F385590

General Info

Members Datasets Scaffolds Average Seq Length
283 174 566 117

Family's Representative Sequence

Representative Sequence 3300020078|Ga0206352_10534658|Ga0206352_105346583
Length 138
Sequence MIAGPSPRAADASRGASWHVGPAAALPAASTGLGHPHPDMLWRGIPLLPRNALLGLLQAYRTVVSPLYGDVCRYYPSCSAYAVGAVQQHGAIKGTALAAARIARCHPWAAGGVDDVKPHRNFRYDLTRHGYVVPPGKD

Samples

Sample ID Description Type Environment
1 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
58 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
59 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
60 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
63 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
64 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
65 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
66 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
67 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
123 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
132 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
133 2643221566 Microbacterium sp. Root166 Isolate Unclassified
134 2643221575 Microbacterium sp. Root61 Isolate Unclassified
135 2643221597 Microbacterium sp. Root180 Isolate Unclassified
136 2643221630 Microbacterium sp. Root322 Isolate Unclassified
137 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
138 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
139 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
140 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
141 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
142 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
143 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
144 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
145 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
146 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
147 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
148 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
149 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
150 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
151 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
152 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
153 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
154 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
155 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
156 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
157 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
158 2919069694 Microbacterium sp. 1154 Isolate Unclassified
159 2919395869 Microbacterium resistens 2980 Isolate Unclassified
160 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
161 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
162 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
163 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
164 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
165 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
166 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
167 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
168 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
169 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
170 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
171 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
