F385524

General Info

Members Datasets Scaffolds Average Seq Length
283 198 279 163

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10490677|Ga0105240_104906771
Length 173
Sequence LAKENSHMQRKSFEGMNCSVARSLEEVGEWWSLMIVRECLQGSRRFDEFQERLGIARNILTARLERLIEVGVMERYECGERANTFGYRLTPKGEELYPVIVALSQWGDRWLPHEPPVKLVDNDSGQPIEQIAVKNAYGQKLSYKDVRMEAGPGASERTHAMLARRNERVLGKA

Samples

Sample ID Description Type Environment
1 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
2 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
3 2857564685 Duganella sp. R-74599 Isolate Unclassified
4 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
105 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
106 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
107 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
108 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
185 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
186 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
187 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
188 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
193 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
194 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
195 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
196 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
197 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
198 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.31
Nodule 1.06
Rhizoplane 9.54
Rhizosphere 65.72
Stem 0
Stem Tuber 0
Unclassified 6.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10217273 3300001989 Bacteria 560
2 JGI25406J46586_10056233 3300003203 Bacteria 1292
3 rootH2_10035919 3300003320 Bacteria 12994
4 rootH2_10140392 3300003320 Bacteria 2517
5 rootL2_10077328 3300003322 Bacteria 6592
6 JGI25160J50197_1000138 3300003354 Bacteria 65562
7 Ga0065165_1001078 3300005262 Bacteria 32546
8 Ga0065715_10144488 3300005293 Bacteria 1807
9 Ga0070676_11175590 3300005328 Bacteria 582
10 Ga0070677_10672732 3300005333 Unclassified 580
11 Ga0070666_10849803 3300005335 Bacteria 673
12 Ga0070674_100219286 3300005356 Bacteria 1479
13 Ga0070667_100231164 3300005367 Bacteria 1649
14 Ga0070708_100587221 3300005445 Bacteria 1050
15 Ga0070678_100141885 3300005456 Bacteria 1923
16 Ga0068867_100594761 3300005459 Bacteria 964
17 Ga0070685_10335659 3300005466 Bacteria 1029
18 Ga0070699_100226646 3300005518 Bacteria 1666
19 Ga0070672_100479406 3300005543 Bacteria 1074
20 Ga0070686_100089441 3300005544 Bacteria 2057
21 Ga0070665_100179550 3300005548 Bacteria 2118
22 Ga0070665_100535558 3300005548 Bacteria 1183
23 Ga0070702_100300963 3300005615 Bacteria 1109
24 Ga0068852_100302853 3300005616 Bacteria 1548
25 Ga0068859_100796250 3300005617 Bacteria 1033
26 Ga0068866_10679729 3300005718 Bacteria 704
27 Ga0068851_10032887 3300005834 Bacteria 2582
28 Ga0068863_100196578 3300005841 Bacteria 1939
29 Ga0068858_100100609 3300005842 Bacteria 2696
30 Ga0081455_10009706 3300005937 Bacteria 9868
31 Ga0081455_10582172 3300005937 Unclassified 733
32 Ga0081540_1005737 3300005983 Bacteria 9203
33 Ga0081539_10007055 3300005985 Bacteria 10390
34 Ga0075365_10004010 3300006038 Bacteria 7719
35 Ga0075365_10049887 3300006038 Bacteria 2759
36 Ga0075365_10270295 3300006038 Bacteria 1196
37 Ga0075368_10198172 3300006042 Bacteria 849
38 Ga0075364_10176544 3300006051 Unclassified 1445
39 Ga0070715_10129464 3300006163 Bacteria 1213
40 Ga0075362_10161108 3300006177 Bacteria 1080
41 Ga0075362_10391198 3300006177 Unclassified 700
42 Ga0075367_10075509 3300006178 Bacteria 2033
43 Ga0075369_10099808 3300006186 Unclassified 1302
44 Ga0075366_10109713 3300006195 Bacteria 1659
45 Ga0097621_100197032 3300006237 Bacteria 1747
46 Ga0075370_10038887 3300006353 Bacteria 2678
47 Ga0075370_10054512 3300006353 Bacteria 2271
48 Ga0075428_101082373 3300006844 Bacteria 847
49 Ga0075434_100943338 3300006871 Bacteria 877
50 Ga0075434_100964708 3300006871 Bacteria 867
51 Ga0068865_100003733 3300006881 Bacteria 9146
52 Ga0075436_100191295 3300006914 Unclassified 1448
53 Ga0097620_100796334 3300006931 Bacteria 1033
54 Ga0099794_10033184 3300007265 Unclassified 2426
55 Ga0099794_10084833 3300007265 Bacteria 1566
