F385583

General Info

Members Datasets Scaffolds Average Seq Length
283 166 566 340

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10013467|Ga0157379_100134673
Length 369
Sequence MAEDSSHWRGPDLVKHRPINGAIGVETTMKRLSGLLVLALALAGVMLAQGGGLINGAGATFPYPIYSKWFDQFHKANGAQINYQSVGSGAGIKQVTEGTVDFGASDGPMNDDQLKAYRAKNGTGILHFPTVLGAAVPTYNIPGVNETLNFTPDALAGIFLGRISKWNDPAIANANKGVNLPGNDIVVIHRSDGSGTTYIWTDYLSKVSGDWKDKVGKGTSVNWPVGLGGKGNEGVTGLLKQTPNSIGYVELIYAAQNKINYGTVKNLAGAFVKADLASVSEAAAGASKTMPEDFRVSITNAPGKTAYPISSFTWLLIPEKFKDATKRDTIKNFVKWAITDGQGDAEALSYAKLPKEVVDKELKALSKVQ

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.53
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 8.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10013467 3300014968 Bacteria 7166
2 JGI25405J52794_10000611 3300003911 Bacteria 5315
3 Ga0070683_100060375 3300005329 Archaea 3524
4 Ga0070683_100423438 3300005329 Bacteria 1270
5 Ga0068868_100005318 3300005338 Archaea 9045
6 Ga0070668_100096189 3300005347 Bacteria 2340
7 Ga0070671_100075066 3300005355 Bacteria 2824
8 Ga0070709_10004379 3300005434 Bacteria 7610
9 Ga0070709_10044429 3300005434 Bacteria 2751
10 Ga0070709_10107433 3300005434 Bacteria 1870
11 Ga0070709_10166643 3300005434 Bacteria 1536
12 Ga0070714_100001838 3300005435 Bacteria 15447
13 Ga0070713_100001735 3300005436 Bacteria 14033
14 Ga0070713_100018737 3300005436 Bacteria 5266
15 Ga0070713_100051816 3300005436 Bacteria 3396
16 Ga0070713_100135522 3300005436 Bacteria 2175
17 Ga0070711_100002689 3300005439 Bacteria 10202
18 Ga0070711_100012404 3300005439 Bacteria 5323
19 Ga0070711_100108560 3300005439 Bacteria 2033
20 Ga0070711_100170922 3300005439 Bacteria 1656
21 Ga0070711_100333339 3300005439 Bacteria 1215
22 Ga0070708_100002211 3300005445 Bacteria 15036
23 Ga0070708_100004551 3300005445 Bacteria 10920
24 Ga0070708_100009332 3300005445 Bacteria 7906
25 Ga0070708_100011093 3300005445 Bacteria 7322
26 Ga0070708_100016503 3300005445 Bacteria 6130
27 Ga0070708_100042477 3300005445 Bacteria 3991
28 Ga0070708_100414822 3300005445 Unclassified 1270
29 Ga0070708_100499540 3300005445 Bacteria 1147
30 Ga0070681_10011502 3300005458 Bacteria 8761
31 Ga0070681_10037105 3300005458 Bacteria 4891
32 Ga0070706_100007624 3300005467 Bacteria 10128
33 Ga0070706_100011352 3300005467 Bacteria 8278
34 Ga0070707_100009238 3300005468 Bacteria 9148
35 Ga0070707_100011133 3300005468 Bacteria 8381
36 Ga0070707_100020665 3300005468 Bacteria 6214
37 Ga0070707_100035941 3300005468 Unclassified 4727
38 Ga0070707_100056940 3300005468 Bacteria 3750
39 Ga0070707_100077048 3300005468 Bacteria 3217
40 Ga0070707_100115567 3300005468 Unclassified 2604
41 Ga0070698_100000091 3300005471 Bacteria 71604
42 Ga0070698_100002372 3300005471 Bacteria 20787
43 Ga0070698_100058764 3300005471 Bacteria 3887
44 Ga0070698_100084806 3300005471 Bacteria 3156
45 Ga0070698_100166644 3300005471 Bacteria 2146
46 Ga0070699_100001047 3300005518 Bacteria 25758
47 Ga0070699_100002850 3300005518 Bacteria 15421
48 Ga0070699_100067589 3300005518 Bacteria 3104
49 Ga0070699_100090811 3300005518 Bacteria 2670
50 Ga0070679_100003099 3300005530 Bacteria 15189
51 Ga0070697_100001046 3300005536 Bacteria 20897
52 Ga0070697_100004847 3300005536 Bacteria 10317