172 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
173 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
174 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.68
Metatranscriptomes 7.77
Isolates 15.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 13.07
Nodule 0
Rhizoplane 13.43
Rhizosphere 45.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206352_10534658 3300020078 Bacteria 2434
2 Ga0007427J51700_106821 3300003559 Bacteria 2641
3 Ga0006562J51391_1118410 3300003578 Bacteria 6826
4 Ga0006562J51391_1118412 3300003578 Bacteria 1516
5 Ga0006780_1010203 3300003735 Bacteria 2957
6 Ga0058858_1377713 3300004785 Bacteria 920
7 Ga0065714_10070826 3300005288 Bacteria 3731
8 Ga0070668_100551765 3300005347 Bacteria 1003
9 Ga0070675_100551943 3300005354 Bacteria 1042
10 Ga0070659_100385971 3300005366 Bacteria 1180
11 Ga0068853_100681288 3300005539 Bacteria 980
12 Ga0070672_100075813 3300005543 Bacteria 2686
13 Ga0070665_100526937 3300005548 Bacteria 1193
14 Ga0068855_100655228 3300005563 Bacteria 1127
15 Ga0075365_10024464 3300006038 Bacteria 3811
16 Ga0075365_10987934 3300006038 Bacteria 593
17 Ga0075368_10014070 3300006042 Bacteria 2949
18 Ga0075363_100042831 3300006048 Bacteria 2393
19 Ga0075364_10010329 3300006051 Bacteria 5635
20 Ga0075364_10010472 3300006051 Bacteria 5602
21 Ga0075364_10235182 3300006051 Bacteria 1244
22 Ga0075364_10576798 3300006051 Bacteria 769
23 Ga0075364_10576930 3300006051 Bacteria 769
24 Ga0075362_10172934 3300006177 Bacteria 1044
25 Ga0075367_10014344 3300006178 Bacteria 4289
26 Ga0075367_10306481 3300006178 Bacteria 1000
27 Ga0075369_10007497 3300006186 Bacteria 4157
28 Ga0075369_10013533 3300006186 Bacteria 3241
29 Ga0075370_10017074 3300006353 Bacteria 3917
30 Ga0075370_10548715 3300006353 Bacteria 699
31 Ga0075370_10656323 3300006353 Bacteria 637
32 Ga0105243_10034988 3300009148 Bacteria 3893
33 Ga0105243_10038841 3300009148 Bacteria 3709
34 Ga0105243_10093946 3300009148 Bacteria 2476
35 Ga0105237_10066813 3300009545 Bacteria 3590
36 Ga0105239_10167572 3300010375 Bacteria 2456
37 Ga0157371_10058480 3300013102 Bacteria 2734
38 Ga0157370_10144790 3300013104 Bacteria 2213
39 Ga0157369_10144470 3300013105 Bacteria 2516
40 Ga0171462_1005 3300013250 Bacteria 598379
41 Ga0163162_10047917 3300013306 Bacteria 4282
42 Ga0157375_10054893 3300013308 Bacteria 3926
43 Ga0157375_11164082 3300013308 Bacteria 904
44 Ga0157380_10085790 3300014326 Bacteria 2585
45 Ga0163161_10135458 3300017792 Bacteria 1862
46 Ga0163161_11178818 3300017792 Bacteria 661
47 Ga0206350_11278204 3300020080 Bacteria 1049
48 Ga0206354_10212851 3300020081 Bacteria 2083
49 Ga0206354_10236288 3300020081 Bacteria 1180
50 Ga0224712_10063083 3300022467 Bacteria 1482
51 Ga0224712_10185522 3300022467 Bacteria 939
52 Ga0209646_1000030 3300025246 Bacteria 384216
53 Ga0207647_10050071 3300025904 Bacteria 2588
54 Ga0207671_10843563 3300025914 Bacteria 726
55 Ga0207659_10188396 3300025926 Bacteria 1640
56 Ga0207690_10414043 3300025932 Bacteria 1077
57 Ga0207709_10009357 3300025935 Bacteria 5391
58 Ga0207709_10018720 3300025935 Bacteria 3883
59 Ga0207709_10051072 3300025935 Bacteria 2532
60 Ga0207668_10440458 3300025972 Bacteria 1110
61 Ga0207668_10605614 3300025972 Bacteria 955
62 Ga0207658_10364169 3300025986 Bacteria 1262