56 Ga0099794_10090482 3300007265 Bacteria 1518
57 Ga0099795_10015937 3300007788 Bacteria 2367
58 Ga0105251_10097876 3300009011 Bacteria 1343
59 Ga0105240_10048449 3300009093 Bacteria 5370
60 Ga0105240_10077669 3300009093 Bacteria 4090
61 Ga0105240_10353121 3300009093 Bacteria 1667
62 Ga0105240_10490677 3300009093 Bacteria 1367
63 Ga0111539_11000656 3300009094 Bacteria 972
64 Ga0114129_10442083 3300009147 Bacteria 1707
65 Ga0105243_10292890 3300009148 Bacteria 1471
66 Ga0105243_10878519 3300009148 Bacteria 890
67 Ga0105242_10112498 3300009176 Bacteria 2323
68 Ga0105242_10464210 3300009176 Bacteria 1196
69 Ga0105248_10187542 3300009177 Bacteria 2331
70 Ga0105248_10452050 3300009177 Bacteria 1448
71 Ga0105237_10024463 3300009545 Bacteria 6177
72 Ga0105237_10040114 3300009545 Bacteria 4722
73 Ga0105237_10836876 3300009545 Bacteria 927
74 Ga0105238_10085337 3300009551 Bacteria 3145
75 Ga0105238_10333403 3300009551 Bacteria 1504
76 Ga0105249_10524496 3300009553 Bacteria 1232
77 Ga0105249_11860638 3300009553 Bacteria 675
78 Ga0099796_10086304 3300010159 Bacteria 1160
79 Ga0105239_10022535 3300010375 Bacteria 6944
80 Ga0105246_10714801 3300011119 Bacteria 880
81 Ga0157369_10365600 3300013105 Bacteria 1498
82 Ga0163162_10144554 3300013306 Bacteria 2493
83 Ga0157372_10174212 3300013307 Unclassified 2490
84 Ga0157375_10029256 3300013308 Bacteria 5178
85 Ga0163163_10197585 3300014325 Bacteria 2059
86 Ga0157380_10717497 3300014326 Bacteria 1007
87 Ga0157379_10155843 3300014968 Bacteria 2061
88 Ga0157376_10254971 3300014969 Bacteria 1640
89 Ga0213872_10002303 3300021361 Bacteria 11391
90 Ga0213872_10011210 3300021361 Bacteria 4245
91 Ga0213872_10013695 3300021361 Bacteria 3796
92 Ga0213872_10031787 3300021361 Bacteria 2419
93 Ga0213872_10065065 3300021361 Bacteria 1646
94 Ga0213872_10067964 3300021361 Bacteria 1608
95 Ga0213872_10103776 3300021361 Bacteria 1266
96 Ga0213872_10128006 3300021361 Bacteria 1120
97 Ga0213872_10209048 3300021361 Bacteria 834
98 Ga0213872_10271051 3300021361 Bacteria 710
99 Ga0209674_110660 3300025226 Bacteria 970
100 Ga0209674_111458 3300025226 Unclassified 903
101 Ga0209759_1022706 3300025256 Bacteria 1398
102 Ga0209564_1008089 3300025295 Bacteria 5263
103 Ga0207426_1000018 3300025302 Bacteria 566740
104 Ga0207642_10216220 3300025899 Bacteria 1068
105 Ga0207688_10086777 3300025901 Bacteria 1793
106 Ga0207680_10878034 3300025903 Bacteria 643
107 Ga0207654_10117417 3300025911 Bacteria 1665
108 Ga0207695_10030469 3300025913 Bacteria 5938
109 Ga0207695_10063338 3300025913 Bacteria 3813
110 Ga0207695_10632453 3300025913 Bacteria 951
111 Ga0207671_10019711 3300025914 Bacteria 5151
112 Ga0207694_10055959 3300025924 Bacteria 3063
113 Ga0207694_10336511 3300025924 Bacteria 1248
114 Ga0207687_11381051 3300025927 Bacteria 605
115 Ga0207686_10033506 3300025934 Bacteria 3067
116 Ga0207686_10695977 3300025934 Bacteria 808
117 Ga0207709_11452840 3300025935 Bacteria 568
118 Ga0207669_10208608 3300025937 Bacteria 1424
119 Ga0207691_10453968 3300025940 Bacteria 1090
120 Ga0207711_10337122 3300025941 Bacteria 1395
121 Ga0207651_10302934 3300025960 Unclassified 1330
122 Ga0207712_10361414 3300025961 Bacteria 1210
123 Ga0207668_10439363 3300025972 Bacteria 1111
124 Ga0207658_10286401 3300025986 Bacteria 1414
125 Ga0207703_10046636 3300026035 Bacteria 3491
126 Ga0207641_10290707 3300026088 Bacteria 1540
127 Ga0207641_10575967 3300026088 Bacteria 1100
128 Ga0207683_10034454 3300026121 Bacteria 4400
129 Ga0207698_10080149 3300026142 Bacteria 2629
130 Ga0207698_10411889 3300026142 Bacteria 1295
131 Ga0209179_1002291 3300027512 Bacteria 2559
132 Ga0209179_1062639 3300027512 Bacteria 808
133 Ga0209588_1004507 3300027671 Bacteria 3934
134 Ga0209588_1006002 3300027671 Bacteria 3505
135 Ga0209813_10124703 3300027866 Bacteria 900
136 Ga0268266_10255609 3300028379 Bacteria 1622
137 Ga0268264_10106463 3300028381 Bacteria 2448
138 Ga0373930_0006122 3300034816 Bacteria 2022
139 Ga0373958_0021586 3300034819 Bacteria 1196
140 Ga0373959_0146017 3300034820 Bacteria 595
141 Ga0373928_0021602 3300035084 Bacteria 1359
142 Ga0373929_0100184 3300035085 Bacteria 729
143 Ga0373932_0033353 3300035112 Bacteria 1445
144 Ga0373932_0039953 3300035112 Bacteria 1348