53 Ga0070697_100090542 3300005536 Bacteria 2528
54 Ga0070697_100142786 3300005536 Bacteria 2014
55 Ga0070686_100126522 3300005544 Bacteria 1761
56 Ga0070696_100151161 3300005546 Bacteria 1704
57 Ga0070693_100027232 3300005547 Archaea 3095
58 Ga0070665_100013348 3300005548 Bacteria 8268
59 Ga0070665_100132838 3300005548 Bacteria 2491
60 Ga0068855_100032783 3300005563 Bacteria 6201
61 Ga0070702_100012188 3300005615 Bacteria 4301
62 Ga0068852_100163923 3300005616 Bacteria 2078
63 Ga0068858_100085541 3300005842 Bacteria 2934
64 Ga0068860_100140356 3300005843 Bacteria 2322
65 Ga0070717_10007661 3300006028 Bacteria 8026
66 Ga0070717_10281688 3300006028 Bacteria 1475
67 Ga0070715_10096711 3300006163 Bacteria 1369
68 Ga0070716_100001004 3300006173 Bacteria 12326
69 Ga0070716_100077056 3300006173 Bacteria 1978
70 Ga0070712_100008758 3300006175 Bacteria 6368
71 Ga0070712_100024994 3300006175 Bacteria 3965
72 Ga0097621_100001209 3300006237 Bacteria 17879
73 Ga0097621_100015017 3300006237 Archaea 5814
74 Ga0068871_100002582 3300006358 Archaea 12362
75 Ga0068871_100003696 3300006358 Bacteria 10516
76 Ga0068871_100061982 3300006358 Bacteria 3056
77 Ga0075434_100002952 3300006871 Bacteria 15118
78 Ga0075434_100041580 3300006871 Bacteria 4554
79 Ga0075434_100087199 3300006871 Bacteria 3122
80 Ga0075434_100262162 3300006871 Bacteria 1747
81 Ga0075434_100412556 3300006871 Bacteria 1372
82 Ga0075436_100003922 3300006914 Bacteria 10195
83 Ga0075435_100425400 3300007076 Bacteria 1144
84 Ga0099794_10002623 3300007265 Bacteria 6685
85 Ga0099795_10005961 3300007788 Bacteria 3288
86 Ga0099795_10009811 3300007788 Bacteria 2794
87 Ga0105240_10064853 3300009093 Bacteria 4537
88 Ga0105240_10445117 3300009093 Unclassified 1451
89 Ga0105240_10531761 3300009093 Bacteria 1303
90 Ga0105240_10536175 3300009093 Bacteria 1297
91 Ga0105245_10009194 3300009098 Bacteria 8616
92 Ga0105245_10205427 3300009098 Bacteria 1893
93 Ga0105242_10014580 3300009176 Bacteria 6086
94 Ga0105242_10324579 3300009176 Archaea 1413
95 Ga0105248_10005471 3300009177 Bacteria 13958
96 Ga0105248_10071554 3300009177 Bacteria 3896
97 Ga0105248_10233721 3300009177 Bacteria 2069
98 Ga0105237_10104079 3300009545 Bacteria 2830
99 Ga0105238_10289190 3300009551 Bacteria 1621
100 Ga0105249_10339833 3300009553 Bacteria 1518
101 Ga0099796_10003954 3300010159 Bacteria 3520
102 Ga0105239_10247157 3300010375 Bacteria 2003
103 Ga0157369_10191858 3300013105 Archaea 2147
104 Ga0157374_10016558 3300013296 Bacteria 6483
105 Ga0157374_10024260 3300013296 Archaea 5435
106 Ga0157378_10000262 3300013297 Bacteria 51559
107 Ga0157378_10003859 3300013297 Bacteria 13259
108 Ga0157378_10023559 3300013297 Bacteria 5415
109 Ga0157378_10083586 3300013297 Bacteria 2889
110 Ga0157378_10339296 3300013297 Archaea 1465
111 Ga0163162_10079486 3300013306 Bacteria 3346
112 Ga0157372_10102937 3300013307 Archaea 3262
113 Ga0157375_10020731 3300013308 Bacteria 6014
114 Ga0157375_10054411 3300013308 Bacteria 3941
115 Ga0163163_10139632 3300014325 Bacteria 2465
116 Ga0163163_10295227 3300014325 Bacteria 1673
117 Ga0182008_10022076 3300014497 Unclassified 3261
118 Ga0157379_10201039 3300014968 Bacteria 1802