63 Ga0207683_10084072 3300026121 Bacteria 2829
64 Ga0207683_11985901 3300026121 Bacteria 530
65 Ga0209813_10034859 3300027866 Bacteria 1504
66 Ga0268266_10558690 3300028379 Bacteria 1097
67 Ga0307410_10160101 3300031852 Bacteria 1686
68 Ga0307406_10000059 3300031901 Bacteria 61305
69 Ga0307406_10000158 3300031901 Bacteria 40639
70 Ga0307406_10002784 3300031901 Bacteria 9549
71 Ga0307406_10110690 3300031901 Bacteria 1890
72 Ga0307406_10224952 3300031901 Bacteria 1397
73 Ga0307406_10330915 3300031901 Bacteria 1182
74 Ga0307406_10411929 3300031901 Bacteria 1074
75 Ga0307406_10889376 3300031901 Bacteria 757
76 Ga0307412_10403390 3300031911 Bacteria 1114
77 Ga0307412_10615150 3300031911 Bacteria 922
78 Ga0307409_100366206 3300031995 Bacteria 1365
79 Ga0307409_100672241 3300031995 Bacteria 1032
80 Ga0307409_100842921 3300031995 Bacteria 927
81 Ga0307416_100126388 3300032002 Bacteria 2291
82 Ga0307416_100450679 3300032002 Bacteria 1339
83 Ga0307416_100759371 3300032002 Bacteria 1063
84 Ga0307416_101572794 3300032002 Bacteria 763
85 Ga0307416_101814475 3300032002 Bacteria 714
86 Ga0307414_10065130 3300032004 Bacteria 2599
87 Ga0307414_10258019 3300032004 Bacteria 1453
88 Ga0307414_10265983 3300032004 Bacteria 1433
89 Ga0307414_10269030 3300032004 Bacteria 1426
90 Ga0307414_10418046 3300032004 Bacteria 1169
91 Ga0307414_10556256 3300032004 Bacteria 1023
92 Ga0307414_10672111 3300032004 Bacteria 935
93 Ga0307414_11822218 3300032004 Bacteria 568
94 Ga0307411_11885777 3300032005 Bacteria 556
95 Ga0307415_101030948 3300032126 Bacteria 766
96 Ga0395898_0168462 3300037466 Bacteria 2094
97 Ga0395901_0113927 3300038443 Bacteria 2840
98 Ga0395901_1859712 3300038443 Bacteria 550
99 Ga0439465_0022440 3300041413 Bacteria 1983
100 Ga0439465_0382479 3300041413 Bacteria 534
101 Ga0451791_0675924 3300041451 Bacteria 813
102 Ga0451793_0637612 3300041452 Bacteria 1384
103 Ga0451793_0974447 3300041452 Bacteria 3316
104 Ga0451797_0088936 3300041453 Bacteria 643
105 Ga0451797_0419480 3300041453 Bacteria 548
106 Ga0451802_0965608 3300041460 Bacteria 599
107 Ga0451835_0481307 3300041492 Bacteria 689
108 Ga0451839_1257840 3300041496 Bacteria 644
109 Ga0451841_1383984 3300041498 Bacteria 1141
110 Ga0451847_0171306 3300041503 Bacteria 805
111 Ga0451849_1430670 3300041505 Bacteria 713
112 Ga0451843_0834440 3300041509 Bacteria 832
113 Ga0451843_0835150 3300041509 Bacteria 733
114 Ga0451853_3279267 3300041512 Bacteria 629
115 Ga0439449_0318321 3300042007 Bacteria 588
116 Ga0466968_0052049 3300044735 Bacteria 1751
117 Ga0466970_0000324 3300044765 Bacteria 23213
118 Ga0466970_0324794 3300044765 Bacteria 870
119 Ga0466958_0054262 3300045836 Bacteria 2431
120 Ga0495627_010849 3300046453 Bacteria 3293
121 Ga0495620_0046290 3300046515 Bacteria 1879
122 Ga0495654_0084177 3300046530 Bacteria 1486
123 Ga0495645_0017432 3300046543 Bacteria 5144
124 Ga0495611_0426518 3300046648 Bacteria 605
125 Ga0495600_0816570 3300046809 Bacteria 555
126 Ga0495581_0469918 3300047315 Bacteria 732
127 Ga0496100_0029507 3300048903 Bacteria 3393
128 Ga0496101_0028497 3300048904 Bacteria 3898
129 Ga0496101_0372039 3300048904 Bacteria 1124
130 Ga0496102_0032109 3300048905 Bacteria 4716
131 Ga0496102_0565336 3300048905 Bacteria 1060
132 Ga0496104_0141709 3300048907 Bacteria 2309
133 Ga0496104_0158397 3300048907 Bacteria 2172