145 Ga0373936_0020767 3300035113 Bacteria 2553
146 Ga0373943_0014982 3300035170 Bacteria 3519
147 Ga0373931_0001627 3300035691 Bacteria 9720
148 Ga0373931_0183699 3300035691 Bacteria 1240
149 Ga0373927_0027127 3300035695 Bacteria 3742
150 Ga0373937_0975600 3300036401 Bacteria 796
151 Ga0373925_0019502 3300037068 Bacteria 4934
152 Ga0373925_0394594 3300037068 Bacteria 1128
153 Ga0395905_0067102 3300037471 Bacteria 3360
154 Ga0436361_0021349 3300039447 Bacteria 2997
155 Ga0436361_0137000 3300039447 Bacteria 1469
156 Ga0436361_0145005 3300039447 Bacteria 2592
157 Ga0436361_0169580 3300039447 Bacteria 7668
158 Ga0436361_0218752 3300039447 Bacteria 1582
159 Ga0436361_0242432 3300039447 Bacteria 19034
160 Ga0436361_0250792 3300039447 Bacteria 1996
161 Ga0436361_0295079 3300039447 Bacteria 1069
162 Ga0436361_0311872 3300039447 Bacteria 28586
163 Ga0436361_0407672 3300039447 Bacteria 10730
164 Ga0436361_0447213 3300039447 Bacteria 2462
165 Ga0436361_0509784 3300039447 Bacteria 3789
166 Ga0436361_0509799 3300039447 Bacteria 1259
167 Ga0436361_0694695 3300039447 Bacteria 38381
168 Ga0436361_0872546 3300039447 Bacteria 2107
169 Ga0436361_0903253 3300039447 Bacteria 1936
170 Ga0436361_0987213 3300039447 Unclassified 1640
171 Ga0436361_1112204 3300039447 Bacteria 1178
172 Ga0436361_1166165 3300039447 Bacteria 1570
173 Ga0466963_0687691 3300044694 Unclassified 722
174 Ga0466970_0073067 3300044765 Bacteria 1846
175 Ga0466967_0398105 3300045976 Unclassified 1339
176 Ga0495603_0083768 3300046455 Bacteria 1867
177 Ga0495629_0007745 3300046459 Bacteria 7903
178 Ga0495629_0872698 3300046459 Unclassified 591
179 Ga0495653_0021774 3300046463 Bacteria 5189
180 Ga0495580_0166661 3300046472 Bacteria 1524
181 Ga0495662_0497769 3300046476 Bacteria 597
182 Ga0495585_0505436 3300046492 Bacteria 574
183 Ga0495606_0017965 3300046507 Bacteria 5321
184 Ga0495628_0076071 3300046516 Bacteria 2613
185 Ga0495630_0045787 3300046517 Bacteria 3269
186 Ga0495632_0391216 3300046519 Bacteria 608
187 Ga0495648_0103832 3300046524 Bacteria 1561
188 Ga0495666_0152444 3300046526 Bacteria 1074
189 Ga0495666_0384301 3300046526 Bacteria 631
190 Ga0495652_0006704 3300046529 Bacteria 10689
191 Ga0495665_0084797 3300046531 Bacteria 1665
192 Ga0495586_0378220 3300046535 Bacteria 814
193 Ga0495645_0043244 3300046543 Bacteria 3286
194 Ga0495635_0003025 3300046663 Bacteria 11554
195 Ga0495623_0008942 3300046679 Bacteria 6503
196 Ga0495646_0021247 3300046680 Bacteria 4103
197 Ga0495669_0435786 3300046684 Bacteria 636
198 Ga0495624_0027318 3300046690 Bacteria 3736
199 Ga0495589_0076962 3300046794 Bacteria 1626
200 Ga0495581_0182907 3300047315 Bacteria 1226
201 Ga0495604_0011645 3300047317 Bacteria 6994
202 Ga0495680_0003069 3300047322 Bacteria 16640
203 Ga0495675_0046817 3300047444 Bacteria 2753
204 Ga0495593_0008610 3300047673 Bacteria 5934
205 Ga0495593_0058313 3300047673 Bacteria 2025
206 Ga0495602_0004504 3300048088 Bacteria 14529
207 Ga0495614_0344973 3300048089 Bacteria 693
208 Ga0496100_0000149 3300048903 Bacteria 38827
209 Ga0496100_0099005 3300048903 Bacteria 2005
210 Ga0496101_0000204 3300048904 Bacteria 45284
211 Ga0496101_0010847 3300048904 Bacteria 6028
212 Ga0496102_0000298 3300048905 Bacteria 63657
213 Ga0496102_0028540 3300048905 Bacteria 4985
214 Ga0496103_0000253 3300048906 Bacteria 51430
215 Ga0496103_0020335 3300048906 Bacteria 3987
216 Ga0496104_0011056 3300048907 Bacteria 8076
217 Ga0496104_0018893 3300048907 Bacteria 6295
218 Ga0496104_0023037 3300048907 Bacteria 5723
219 Ga0496105_0001894 3300048908 Bacteria 15008
220 Ga0496105_0031813 3300048908 Bacteria 4327
221 Ga0496105_0034316 3300048908 Bacteria 4172
222 Ga0496106_0041619 3300048909 Bacteria 3443
223 Ga0496107_0006998 3300048910 Bacteria 7770
224 Ga0496108_0005832 3300048911 Bacteria 9985
225 Ga0496108_0052648 3300048911 Bacteria 3412
226 Ga0496109_0055952 3300048912 Bacteria 3599
227 Ga0496109_0554534 3300048912 Bacteria 1084
228 Ga0496110_0047672 3300048913 Bacteria 3753
229 Ga0496111_0006836 3300048914 Bacteria 7440
230 Ga0496112_0006065 3300048915 Bacteria 10559
231 Ga0496112_0043234 3300048915 Bacteria 4411
232 Ga0496113_0028154 3300048916 Bacteria 4038
233 Ga0496114_0011949 3300048917 Bacteria 6946