119 Ga0157376_10000005 3300014969 Bacteria 443695
120 Ga0157376_10000707 3300014969 Bacteria 21590
121 Ga0157376_10001503 3300014969 Archaea 15388
122 Ga0157376_10037602 3300014969 Bacteria 3931
123 Ga0207692_10027286 3300025898 Unclassified 2689
124 Ga0207685_10094016 3300025905 Bacteria 1269
125 Ga0207699_10025891 3300025906 Bacteria 3227
126 Ga0207699_10114004 3300025906 Bacteria 1738
127 Ga0207684_10000383 3300025910 Bacteria 59620
128 Ga0207684_10004519 3300025910 Bacteria 13072
129 Ga0207684_10060779 3300025910 Unclassified 3209
130 Ga0207684_10061098 3300025910 Unclassified 3200
131 Ga0207684_10160041 3300025910 Bacteria 1939
132 Ga0207707_10027720 3300025912 Bacteria 4954
133 Ga0207707_10080999 3300025912 Bacteria 2834
134 Ga0207695_10035616 3300025913 Bacteria 5394
135 Ga0207695_10052978 3300025913 Bacteria 4247
136 Ga0207671_10187660 3300025914 Bacteria 1611
137 Ga0207693_10005694 3300025915 Bacteria 10356
138 Ga0207693_10013790 3300025915 Bacteria 6507
139 Ga0207693_10018214 3300025915 Bacteria 5595
140 Ga0207693_10026652 3300025915 Unclassified 4573
141 Ga0207693_10048681 3300025915 Bacteria 3328
142 Ga0207693_10090067 3300025915 Bacteria 2404
143 Ga0207663_10027764 3300025916 Bacteria 3304
144 Ga0207663_10031840 3300025916 Bacteria 3125
145 Ga0207663_10088999 3300025916 Bacteria 2043
146 Ga0207663_10124089 3300025916 Bacteria 1773
147 Ga0207663_10142730 3300025916 Bacteria 1670
148 Ga0207663_10212526 3300025916 Bacteria 1403
149 Ga0207657_10236371 3300025919 Archaea 1460
150 Ga0207652_10014579 3300025921 Bacteria 6371
151 Ga0207652_10204598 3300025921 Bacteria 1777
152 Ga0207646_10000229 3300025922 Bacteria 77035
153 Ga0207646_10001165 3300025922 Bacteria 33348
154 Ga0207646_10015648 3300025922 Bacteria 7152
155 Ga0207646_10073690 3300025922 Bacteria 3050
156 Ga0207646_10074203 3300025922 Bacteria 3039
157 Ga0207646_10102127 3300025922 Bacteria 2571
158 Ga0207646_10195818 3300025922 Unclassified 1825
159 Ga0207694_10031635 3300025924 Bacteria 4044
160 Ga0207694_10285497 3300025924 Bacteria 1356
161 Ga0207650_10281305 3300025925 Bacteria 1355
162 Ga0207687_10022611 3300025927 Plasmid 4186
163 Ga0207700_10022096 3300025928 Bacteria 4358
164 Ga0207664_10001978 3300025929 Bacteria 13487
165 Ga0207644_10044098 3300025931 Bacteria 3167
166 Ga0207644_10277477 3300025931 Bacteria 1345
167 Ga0207665_10007507 3300025939 Bacteria 7206
168 Ga0207665_10021042 3300025939 Unclassified 4287
169 Ga0207665_10027769 3300025939 Bacteria 3739
170 Ga0207665_10103796 3300025939 Bacteria 1989
171 Ga0207711_10003720 3300025941 Bacteria 13147
172 Ga0207661_10383572 3300025944 Bacteria 1272
173 Ga0207703_10166519 3300026035 Bacteria 1935
174 Ga0207703_10282253 3300026035 Bacteria 1509
175 Ga0207702_10006345 3300026078 Archaea 10212
176 Ga0207641_10029384 3300026088 Unclassified 4545
177 Ga0207683_10102819 3300026121 Bacteria 2552
178 Ga0209588_1004958 3300027671 Bacteria 3785
179 Ga0268266_10000698 3300028379 Bacteria 45298
180 Ga0268266_10226645 3300028379 Bacteria 1720
181 Ga0268265_10125798 3300028380 Bacteria 2121
182 Ga0268264_10221352 3300028381 Unclassified 1742
183 Ga0265338_10005692 3300028800 Bacteria 16121
184 Ga0265338_10043119 3300028800 Bacteria 4189