134 Ga0496105_0011174 3300048908 Bacteria 7082
135 Ga0496105_0503519 3300048908 Bacteria 950
136 Ga0496105_1428363 3300048908 Bacteria 500
137 Ga0496106_1002545 3300048909 Bacteria 657
138 Ga0496107_0119212 3300048910 Bacteria 1943
139 Ga0496108_0086633 3300048911 Bacteria 2659
140 Ga0496108_0099552 3300048911 Bacteria 2478
141 Ga0496109_0027012 3300048912 Bacteria 5121
142 Ga0496109_0085492 3300048912 Bacteria 2911
143 Ga0496110_0059706 3300048913 Bacteria 3362
144 Ga0496110_0122673 3300048913 Bacteria 2342
145 Ga0496111_0044780 3300048914 Bacteria 3181
146 Ga0496111_0407767 3300048914 Bacteria 1004
147 Ga0496111_0520846 3300048914 Bacteria 874
148 Ga0496112_0129521 3300048915 Bacteria 2494
149 Ga0496112_0665853 3300048915 Bacteria 970
150 Ga0496113_0019062 3300048916 Bacteria 4793
151 Ga0496113_0038671 3300048916 Bacteria 3508
152 Ga0496113_0250836 3300048916 Bacteria 1413
153 Ga0496114_0012750 3300048917 Bacteria 6732
154 Ga0496114_0024054 3300048917 Bacteria 4971
155 Ga0496114_0326584 3300048917 Bacteria 1356
156 Ga0496114_0380705 3300048917 Bacteria 1249
157 Ga0496115_0044609 3300048918 Bacteria 3537
158 Ga0496115_0555326 3300048918 Bacteria 917
159 Ga0496116_0013658 3300048919 Bacteria 6530
160 Ga0496117_0000994 3300048920 Bacteria 43381
161 Ga0496117_0039068 3300048920 Bacteria 3507
162 Ga0496117_0136869 3300048920 Bacteria 1474
163 Ga0496117_0372457 3300048920 Bacteria 730
164 Ga0496118_0109921 3300048921 Bacteria 1833
165 Ga0496118_0511196 3300048921 Bacteria 595
166 Ga0496119_0001788 3300048922 Bacteria 25044
167 Ga0496119_0015879 3300048922 Bacteria 5765
168 Ga0496119_0020861 3300048922 Bacteria 4756
169 Ga0496119_0094272 3300048922 Bacteria 1694
170 Ga0496119_0286098 3300048922 Bacteria 818
171 Ga0496120_0000922 3300048923 Bacteria 40777
172 Ga0496120_0000935 3300048923 Bacteria 40142
173 Ga0496120_0059646 3300048923 Bacteria 2138
174 Ga0496120_0130222 3300048923 Bacteria 1289
175 Ga0496120_0385389 3300048923 Bacteria 622
176 Ga0496122_0000065 3300048925 Bacteria 235242
177 Ga0496122_0014473 3300048925 Bacteria 7623
178 Ga0496122_0044681 3300048925 Bacteria 3454
179 Ga0496122_0108642 3300048925 Bacteria 1829
180 Ga0496122_0191232 3300048925 Bacteria 1208
181 Ga0496122_0238343 3300048925 Bacteria 1028
182 Ga0496123_0000006 3300048926 Bacteria 647258
183 Ga0496123_0009533 3300048926 Bacteria 8731
184 Ga0496123_0204822 3300048926 Bacteria 1008
185 Ga0496124_0002481 3300048927 Bacteria 24061
186 Ga0496124_0018540 3300048927 Bacteria 6515
187 Ga0496124_0054050 3300048927 Bacteria 3401
188 Ga0496124_0225382 3300048927 Bacteria 1406
189 Ga0496125_0001428 3300048928 Bacteria 34818
190 Ga0496125_0004499 3300048928 Bacteria 16038
191 Ga0496125_0040193 3300048928 Bacteria 4014
192 Ga0496125_0054740 3300048928 Bacteria 3257
193 Ga0496125_0258497 3300048928 Bacteria 1093
194 Ga0496126_0010385 3300048929 Bacteria 9771
195 Ga0496126_0011279 3300048929 Bacteria 9273
196 Ga0496126_0146826 3300048929 Bacteria 2025
197 Ga0496126_0248174 3300048929 Bacteria 1484
198 Ga0501306_058511 3300049127 Bacteria 631
199 Ga0501310_028818 3300049130 Bacteria 729
200 Ga0501317_059389 3300049533 Bacteria 624
201 Ga0501032_0733688 3300049569 Bacteria 625
202 Ga0501034_0217620 3300049571 Bacteria 1863
203 Ga0501034_0286676 3300049571 Bacteria 1586