234 Ga0496115_0040356 3300048918 Bacteria 3710
235 Ga0496117_0000171 3300048920 Bacteria 135051
236 Ga0496118_0000276 3300048921 Bacteria 90379
237 Ga0496118_0255917 3300048921 Bacteria 992
238 Ga0496119_0023549 3300048922 Bacteria 4361
239 Ga0496119_0238500 3300048922 Bacteria 922
240 Ga0496120_0166360 3300048923 Bacteria 1095
241 Ga0496121_0004389 3300048924 Bacteria 19038
242 Ga0496121_0040001 3300048924 Bacteria 4120
243 Ga0496121_0245854 3300048924 Bacteria 1244
244 Ga0496123_0140130 3300048926 Bacteria 1324
245 Ga0496124_0076564 3300048927 Bacteria 2761
246 Ga0496124_0111743 3300048927 Bacteria 2198
247 Ga0496125_0767792 3300048928 Unclassified 503
248 nmdc:mga03683_185412_c1 3300050489 Unclassified 950
249 nmdc:mga00v17_58338_c1 3300050491 Bacteria 2364
250 nmdc:mga0yw44_194787_c1 3300050492 Bacteria 1337
251 nmdc:mga0yw44_203094_c1 3300050492 Bacteria 1309
252 nmdc:mga0yw44_620535_c1 3300050492 Bacteria 735
253 nmdc:mga0k408_262699_c1 3300050493 Bacteria 1031
254 nmdc:mga0k408_667615_c1 3300050493 Bacteria 610
255 nmdc:mga06z11_131912_c1 3300050494 Bacteria 1404
256 nmdc:mga07m45_19448_c1 3300050496 Bacteria 3680
257 nmdc:mga07m45_46569_c2 3300050496 Bacteria 1577
258 nmdc:mga0n895_981452_c1 3300050512 Bacteria 827
259 nmdc:mga08x19_302767_c1 3300050514 Bacteria 1110
260 Ga0500647_0016972 3300053091 Bacteria 3351
261 Ga0500566_0000128 3300053094 Bacteria 38564
262 Ga0500640_000168 3300053095 Bacteria 13302
263 Ga0500554_002044 3300053102 Bacteria 3911
264 Ga0500569_101929 3300053109 Bacteria 942
265 Ga0500572_000620 3300053111 Bacteria 11912
266 Ga0500607_000026 3300053121 Bacteria 95013
267 Ga0500608_011129 3300053122 Bacteria 3893
268 Ga0500614_000326 3300053123 Bacteria 12307
269 Ga0500614_040028 3300053123 Bacteria 1188
270 Ga0500559_0001215 3300053136 Bacteria 15283
271 Ga0500603_000356 3300053150 Bacteria 11934
272 Ga0500603_000386 3300053150 Bacteria 11545
273 Ga0500603_224613 3300053150 Bacteria 600
274 Ga0500630_000855 3300053159 Bacteria 14148
275 Ga0500638_016691 3300053162 Bacteria 3395
276 Ga0500639_000125 3300053163 Bacteria 36885
277 Ga0500637_0034752 3300053178 Bacteria 2821
278 Ga0500596_000129 3300053735 Bacteria 11049
279 Ga0500601_001976 3300053737 Bacteria 2201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025295 Ga0209564_1008089 Ga0209564_10080893 127
2 3300053109 Ga0500569_101929 Ga0500569_101929_485_931 134
3 iso_pu_bacteria 2857564685 2857565614 141
4 iso_pu_bacteria 2921643360 2921653730 141
5 3300003322 rootL2_10077328 rootL2_100773282 145
6 3300003354 JGI25160J50197_1000138 JGI25160J50197_100013831 145
7 3300005262 Ga0065165_1001078 Ga0065165_10010787 145
8 3300009093 Ga0105240_10353121 Ga0105240_103531212 145
9 3300025226 Ga0209674_111458 Ga0209674_1114581 145
10 3300025302 Ga0207426_1000018 Ga0207426_1000018380 145
11 3300025913 Ga0207695_10632453 Ga0207695_106324531 145
12 3300037471 Ga0395905_0067102 Ga0395905_0067102_196_690 145
13 3300039447 Ga0436361_0218752 Ga0436361_0218752_567_1061 145
14 3300039447 Ga0436361_0407672 Ga0436361_0407672_7086_7568 145
15 3300048903 Ga0496100_0000149 Ga0496100_0000149_9884_10378 145
16 3300048904 Ga0496101_0000204 Ga0496101_0000204_13258_13752 145
17 3300048905 Ga0496102_0000298 Ga0496102_0000298_31505_31999 145
18 3300048906 Ga0496103_0000253 Ga0496103_0000253_18062_18556 145
19 3300048908 Ga0496105_0034316 Ga0496105_0034316_1614_2108 145
20 3300048920 Ga0496117_0000171 Ga0496117_0000171_103025_103519 145
21 3300048921 Ga0496118_0000276 Ga0496118_0000276_58381_58875 145
22 3300048922 Ga0496119_0023549 Ga0496119_0023549_2351_2845 145
23 3300048924 Ga0496121_0004389 Ga0496121_0004389_11325_11819 145
24 3300048926 Ga0496123_0140130 Ga0496123_0140130_109_603 145
25 3300006871 Ga0075434_100943338 Ga0075434_1009433382 149
26 iso_pu_bacteria 2513237166 2514053745 149
27 3300006177 Ga0075362_10391198 Ga0075362_103911981 150
28 3300050489 nmdc:mga03683_185412_c1 nmdc:mga03683_185412_c1_89_580 150
29 3300009093 Ga0105240_10048449 Ga0105240_100484491 151
30 3300009545 Ga0105237_10040114 Ga0105237_100401145 151
31 3300025913 Ga0207695_10030469 Ga0207695_100304692 151
32 3300025913 Ga0207695_10063338 Ga0207695_100633381 151
33 3300025914 Ga0207671_10019711 Ga0207671_100197115 151