185 Ga0265338_10216073 3300028800 Bacteria 1436
186 Ga0265332_10019431 3300031238 Bacteria 2999
187 Ga0265320_10030925 3300031240 Bacteria 2754
188 Ga0265325_10068783 3300031241 Bacteria 1782
189 Ga0265325_10107133 3300031241 Bacteria 1362
190 Ga0265329_10011457 3300031242 Bacteria 3221
191 Ga0265329_10018155 3300031242 Unclassified 2409
192 Ga0265340_10022712 3300031247 Bacteria 3205
193 Ga0265339_10003305 3300031249 Bacteria 11291
194 Ga0265331_10006739 3300031250 Bacteria 6731
195 Ga0265316_10002519 3300031344 Bacteria 18943
196 Ga0265316_10009379 3300031344 Bacteria 9011
197 Ga0265316_10165805 3300031344 Bacteria 1650
198 Ga0265314_10061455 3300031711 Unclassified 2558
199 Ga0265342_10110018 3300031712 Bacteria 1560
200 Ga0307407_10029206 3300031903 Bacteria 2959
201 Ga0373934_0001628 3300035086 Bacteria 8239
202 Ga0373956_0001335 3300035119 Bacteria 10190
203 Ga0373957_0039989 3300035120 Bacteria 1761
204 Ga0373955_0000157 3300035172 Bacteria 27419
205 Ga0373927_0002985 3300035695 Bacteria 12268
206 Ga0373933_0003395 3300035724 Bacteria 8878
207 Ga0373933_0070604 3300035724 Bacteria 2125
208 Ga0373937_0000693 3300036401 Bacteria 29361
209 Ga0373937_0010258 3300036401 Bacteria 8177
210 Ga0373937_0015463 3300036401 Bacteria 6748
211 Ga0373937_0081699 3300036401 Bacteria 2990
212 Ga0395900_0473695 3300037418 Bacteria 1205
213 Ga0436364_0641766 3300037853 Bacteria 2629
214 Ga0395901_0001234 3300038443 Bacteria 27294
215 Ga0451577_0009730 3300042876 Bacteria 9217
216 Ga0466967_0535556 3300045976 Archaea 1152
217 Ga0495603_0091177 3300046455 Bacteria 1782
218 Ga0495629_0121162 3300046459 Bacteria 1822
219 Ga0495651_0006515 3300046462 Bacteria 8920
220 Ga0495582_0001568 3300046473 Bacteria 12887
221 Ga0495582_0022246 3300046473 Bacteria 3469
222 Ga0495582_0087584 3300046473 Unclassified 1734
223 Ga0495639_0010604 3300046475 Bacteria 3969
224 Ga0495662_0068814 3300046476 Bacteria 1715
225 Ga0495594_0009108 3300046499 Bacteria 5125
226 Ga0495630_0047039 3300046517 Bacteria 3226
227 Ga0495666_0012395 3300046526 Bacteria 4250
228 Ga0495587_0000510 3300046536 Bacteria 27033
229 Ga0495634_0017314 3300046642 Bacteria 5145
230 Ga0495623_0154039 3300046679 Bacteria 1356
231 Ga0495647_0065576 3300046681 Unclassified 1442
232 Ga0495604_0000275 3300047317 Bacteria 45903
233 Ga0495674_0281105 3300047319 Unclassified 1363
234 Ga0495680_0091090 3300047322 Bacteria 2286
235 Ga0495684_0065862 3300047471 Bacteria 2754
236 Ga0495602_0025975 3300048088 Bacteria 5658
237 Ga0495614_0021985 3300048089 Bacteria 2754
238 Ga0496100_0148360 3300048903 Bacteria 1670
239 Ga0496102_0002125 3300048905 Bacteria 17034
240 Ga0496106_0049825 3300048909 Archaea 3156
241 Ga0496107_0176528 3300048910 Bacteria 1586
242 Ga0496112_0031005 3300048915 Bacteria 5181
243 Ga0496112_0100450 3300048915 Bacteria 2862
244 Ga0496112_0109452 3300048915 Bacteria 2733
245 Ga0496114_0011326 3300048917 Bacteria 7123
246 Ga0496114_0089332 3300048917 Bacteria 2615
247 Ga0496115_0006271 3300048918 Bacteria 8698
248 Ga0501033_0005380 3300049570 Bacteria 10144
249 Ga0501034_0078260 3300049571 Unclassified 3311
250 Ga0501036_0000498 3300049572 Bacteria 28138
251 Ga0501037_0003838 3300049573 Bacteria 10912