204 Ga0501037_0290788 3300049573 Bacteria 1137
205 Ga0501038_0009959 3300049574 Bacteria 8704
206 Ga0501038_0134817 3300049574 Bacteria 2024
207 Ga0501038_0264508 3300049574 Bacteria 1358
208 Ga0501039_0340170 3300049575 Bacteria 1179
209 Ga0501043_0212573 3300049579 Bacteria 1499
210 Ga0501043_0388400 3300049579 Bacteria 1056
211 Ga0501070_0000813 3300049586 Bacteria 28354
212 Ga0501070_1353655 3300049586 Bacteria 542
213 nmdc:mga03n38_287901_c1 3300050490 Bacteria 879
214 nmdc:mga03n38_52834_c1 3300050490 Bacteria 1820
215 nmdc:mga00v17_113394_c1 3300050491 Bacteria 1721
216 nmdc:mga00v17_11916_c1 3300050491 Bacteria 4787
217 nmdc:mga00v17_167704_c1 3300050491 Bacteria 1415
218 nmdc:mga00v17_28146_c1 3300050491 Bacteria 3290
219 nmdc:mga00v17_31909_c1 3300050491 Bacteria 3110
220 nmdc:mga00v17_647382_c1 3300050491 Bacteria 680
221 nmdc:mga00v17_773853_c1 3300050491 Bacteria 613
222 nmdc:mga0yw44_14466_c1 3300050492 Bacteria 4192
223 nmdc:mga0yw44_919929_c1 3300050492 Bacteria 593
224 nmdc:mga0yw44_9301_c1 3300050492 Bacteria 4957
225 nmdc:mga0k408_99799_c1 3300050493 Bacteria 1711
226 nmdc:mga06z11_5213_c1 3300050494 Bacteria 5194
227 nmdc:mga04h51_19349_c1 3300050495 Bacteria 2018
228 nmdc:mga07m45_11615_c1 3300050496 Bacteria 4630
229 nmdc:mga0sz30_13104_c1 3300050516 Bacteria 3239
230 nmdc:mga0sz30_230545_c1 3300050516 Bacteria 824
231 nmdc:mga0sz30_9374_c1 3300050516 Bacteria 3723
232 Ga0587084_000410 3300059477 Bacteria 3300
233 Ga0587091_002947 3300059511 Bacteria 2087
234 Ga0587094_025891 3300059513 Bacteria 882
235 Ga0587101_001673 3300059623 Bacteria 1965
236 Ga0587115_002785 3300059626 Bacteria 1776
237 Ga0587100_001154 3300059648 Bacteria 1477
238 Ga0587124_030289 3300059660 Bacteria 595
239 Ga0587111_0006304 3300060346 Bacteria 1876
240 2588107527 2585428157 Bacteria 3018951
241 2643735265 2643221542 Bacteria 3563959
242 2643847354 2643221566 Bacteria 3460379
243 2643887533 2643221575 Bacteria 4022601
244 2643997343 2643221597 Bacteria 3347721
245 2644172103 2643221630 Bacteria 3601215
246 2644678375 2643221724 Bacteria 3593515
247 2730231374 2728369380 Bacteria 3620317
248 2747954025 2747842429 Bacteria 3914386
249 2758225285 2757320536 Bacteria 3629334
250 2774379429 2773857758 Bacteria 3592392
251 2774397469 2773857763 Bacteria 4180068
252 2808629408 2808606306 Bacteria 3608896
253 2808884330 2808606368 Bacteria 3174172
254 2809225834 2808606447 Bacteria 3572005
255 2812325192 2811994872 Bacteria 4121241
256 2821271848 2821268502 Bacteria 3750023
257 2833712892 2833709550 Bacteria 4008291
258 2852635290 2852632344 Bacteria 3463163
259 2852649645 2852646457 Bacteria 3408613
260 2852666738 2852663356 Bacteria 4090475
261 2857722688 2857720070 Bacteria 3189373
262 2857726039 2857723135 Bacteria 4217853
263 2870628673 2870628048 Bacteria 3696012
264 2904512285 2904509784 Bacteria 3520416
265 2906802550 2906799679 Bacteria 4031749
266 2908679542 2908678064 Bacteria 3482747
267 2919070188 2919069694 Bacteria 3622919
268 2919398447 2919395869 Bacteria 3704152
269 2945969759 2945968032 Bacteria 4111363
270 2946035651 2946033335 Bacteria 3835514
271 2946042139 2946041624 Bacteria 4191385
272 2946083065 2946080515 Bacteria 4310960
273 2974295483 2974294766 Bacteria 3767688
274 2974324714 2974324384 Bacteria 3750535
275 2977229746 2977228692 Bacteria 3450105