34 3300005333 Ga0070677_10672732 Ga0070677_106727321 152
35 3300003320 rootH2_10140392 rootH2_101403922 153
36 3300005445 Ga0070708_100587221 Ga0070708_1005872212 153
37 3300006353 Ga0075370_10054512 Ga0075370_100545121 153
38 3300006914 Ga0075436_100191295 Ga0075436_1001912952 153
39 3300007265 Ga0099794_10033184 Ga0099794_100331841 153
40 3300009011 Ga0105251_10097876 Ga0105251_100978761 153
41 3300009093 Ga0105240_10490677 Ga0105240_104906771 153
42 3300009147 Ga0114129_10442083 Ga0114129_104420831 153
43 3300009545 Ga0105237_10836876 Ga0105237_108368762 153
44 3300013307 Ga0157372_10174212 Ga0157372_101742123 153
45 3300021361 Ga0213872_10002303 Ga0213872_100023038 153
46 3300021361 Ga0213872_10011210 Ga0213872_100112103 153
47 3300021361 Ga0213872_10013695 Ga0213872_100136955 153
48 3300021361 Ga0213872_10031787 Ga0213872_100317872 153
49 3300021361 Ga0213872_10065065 Ga0213872_100650653 153
50 3300021361 Ga0213872_10067964 Ga0213872_100679642 153
51 3300021361 Ga0213872_10103776 Ga0213872_101037763 153
52 3300021361 Ga0213872_10128006 Ga0213872_101280061 153
53 3300021361 Ga0213872_10209048 Ga0213872_102090481 153
54 3300021361 Ga0213872_10271051 Ga0213872_102710511 153
55 3300025226 Ga0209674_110660 Ga0209674_1106602 153
56 3300025256 Ga0209759_1022706 Ga0209759_10227062 153
57 3300027671 Ga0209588_1006002 Ga0209588_10060023 153
58 3300035170 Ga0373943_0014982 Ga0373943_0014982_1147_1674 153
59 3300039447 Ga0436361_0021349 Ga0436361_0021349_2165_2671 153
60 3300039447 Ga0436361_0137000 Ga0436361_0137000_533_1039 153
61 3300039447 Ga0436361_0145005 Ga0436361_0145005_1466_1972 153
62 3300039447 Ga0436361_0169580 Ga0436361_0169580_4707_5231 153
63 3300039447 Ga0436361_0242432 Ga0436361_0242432_2609_3115 153
64 3300039447 Ga0436361_0250792 Ga0436361_0250792_1062_1568 153
65 3300039447 Ga0436361_0295079 Ga0436361_0295079_458_973 153
66 3300039447 Ga0436361_0311872 Ga0436361_0311872_14890_15396 153
67 3300039447 Ga0436361_0447213 Ga0436361_0447213_498_1004 153
68 3300039447 Ga0436361_0509784 Ga0436361_0509784_2604_3110 153
69 3300039447 Ga0436361_0509799 Ga0436361_0509799_327_830 153
70 3300039447 Ga0436361_0694695 Ga0436361_0694695_35547_36053 153
71 3300039447 Ga0436361_0872546 Ga0436361_0872546_616_1122 153
72 3300039447 Ga0436361_0903253 Ga0436361_0903253_545_1051 153
73 3300039447 Ga0436361_0987213 Ga0436361_0987213_249_749 153
74 3300039447 Ga0436361_1112204 Ga0436361_1112204_358_873 153
75 3300039447 Ga0436361_1166165 Ga0436361_1166165_621_1127 153
76 3300044765 Ga0466970_0073067 Ga0466970_0073067_420_941 153
77 3300046524 Ga0495648_0103832 Ga0495648_0103832_435_947 153
78 3300046531 Ga0495665_0084797 Ga0495665_0084797_1130_1642 153
79 3300047673 Ga0495593_0058313 Ga0495593_0058313_20_532 153
80 3300048907 Ga0496104_0023037 Ga0496104_0023037_4886_5404 153
81 3300048927 Ga0496124_0076564 Ga0496124_0076564_617_1135 153
82 3300050496 nmdc:mga07m45_19448_c1 nmdc:mga07m45_19448_c1_71_577 153
83 3300050514 nmdc:mga08x19_302767_c1 nmdc:mga08x19_302767_c1_166_669 153
84 3300053121 Ga0500607_000026 Ga0500607_000026_82997_83503 153
85 3300003320 rootH2_10035919 rootH2_100359194 155
86 3300009093 Ga0105240_10077669 Ga0105240_100776692 155
87 3300013105 Ga0157369_10365600 Ga0157369_103656002 155
88 3300046459 Ga0495629_0007745 Ga0495629_0007745_4531_5061 155
89 3300046463 Ga0495653_0021774 Ga0495653_0021774_2821_3351 155
90 3300046472 Ga0495580_0166661 Ga0495580_0166661_428_958 155
91 3300046476 Ga0495662_0497769 Ga0495662_0497769_54_584 155
92 3300046507 Ga0495606_0017965 Ga0495606_0017965_2091_2621 155
93 3300046517 Ga0495630_0045787 Ga0495630_0045787_310_840 155
94 3300046526 Ga0495666_0152444 Ga0495666_0152444_136_666 155
95 3300046529 Ga0495652_0006704 Ga0495652_0006704_4674_5204 155
96 3300046535 Ga0495586_0378220 Ga0495586_0378220_132_662 155
97 3300046663 Ga0495635_0003025 Ga0495635_0003025_503_1033 155
98 3300046679 Ga0495623_0008942 Ga0495623_0008942_1753_2283 155
99 3300046680 Ga0495646_0021247 Ga0495646_0021247_2428_2958 155
100 3300046684 Ga0495669_0435786 Ga0495669_0435786_37_567 155
101 3300046690 Ga0495624_0027318 Ga0495624_0027318_1286_1816 155
102 3300047315 Ga0495581_0182907 Ga0495581_0182907_338_868 155