252 Ga0501038_0028959 3300049574 Unclassified 4913
253 Ga0501039_0037621 3300049575 Bacteria 3736
254 Ga0501042_0053515 3300049578 Bacteria 2880
255 Ga0501043_0006639 3300049579 Bacteria 9259
256 Ga0501046_0002887 3300049580 Bacteria 15937
257 Ga0501047_0020593 3300049581 Bacteria 6333
258 Ga0501048_0018756 3300049582 Bacteria 5086
259 Ga0501067_0007862 3300049583 Bacteria 5926
260 Ga0501068_0000768 3300049584 Bacteria 16530
261 Ga0501069_0024464 3300049585 Bacteria 3294
262 Ga0501070_0006405 3300049586 Bacteria 10015
263 Ga0501072_0000320 3300049588 Bacteria 34200
264 Ga0501073_0000432 3300049589 Bacteria 28777
265 Ga0501074_0021504 3300049590 Bacteria 4683
266 Ga0501076_0030634 3300049592 Bacteria 4192
267 Ga0501077_0000457 3300049593 Bacteria 24786
268 Ga0501079_0051351 3300049741 Unclassified 3183
269 Ga0501080_0000559 3300049742 Bacteria 29429
270 Ga0501083_0053553 3300049744 Bacteria 2708
271 Ga0501035_0044272 3300049822 Unclassified 4008
272 Ga0501035_0171708 3300049822 Bacteria 1873
273 Ga0501044_0001357 3300049823 Bacteria 28736
274 Ga0501044_0014229 3300049823 Bacteria 8592
275 Ga0501045_0057801 3300049824 Bacteria 2839
276 nmdc:mga06r32_227026_c1 3300050510 Bacteria 1855
277 nmdc:mga0n895_14090_c1 3300050512 Bacteria 7248
278 nmdc:mga0n895_192968_c1 3300050512 Bacteria 2068
279 nmdc:mga0n895_33178_c1 3300050512 Unclassified 4960
280 nmdc:mga0n895_409075_c1 3300050512 Bacteria 1372
281 nmdc:mga08x19_57286_c1 3300050514 Bacteria 2518
282 Ga0501084_0002811 3300054114 Bacteria 14056
283 Ga0501082_0063359 3300060353 Unclassified 3183
284 Ga0157379_10013467
285 JGI25405J52794_10000611
286 Ga0070683_100060375
287 Ga0070683_100423438
288 Ga0068868_100005318
289 Ga0070668_100096189
290 Ga0070671_100075066
291 Ga0070709_10004379
292 Ga0070709_10044429
293 Ga0070709_10107433
294 Ga0070709_10166643
295 Ga0070714_100001838
296 Ga0070713_100001735
297 Ga0070713_100018737
298 Ga0070713_100051816
299 Ga0070713_100135522
300 Ga0070711_100002689
301 Ga0070711_100012404
302 Ga0070711_100108560
303 Ga0070711_100170922
304 Ga0070711_100333339
305 Ga0070708_100002211
306 Ga0070708_100004551
307 Ga0070708_100009332
308 Ga0070708_100011093
309 Ga0070708_100016503
310 Ga0070708_100042477
311 Ga0070708_100414822
312 Ga0070708_100499540
313 Ga0070681_10011502
314 Ga0070681_10037105
315 Ga0070706_100007624
316 Ga0070706_100011352
317 Ga0070707_100009238
318 Ga0070707_100011133
319 Ga0070707_100020665
320 Ga0070707_100035941
321 Ga0070707_100056940
322 Ga0070707_100077048
323 Ga0070707_100115567
324 Ga0070698_100000091
325 Ga0070698_100002372
326 Ga0070698_100058764
327 Ga0070698_100084806
328 Ga0070698_100166644
329 Ga0070699_100001047
330 Ga0070699_100002850
331 Ga0070699_100067589
332 Ga0070699_100090811
333 Ga0070679_100003099
334 Ga0070697_100001046
335 Ga0070697_100004847
336 Ga0070697_100090542
337 Ga0070697_100142786
338 Ga0070686_100126522
339 Ga0070696_100151161
340 Ga0070693_100027232
341 Ga0070665_100013348
342 Ga0070665_100132838
343 Ga0068855_100032783
344 Ga0070702_100012188
345 Ga0068852_100163923
346 Ga0068858_100085541
347 Ga0068860_100140356
348 Ga0070717_10007661
349 Ga0070717_10281688
350 Ga0070715_10096711
351 Ga0070716_100001004
352 Ga0070716_100077056