276 2977238208 2977236895 Bacteria 3569373
277 2977265000 2977264416 Bacteria 3750737
278 2984544008 2984542743 Bacteria 3569378
279 2984582899 2984580707 Bacteria 3351387
280 8004182779 8004182704 Bacteria 3391155
281 8004215538 8004212874 Bacteria 2861420
282 8016255684 8016254467 Bacteria 3797036
283 8045833207 8045830549 Bacteria 4444727
284 Ga0206352_10534658
285 Ga0007427J51700_106821
286 Ga0006562J51391_1118410
287 Ga0006562J51391_1118412
288 Ga0006780_1010203
289 Ga0058858_1377713
290 Ga0065714_10070826
291 Ga0070668_100551765
292 Ga0070675_100551943
293 Ga0070659_100385971
294 Ga0068853_100681288
295 Ga0070672_100075813
296 Ga0070665_100526937
297 Ga0068855_100655228
298 Ga0075365_10024464
299 Ga0075365_10987934
300 Ga0075368_10014070
301 Ga0075363_100042831
302 Ga0075364_10010329
303 Ga0075364_10010472
304 Ga0075364_10235182
305 Ga0075364_10576798
306 Ga0075364_10576930
307 Ga0075362_10172934
308 Ga0075367_10014344
309 Ga0075367_10306481
310 Ga0075369_10007497
311 Ga0075369_10013533
312 Ga0075370_10017074
313 Ga0075370_10548715
314 Ga0075370_10656323
315 Ga0105243_10034988
316 Ga0105243_10038841
317 Ga0105243_10093946
318 Ga0105237_10066813
319 Ga0105239_10167572
320 Ga0157371_10058480
321 Ga0157370_10144790
322 Ga0157369_10144470
323 Ga0171462_1005
324 Ga0163162_10047917
325 Ga0157375_10054893
326 Ga0157375_11164082
327 Ga0157380_10085790
328 Ga0163161_10135458
329 Ga0163161_11178818
330 Ga0206350_11278204
331 Ga0206354_10212851
332 Ga0206354_10236288
333 Ga0224712_10063083
334 Ga0224712_10185522
335 Ga0209646_1000030
336 Ga0207647_10050071
337 Ga0207671_10843563
338 Ga0207659_10188396
339 Ga0207690_10414043
340 Ga0207709_10009357
341 Ga0207709_10018720
342 Ga0207709_10051072
343 Ga0207668_10440458
344 Ga0207668_10605614
345 Ga0207658_10364169
346 Ga0207683_10084072
347 Ga0207683_11985901
348 Ga0209813_10034859
349 Ga0268266_10558690
350 Ga0307410_10160101
351 Ga0307406_10000059
352 Ga0307406_10000158
353 Ga0307406_10002784
354 Ga0307406_10110690
355 Ga0307406_10224952
356 Ga0307406_10330915
357 Ga0307406_10411929
358 Ga0307406_10889376
359 Ga0307412_10403390
360 Ga0307412_10615150
361 Ga0307409_100366206
362 Ga0307409_100672241
363 Ga0307409_100842921
364 Ga0307416_100126388
365 Ga0307416_100450679
366 Ga0307416_100759371
367 Ga0307416_101572794
368 Ga0307416_101814475
369 Ga0307414_10065130
370 Ga0307414_10258019
371 Ga0307414_10265983
372 Ga0307414_10269030
373 Ga0307414_10418046
374 Ga0307414_10556256
375 Ga0307414_10672111
376 Ga0307414_11822218
377 Ga0307411_11885777
378 Ga0307415_101030948
379 Ga0395898_0168462
380 Ga0395901_0113927
381 Ga0395901_1859712
382 Ga0439465_0022440
383 Ga0439465_0382479
384 Ga0451791_0675924
385 Ga0451793_0637612
386 Ga0451793_0974447
387 Ga0451797_0088936
388 Ga0451797_0419480
389 Ga0451802_0965608
390 Ga0451835_0481307
391 Ga0451839_1257840
392 Ga0451841_1383984
393 Ga0451847_0171306
394 Ga0451849_1430670
395 Ga0451843_0834440
396 Ga0451843_0835150
397 Ga0451853_3279267
398 Ga0439449_0318321
399 Ga0466968_0052049
400 Ga0466970_0000324
401 Ga0466970_0324794
402 Ga0466958_0054262
403 Ga0495627_010849
404 Ga0495620_0046290
405 Ga0495654_0084177
406 Ga0495645_0017432
407 Ga0495611_0426518
408 Ga0495600_0816570
409 Ga0495581_0469918
410 Ga0496100_0029507
411 Ga0496101_0028497
412 Ga0496101_0372039