103 3300047317 Ga0495604_0011645 Ga0495604_0011645_1284_1814 155
104 3300047322 Ga0495680_0003069 Ga0495680_0003069_10766_11296 155
105 3300047444 Ga0495675_0046817 Ga0495675_0046817_201_731 155
106 3300047673 Ga0495593_0008610 Ga0495593_0008610_1908_2438 155
107 3300048088 Ga0495602_0004504 Ga0495602_0004504_4896_5426 155
108 3300048089 Ga0495614_0344973 Ga0495614_0344973_84_614 155
109 3300048907 Ga0496104_0011056 Ga0496104_0011056_4497_5027 155
110 3300048908 Ga0496105_0031813 Ga0496105_0031813_311_841 155
111 3300048912 Ga0496109_0554534 Ga0496109_0554534_284_814 155
112 3300048921 Ga0496118_0255917 Ga0496118_0255917_183_713 155
113 3300048923 Ga0496120_0166360 Ga0496120_0166360_55_585 155
114 3300048924 Ga0496121_0245854 Ga0496121_0245854_388_918 155
115 3300005459 Ga0068867_100594761 Ga0068867_1005947612 156
116 3300006038 Ga0075365_10049887 Ga0075365_100498873 156
117 3300006051 Ga0075364_10176544 Ga0075364_101765442 156
118 3300006195 Ga0075366_10109713 Ga0075366_101097131 156
119 3300006881 Ga0068865_100003733 Ga0068865_1000037335 156
120 3300009177 Ga0105248_10187542 Ga0105248_101875422 156
121 3300013306 Ga0163162_10144554 Ga0163162_101445543 156
122 3300025927 Ga0207687_11381051 Ga0207687_113810511 156
123 3300025960 Ga0207651_10302934 Ga0207651_103029342 156
124 3300044694 Ga0466963_0687691 Ga0466963_0687691_173_646 156
125 3300045976 Ga0466967_0398105 Ga0466967_0398105_202_675 156
126 3300046516 Ga0495628_0076071 Ga0495628_0076071_45_515 156
127 3300046543 Ga0495645_0043244 Ga0495645_0043244_1708_2178 156
128 3300050492 nmdc:mga0yw44_620535_c1 nmdc:mga0yw44_620535_c1_199_687 156
129 3300050493 nmdc:mga0k408_262699_c1 nmdc:mga0k408_262699_c1_239_727 156
130 3300050493 nmdc:mga0k408_667615_c1 nmdc:mga0k408_667615_c1_12_500 156
131 3300001989 JGI24739J22299_10217273 JGI24739J22299_102172731 157
132 3300003203 JGI25406J46586_10056233 JGI25406J46586_100562332 157
133 3300005293 Ga0065715_10144488 Ga0065715_101444882 157
134 3300005328 Ga0070676_11175590 Ga0070676_111755901 157
135 3300005335 Ga0070666_10849803 Ga0070666_108498031 157
136 3300005356 Ga0070674_100219286 Ga0070674_1002192862 157
137 3300005367 Ga0070667_100231164 Ga0070667_1002311641 157
138 3300005456 Ga0070678_100141885 Ga0070678_1001418852 157
139 3300005466 Ga0070685_10335659 Ga0070685_103356592 157
140 3300005518 Ga0070699_100226646 Ga0070699_1002266462 157
141 3300005543 Ga0070672_100479406 Ga0070672_1004794062 157
142 3300005544 Ga0070686_100089441 Ga0070686_1000894412 157
143 3300005548 Ga0070665_100179550 Ga0070665_1001795501 157
144 3300005548 Ga0070665_100535558 Ga0070665_1005355582 157
145 3300005615 Ga0070702_100300963 Ga0070702_1003009631 157
146 3300005616 Ga0068852_100302853 Ga0068852_1003028532 157
147 3300005617 Ga0068859_100796250 Ga0068859_1007962502 157
148 3300005718 Ga0068866_10679729 Ga0068866_106797291 157
149 3300005834 Ga0068851_10032887 Ga0068851_100328873 157
150 3300005841 Ga0068863_100196578 Ga0068863_1001965782 157
151 3300005842 Ga0068858_100100609 Ga0068858_1001006092 157
152 3300005937 Ga0081455_10009706 Ga0081455_100097066 157
153 3300005937 Ga0081455_10582172 Ga0081455_105821721 157
154 3300005983 Ga0081540_1005737 Ga0081540_10057375 157
155 3300005985 Ga0081539_10007055 Ga0081539_100070553 157
156 3300006038 Ga0075365_10004010 Ga0075365_100040105 157
157 3300006038 Ga0075365_10270295 Ga0075365_102702952 157
158 3300006042 Ga0075368_10198172 Ga0075368_101981722 157
159 3300006163 Ga0070715_10129464 Ga0070715_101294642 157
160 3300006177 Ga0075362_10161108 Ga0075362_101611082 157
161 3300006178 Ga0075367_10075509 Ga0075367_100755093 157
162 3300006186 Ga0075369_10099808 Ga0075369_100998082 157
163 3300006237 Ga0097621_100197032 Ga0097621_1001970322 157
164 3300006353 Ga0075370_10038887 Ga0075370_100388873 157
165 3300006844 Ga0075428_101082373 Ga0075428_1010823731 157
166 3300006871 Ga0075434_100964708 Ga0075434_1009647082 157
167 3300006931 Ga0097620_100796334 Ga0097620_1007963341 157
168 3300007265 Ga0099794_10084833 Ga0099794_100848332 157
169 3300007265 Ga0099794_10090482 Ga0099794_100904822 157
170 3300007788 Ga0099795_10015937 Ga0099795_100159374 157
171 3300009094 Ga0111539_11000656 Ga0111539_110006562 157