353 Ga0070712_100008758
354 Ga0070712_100024994
355 Ga0097621_100001209
356 Ga0097621_100015017
357 Ga0068871_100002582
358 Ga0068871_100003696
359 Ga0068871_100061982
360 Ga0075434_100002952
361 Ga0075434_100041580
362 Ga0075434_100087199
363 Ga0075434_100262162
364 Ga0075434_100412556
365 Ga0075436_100003922
366 Ga0075435_100425400
367 Ga0099794_10002623
368 Ga0099795_10005961
369 Ga0099795_10009811
370 Ga0105240_10064853
371 Ga0105240_10445117
372 Ga0105240_10531761
373 Ga0105240_10536175
374 Ga0105245_10009194
375 Ga0105245_10205427
376 Ga0105242_10014580
377 Ga0105242_10324579
378 Ga0105248_10005471
379 Ga0105248_10071554
380 Ga0105248_10233721
381 Ga0105237_10104079
382 Ga0105238_10289190
383 Ga0105249_10339833
384 Ga0099796_10003954
385 Ga0105239_10247157
386 Ga0157369_10191858
387 Ga0157374_10016558
388 Ga0157374_10024260
389 Ga0157378_10000262
390 Ga0157378_10003859
391 Ga0157378_10023559
392 Ga0157378_10083586
393 Ga0157378_10339296
394 Ga0163162_10079486
395 Ga0157372_10102937
396 Ga0157375_10020731
397 Ga0157375_10054411
398 Ga0163163_10139632
399 Ga0163163_10295227
400 Ga0182008_10022076
401 Ga0157379_10201039
402 Ga0157376_10000005
403 Ga0157376_10000707
404 Ga0157376_10001503
405 Ga0157376_10037602
406 Ga0207692_10027286
407 Ga0207685_10094016
408 Ga0207699_10025891
409 Ga0207699_10114004
410 Ga0207684_10000383
411 Ga0207684_10004519
412 Ga0207684_10060779
413 Ga0207684_10061098
414 Ga0207684_10160041
415 Ga0207707_10027720
416 Ga0207707_10080999
417 Ga0207695_10035616
418 Ga0207695_10052978
419 Ga0207671_10187660
420 Ga0207693_10005694
421 Ga0207693_10013790
422 Ga0207693_10018214
423 Ga0207693_10026652
424 Ga0207693_10048681
425 Ga0207693_10090067
426 Ga0207663_10027764
427 Ga0207663_10031840
428 Ga0207663_10088999
429 Ga0207663_10124089
430 Ga0207663_10142730
431 Ga0207663_10212526
432 Ga0207657_10236371
433 Ga0207652_10014579
434 Ga0207652_10204598
435 Ga0207646_10000229
436 Ga0207646_10001165
437 Ga0207646_10015648
438 Ga0207646_10073690
439 Ga0207646_10074203
440 Ga0207646_10102127
441 Ga0207646_10195818
442 Ga0207694_10031635
443 Ga0207694_10285497
444 Ga0207650_10281305
445 Ga0207687_10022611
446 Ga0207700_10022096
447 Ga0207664_10001978
448 Ga0207644_10044098
449 Ga0207644_10277477
450 Ga0207665_10007507
451 Ga0207665_10021042
452 Ga0207665_10027769
453 Ga0207665_10103796
454 Ga0207711_10003720
455 Ga0207661_10383572
456 Ga0207703_10166519
457 Ga0207703_10282253
458 Ga0207702_10006345
459 Ga0207641_10029384
460 Ga0207683_10102819
461 Ga0209588_1004958
462 Ga0268266_10000698
463 Ga0268266_10226645
464 Ga0268265_10125798
465 Ga0268264_10221352
466 Ga0265338_10005692
467 Ga0265338_10043119
468 Ga0265338_10216073
469 Ga0265332_10019431
470 Ga0265320_10030925
471 Ga0265325_10068783
472 Ga0265325_10107133
473 Ga0265329_10011457
474 Ga0265329_10018155
475 Ga0265340_10022712
476 Ga0265339_10003305
477 Ga0265331_10006739
478 Ga0265316_10002519
479 Ga0265316_10009379
480 Ga0265316_10165805
481 Ga0265314_10061455
482 Ga0265342_10110018
483 Ga0307407_10029206
484 Ga0373934_0001628
485 Ga0373956_0001335
486 Ga0373957_0039989
487 Ga0373955_0000157
488 Ga0373927_0002985
489 Ga0373933_0003395
490 Ga0373933_0070604
491 Ga0373937_0000693