413 Ga0496102_0032109
414 Ga0496102_0565336
415 Ga0496104_0141709
416 Ga0496104_0158397
417 Ga0496105_0011174
418 Ga0496105_0503519
419 Ga0496105_1428363
420 Ga0496106_1002545
421 Ga0496107_0119212
422 Ga0496108_0086633
423 Ga0496108_0099552
424 Ga0496109_0027012
425 Ga0496109_0085492
426 Ga0496110_0059706
427 Ga0496110_0122673
428 Ga0496111_0044780
429 Ga0496111_0407767
430 Ga0496111_0520846
431 Ga0496112_0129521
432 Ga0496112_0665853
433 Ga0496113_0019062
434 Ga0496113_0038671
435 Ga0496113_0250836
436 Ga0496114_0012750
437 Ga0496114_0024054
438 Ga0496114_0326584
439 Ga0496114_0380705
440 Ga0496115_0044609
441 Ga0496115_0555326
442 Ga0496116_0013658
443 Ga0496117_0000994
444 Ga0496117_0039068
445 Ga0496117_0136869
446 Ga0496117_0372457
447 Ga0496118_0109921
448 Ga0496118_0511196
449 Ga0496119_0001788
450 Ga0496119_0015879
451 Ga0496119_0020861
452 Ga0496119_0094272
453 Ga0496119_0286098
454 Ga0496120_0000922
455 Ga0496120_0000935
456 Ga0496120_0059646
457 Ga0496120_0130222
458 Ga0496120_0385389
459 Ga0496122_0000065
460 Ga0496122_0014473
461 Ga0496122_0044681
462 Ga0496122_0108642
463 Ga0496122_0191232
464 Ga0496122_0238343
465 Ga0496123_0000006
466 Ga0496123_0009533
467 Ga0496123_0204822
468 Ga0496124_0002481
469 Ga0496124_0018540
470 Ga0496124_0054050
471 Ga0496124_0225382
472 Ga0496125_0001428
473 Ga0496125_0004499
474 Ga0496125_0040193
475 Ga0496125_0054740
476 Ga0496125_0258497
477 Ga0496126_0010385
478 Ga0496126_0011279
479 Ga0496126_0146826
480 Ga0496126_0248174
481 Ga0501306_058511
482 Ga0501310_028818
483 Ga0501317_059389
484 Ga0501032_0733688
485 Ga0501034_0217620
486 Ga0501034_0286676
487 Ga0501037_0290788
488 Ga0501038_0009959
489 Ga0501038_0134817
490 Ga0501038_0264508
491 Ga0501039_0340170
492 Ga0501043_0212573
493 Ga0501043_0388400
494 Ga0501070_0000813
495 Ga0501070_1353655
496 nmdc:mga03n38_287901_c1
497 nmdc:mga03n38_52834_c1
498 nmdc:mga00v17_113394_c1
499 nmdc:mga00v17_11916_c1
500 nmdc:mga00v17_167704_c1
501 nmdc:mga00v17_28146_c1
502 nmdc:mga00v17_31909_c1
503 nmdc:mga00v17_647382_c1
504 nmdc:mga00v17_773853_c1
505 nmdc:mga0yw44_14466_c1
506 nmdc:mga0yw44_919929_c1
507 nmdc:mga0yw44_9301_c1
508 nmdc:mga0k408_99799_c1
509 nmdc:mga06z11_5213_c1
510 nmdc:mga04h51_19349_c1
511 nmdc:mga07m45_11615_c1
512 nmdc:mga0sz30_13104_c1
513 nmdc:mga0sz30_230545_c1
514 nmdc:mga0sz30_9374_c1
515 Ga0587084_000410
516 Ga0587091_002947
517 Ga0587094_025891
518 Ga0587101_001673
519 Ga0587115_002785
520 Ga0587100_001154
521 Ga0587124_030289
522 Ga0587111_0006304
523 2588107527
524 2643735265
525 2643847354
526 2643887533
527 2643997343
528 2644172103
529 2644678375
530 2730231374
531 2747954025
532 2758225285
533 2774379429
534 2774397469
535 2808629408
536 2808884330
537 2809225834
538 2812325192
539 2821271848
540 2833712892
541 2852635290
542 2852649645
543 2852666738
544 2857722688
545 2857726039
546 2870628673
547 2904512285
548 2906802550
549 2908679542
550 2919070188
551 2919398447
552 2945969759
553 2946035651
554 2946042139
555 2946083065
556 2974295483
557 2974324714
558 2977229746
559 2977238208
560 2977265000
561 2984544008
562 2984582899
563 8004182779
564 8004215538
565 8016255684
566 8045833207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01809

YidD

Putative membrane protein insertion efficiency factor

50

116

0.97

Map