172 3300009148 Ga0105243_10292890 Ga0105243_102928902 157
173 3300009148 Ga0105243_10878519 Ga0105243_108785192 157
174 3300009176 Ga0105242_10112498 Ga0105242_101124982 157
175 3300009176 Ga0105242_10464210 Ga0105242_104642102 157
176 3300009177 Ga0105248_10452050 Ga0105248_104520502 157
177 3300009545 Ga0105237_10024463 Ga0105237_100244635 157
178 3300009551 Ga0105238_10085337 Ga0105238_100853372 157
179 3300009551 Ga0105238_10333403 Ga0105238_103334032 157
180 3300009553 Ga0105249_10524496 Ga0105249_105244961 157
181 3300009553 Ga0105249_11860638 Ga0105249_118606382 157
182 3300010159 Ga0099796_10086304 Ga0099796_100863042 157
183 3300010375 Ga0105239_10022535 Ga0105239_100225355 157
184 3300011119 Ga0105246_10714801 Ga0105246_107148012 157
185 3300013308 Ga0157375_10029256 Ga0157375_100292562 157
186 3300014325 Ga0163163_10197585 Ga0163163_101975853 157
187 3300014326 Ga0157380_10717497 Ga0157380_107174972 157
188 3300014968 Ga0157379_10155843 Ga0157379_101558434 157
189 3300014969 Ga0157376_10254971 Ga0157376_102549712 157
190 3300025899 Ga0207642_10216220 Ga0207642_102162202 157
191 3300025901 Ga0207688_10086777 Ga0207688_100867771 157
192 3300025903 Ga0207680_10878034 Ga0207680_108780341 157
193 3300025911 Ga0207654_10117417 Ga0207654_101174172 157
194 3300025924 Ga0207694_10055959 Ga0207694_100559592 157
195 3300025924 Ga0207694_10336511 Ga0207694_103365112 157
196 3300025934 Ga0207686_10033506 Ga0207686_100335063 157
197 3300025934 Ga0207686_10695977 Ga0207686_106959771 157
198 3300025935 Ga0207709_11452840 Ga0207709_114528401 157
199 3300025937 Ga0207669_10208608 Ga0207669_102086082 157
200 3300025940 Ga0207691_10453968 Ga0207691_104539682 157
201 3300025941 Ga0207711_10337122 Ga0207711_103371223 157
202 3300025961 Ga0207712_10361414 Ga0207712_103614141 157
203 3300025972 Ga0207668_10439363 Ga0207668_104393632 157
204 3300025986 Ga0207658_10286401 Ga0207658_102864012 157
205 3300026035 Ga0207703_10046636 Ga0207703_100466364 157
206 3300026088 Ga0207641_10290707 Ga0207641_102907072 157
207 3300026088 Ga0207641_10575967 Ga0207641_105759672 157
208 3300026121 Ga0207683_10034454 Ga0207683_100344543 157
209 3300026142 Ga0207698_10080149 Ga0207698_100801493 157
210 3300026142 Ga0207698_10411889 Ga0207698_104118892 157
211 3300027512 Ga0209179_1002291 Ga0209179_10022913 157
212 3300027512 Ga0209179_1062639 Ga0209179_10626391 157
213 3300027671 Ga0209588_1004507 Ga0209588_10045073 157
214 3300027866 Ga0209813_10124703 Ga0209813_101247032 157
215 3300028379 Ga0268266_10255609 Ga0268266_102556092 157
216 3300028381 Ga0268264_10106463 Ga0268264_101064633 157
217 3300034816 Ga0373930_0006122 Ga0373930_0006122_1056_1529 157
218 3300034819 Ga0373958_0021586 Ga0373958_0021586_509_982 157
219 3300034820 Ga0373959_0146017 Ga0373959_0146017_106_579 157
220 3300035084 Ga0373928_0021602 Ga0373928_0021602_649_1122 157
221 3300035085 Ga0373929_0100184 Ga0373929_0100184_45_518 157
222 3300035112 Ga0373932_0033353 Ga0373932_0033353_107_580 157
223 3300035112 Ga0373932_0039953 Ga0373932_0039953_30_521 157
224 3300035113 Ga0373936_0020767 Ga0373936_0020767_1755_2228 157
225 3300035691 Ga0373931_0001627 Ga0373931_0001627_8604_9077 157
226 3300035691 Ga0373931_0183699 Ga0373931_0183699_205_711 157
227 3300035695 Ga0373927_0027127 Ga0373927_0027127_157_630 157
228 3300036401 Ga0373937_0975600 Ga0373937_0975600_77_550 157
229 3300037068 Ga0373925_0019502 Ga0373925_0019502_1693_2166 157
230 3300037068 Ga0373925_0394594 Ga0373925_0394594_533_1006 157
231 3300046455 Ga0495603_0083768 Ga0495603_0083768_506_979 157
232 3300046459 Ga0495629_0872698 Ga0495629_0872698_59_538 157
233 3300046492 Ga0495585_0505436 Ga0495585_0505436_81_554 157
234 3300046519 Ga0495632_0391216 Ga0495632_0391216_107_598 157
235 3300046526 Ga0495666_0384301 Ga0495666_0384301_14_487 157
236 3300046794 Ga0495589_0076962 Ga0495589_0076962_345_818 157
237 3300048903 Ga0496100_0099005 Ga0496100_0099005_459_932 157
238 3300048904 Ga0496101_0010847 Ga0496101_0010847_2116_2589 157
239 3300048905 Ga0496102_0028540 Ga0496102_0028540_4206_4679 157
240 3300048906 Ga0496103_0020335 Ga0496103_0020335_2898_3371 157
241 3300048907 Ga0496104_0018893 Ga0496104_0018893_3761_4234 157