492 Ga0373937_0010258
493 Ga0373937_0015463
494 Ga0373937_0081699
495 Ga0395900_0473695
496 Ga0436364_0641766
497 Ga0395901_0001234
498 Ga0451577_0009730
499 Ga0466967_0535556
500 Ga0495603_0091177
501 Ga0495629_0121162
502 Ga0495651_0006515
503 Ga0495582_0001568
504 Ga0495582_0022246
505 Ga0495582_0087584
506 Ga0495639_0010604
507 Ga0495662_0068814
508 Ga0495594_0009108
509 Ga0495630_0047039
510 Ga0495666_0012395
511 Ga0495587_0000510
512 Ga0495634_0017314
513 Ga0495623_0154039
514 Ga0495647_0065576
515 Ga0495604_0000275
516 Ga0495674_0281105
517 Ga0495680_0091090
518 Ga0495684_0065862
519 Ga0495602_0025975
520 Ga0495614_0021985
521 Ga0496100_0148360
522 Ga0496102_0002125
523 Ga0496106_0049825
524 Ga0496107_0176528
525 Ga0496112_0031005
526 Ga0496112_0100450
527 Ga0496112_0109452
528 Ga0496114_0011326
529 Ga0496114_0089332
530 Ga0496115_0006271
531 Ga0501033_0005380
532 Ga0501034_0078260
533 Ga0501036_0000498
534 Ga0501037_0003838
535 Ga0501038_0028959
536 Ga0501039_0037621
537 Ga0501042_0053515
538 Ga0501043_0006639
539 Ga0501046_0002887
540 Ga0501047_0020593
541 Ga0501048_0018756
542 Ga0501067_0007862
543 Ga0501068_0000768
544 Ga0501069_0024464
545 Ga0501070_0006405
546 Ga0501072_0000320
547 Ga0501073_0000432
548 Ga0501074_0021504
549 Ga0501076_0030634
550 Ga0501077_0000457
551 Ga0501079_0051351
552 Ga0501080_0000559
553 Ga0501083_0053553
554 Ga0501035_0044272
555 Ga0501035_0171708
556 Ga0501044_0001357
557 Ga0501044_0014229
558 Ga0501045_0057801
559 nmdc:mga06r32_227026_c1
560 nmdc:mga0n895_14090_c1
561 nmdc:mga0n895_192968_c1
562 nmdc:mga0n895_33178_c1
563 nmdc:mga0n895_409075_c1
564 nmdc:mga08x19_57286_c1
565 Ga0501084_0002811
566 Ga0501082_0063359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

46

341

0.83

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

51

344

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pc3-assembly1.cif.gz_A crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis. 0.953 37 350
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9525 42 350
8ods-assembly1.cif.gz_A phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate 0.9455 40 348
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9444 42 350
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9435 41 344
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9674 120 289 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9405 119 289 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9394 121 289 3.40.190.10
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9333 39 105 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9299 120 289 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V5PJC1-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9952 96 350 GO:0035435
GO:0042301
GO:0043190
AF-A0A2V5Q5X5-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9935 111 350 GO:0035435
GO:0042301
GO:0043190
AF-A0A7C5I7P8-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9874 94 349 GO:0035435
GO:0042301
GO:0043190
AF-A0A2H4V2I9-F1-model_v4 Phosphate-binding periplasmic protein of phosphate ABC transporter 0.9866 114 212
AF-A0A1Q6YN43-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9825 40 349 GO:0035435
GO:0042301
GO:0043190

Map