242 3300048908 Ga0496105_0001894 Ga0496105_0001894_10077_10550 157
243 3300048909 Ga0496106_0041619 Ga0496106_0041619_1110_1583 157
244 3300048910 Ga0496107_0006998 Ga0496107_0006998_213_686 157
245 3300048911 Ga0496108_0005832 Ga0496108_0005832_7352_7825 157
246 3300048911 Ga0496108_0052648 Ga0496108_0052648_2481_2954 157
247 3300048912 Ga0496109_0055952 Ga0496109_0055952_2391_2864 157
248 3300048913 Ga0496110_0047672 Ga0496110_0047672_579_1052 157
249 3300048914 Ga0496111_0006836 Ga0496111_0006836_4341_4814 157
250 3300048915 Ga0496112_0006065 Ga0496112_0006065_5482_5955 157
251 3300048915 Ga0496112_0043234 Ga0496112_0043234_453_932 157
252 3300048916 Ga0496113_0028154 Ga0496113_0028154_2550_3023 157
253 3300048917 Ga0496114_0011949 Ga0496114_0011949_3644_4117 157
254 3300048918 Ga0496115_0040356 Ga0496115_0040356_1484_1957 157
255 3300048922 Ga0496119_0238500 Ga0496119_0238500_358_831 157
256 3300048924 Ga0496121_0040001 Ga0496121_0040001_2950_3423 157
257 3300048927 Ga0496124_0111743 Ga0496124_0111743_1455_1928 157
258 3300048928 Ga0496125_0767792 Ga0496125_0767792_12_485 157
259 3300050491 nmdc:mga00v17_58338_c1 nmdc:mga00v17_58338_c1_1714_2187 157
260 3300050492 nmdc:mga0yw44_194787_c1 nmdc:mga0yw44_194787_c1_574_1065 157
261 3300050492 nmdc:mga0yw44_203094_c1 nmdc:mga0yw44_203094_c1_382_855 157
262 3300050494 nmdc:mga06z11_131912_c1 nmdc:mga06z11_131912_c1_59_532 157
263 3300050496 nmdc:mga07m45_46569_c2 nmdc:mga07m45_46569_c2_943_1416 157
264 3300050512 nmdc:mga0n895_981452_c1 nmdc:mga0n895_981452_c1_228_713 157
265 3300053091 Ga0500647_0016972 Ga0500647_0016972_1369_1842 157
266 3300053094 Ga0500566_0000128 Ga0500566_0000128_9280_9753 157
267 3300053095 Ga0500640_000168 Ga0500640_000168_10902_11375 157
268 3300053102 Ga0500554_002044 Ga0500554_002044_143_616 157
269 3300053111 Ga0500572_000620 Ga0500572_000620_1951_2424 157
270 3300053122 Ga0500608_011129 Ga0500608_011129_1928_2401 157
271 3300053123 Ga0500614_000326 Ga0500614_000326_3616_4089 157
272 3300053123 Ga0500614_040028 Ga0500614_040028_306_794 157
273 3300053136 Ga0500559_0001215 Ga0500559_0001215_3733_4206 157
274 3300053150 Ga0500603_000356 Ga0500603_000356_9239_9712 157
275 3300053150 Ga0500603_000386 Ga0500603_000386_3337_3810 157
276 3300053150 Ga0500603_224613 Ga0500603_224613_93_581 157
277 3300053159 Ga0500630_000855 Ga0500630_000855_6886_7359 157
278 3300053162 Ga0500638_016691 Ga0500638_016691_20_493 157
279 3300053163 Ga0500639_000125 Ga0500639_000125_16737_17210 157
280 3300053178 Ga0500637_0034752 Ga0500637_0034752_1161_1634 157
281 3300053735 Ga0500596_000129 Ga0500596_000129_9090_9563 157
282 3300053737 Ga0500601_001976 Ga0500601_001976_1342_1815 157
283 iso_pu_bacteria 2721755755 2723847961 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

26

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hqe-assembly1.cif.gz_A the crystal structure of qsrr-dna complex 0.91 13 108
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9082 13 110
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.8997 13 106
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.8934 15 106
7bzg-assembly3.cif.gz_J structure of bacillus subtilis hxlr, wild type in complex with formaldehyde and dna 0.886 12 108
ID Description Score Start End Superfamily
af_P71983_1_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8921 13 108 1.10.10.10
2hztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8825 15 106 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8799 40 86 1.10.10.10
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8791 17 108 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8786 22 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R4Q013-F1-model_v4 Transcriptional regulator 0.9535 13 108 GO:0003677
AF-A0A5N8V823-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9499 14 111 GO:0003677
AF-A0A7W8KK52-F1-model_v4 DNA-binding HxlR family transcriptional regulator 0.9488 13 108 GO:0003677
AF-A0A537XEU8-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9487 14 108 GO:0003677
AF-A0A2E4QWD8-F1-model_v4 Transcriptional regulator 0.9422 13 111 GO:0003677

Feature Viewer

pLDDT pTM Quality
89.7 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map