F385479

General Info

Members Datasets Scaffolds Average Seq Length
283 177 566 148

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_11552592|Ga0070717_115525921
Length 164
Sequence MAQDKKPQKAKTADGYDLVVENRKARHDFFIEETVEAGLALTGTEVKSLRAHKANLRDSYARIKDGEAFLQGVHIGAYAPAGQFSHKETRTRKLLMHRREIDRFWGRVREKGYSLVPLRIYFLKGRAKVEIGLAKGKHLYDKRAAIATKTSRREMERALKSRNR

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
124 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
132 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
133 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 1.06
Rhizosphere 92.58
Stem 0
Stem Tuber 0
Unclassified 6.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_11552592 3300006028 Bacteria 600
2 JGI24740J21852_10018970 3300001979 Bacteria 2430
3 JGI24739J22299_10167720 3300001989 Bacteria 647
4 JGI24738J21930_10079622 3300002075 Bacteria 685
5 rootH2_10020391 3300003320 Bacteria 4032
6 rootH2_10183957 3300003320 Bacteria 3056
7 rootL2_10108323 3300003322 Unclassified 1165
8 rootH1_10293160 3300003323 Bacteria 2279
9 Ga0070658_10041994 3300005327 Bacteria 3690
10 Ga0070676_10101853 3300005328 Bacteria 1775
11 Ga0070683_100013409 3300005329 Bacteria 7148
12 Ga0070683_100840280 3300005329 Bacteria 880
13 Ga0070683_101114099 3300005329 Bacteria 758
14 Ga0070670_100022847 3300005331 Bacteria 5382
15 Ga0070670_100169843 3300005331 Bacteria 1891
16 Ga0070670_101039361 3300005331 Bacteria 746
17 Ga0070666_10143025 3300005335 Bacteria 1666
18 Ga0070666_10206872 3300005335 Bacteria 1381
19 Ga0070680_100608993 3300005336 Bacteria 938
20 Ga0070680_101505426 3300005336 Unclassified 583
21 Ga0070682_100005234 3300005337 Bacteria 7216
22 Ga0068868_100928024 3300005338 Bacteria 793
23 Ga0070689_101033203 3300005340 Unclassified 732
24 Ga0070661_100011248 3300005344 Bacteria 6235
25 Ga0070661_100213400 3300005344 Bacteria 1478
26 Ga0070669_100143006 3300005353 Bacteria 1846
27 Ga0070675_100154942 3300005354 Bacteria 1967
28 Ga0070675_100172177 3300005354 Bacteria 1868
29 Ga0070675_100872134 3300005354 Bacteria 824
30 Ga0070671_100053117 3300005355 Bacteria 3368
31 Ga0070674_100103343 3300005356 Bacteria 2080
32 Ga0070673_100826322 3300005364 Bacteria 857
33 Ga0070688_100277020 3300005365 Bacteria 1204
34 Ga0070659_100010357 3300005366 Bacteria 6856
35 Ga0070659_100288294 3300005366 Bacteria 1367
36 Ga0070667_101053452 3300005367 Bacteria 760
37 Ga0070663_100675706 3300005455 Bacteria 876
38 Ga0070678_100669628 3300005456 Bacteria 932
39 Ga0070678_100932308 3300005456 Bacteria 795
40 Ga0070662_100155881 3300005457 Bacteria 1783
41 Ga0070681_10149971 3300005458 Bacteria 2258
42 Ga0068867_100129613 3300005459 Unclassified 1959
43 Ga0068867_100881110 3300005459 Bacteria 804
44 Ga0070706_100508272 3300005467 Bacteria 1121
45 Ga0070707_101043496 3300005468 Bacteria 783
46 Ga0070679_100097874 3300005530 Bacteria 2921
47 Ga0070679_100124010 3300005530 Bacteria 2566
48 Ga0070684_100142957 3300005535 Bacteria 2164
49 Ga0070697_100605536 3300005536 Unclassified 963
50 Ga0068853_100192958 3300005539 Bacteria 1851
51 Ga0068853_100420450 3300005539 Bacteria 1253
52 Ga0070686_101342901 3300005544 Bacteria 598
53 Ga0070696_100275897 3300005546 Bacteria 1280
54 Ga0070693_100396517 3300005547 Bacteria 956
55 Ga0070693_100400582 3300005547 Bacteria 951
56 Ga0070693_100451095 3300005547 Bacteria 903
57 Ga0070704_101647839 3300005549 Unclassified 592
58 Ga0068855_100050887 3300005563 Bacteria 4880
59 Ga0068855_100143108 3300005563 Bacteria 2724
60 Ga0070664_100081033 3300005564 Bacteria 2796
61 Ga0070664_100329898 3300005564 Bacteria 1384
62 Ga0068857_100296823 3300005577 Bacteria 1489
63 Ga0068857_101709256 3300005577 Bacteria 615
64 Ga0068854_100078280 3300005578 Bacteria 2435
65 Ga0068854_100080978 3300005578 Bacteria 2397
66 Ga0068856_100218938 3300005614 Bacteria 1919
67 Ga0068852_100052792 3300005616 Bacteria 3495
68 Ga0068852_100187900 3300005616 Bacteria 1947
69 Ga0068852_102168572 3300005616 Bacteria 577
70 Ga0068859_100750703 3300005617 Bacteria 1065
71 Ga0068864_101247296 3300005618 Bacteria 743
72 Ga0068866_10009251 3300005718 Bacteria 4178
73 Ga0068861_100739241 3300005719 Bacteria 918
74 Ga0068851_10396037 3300005834 Bacteria 812
75 Ga0068863_100815068 3300005841 Bacteria 931
76 Ga0068860_100057178 3300005843 Bacteria 3708
77 Ga0068860_102014175 3300005843 Bacteria 599
78 Ga0081539_10003232 3300005985 Bacteria 20536
79 Ga0081539_10289775 3300005985 Bacteria 708
80 Ga0070716_101554178 3300006173 Bacteria 542
81 Ga0075366_10014150 3300006195 Bacteria 4553
82 Ga0075366_10289720 3300006195 Bacteria 1001
83 Ga0097621_100013009 3300006237 Bacteria 6185
84 Ga0097621_102011114 3300006237 Bacteria 552
85 Ga0068871_100060964 3300006358 Bacteria 3079
86 Ga0068865_101541011 3300006881 Bacteria 596
87 Ga0097620_100750715 3300006931 Bacteria 1065
88 Ga0105240_10005685 3300009093 Bacteria 18505
89 Ga0111539_11179089 3300009094 Bacteria 890
90 Ga0114129_10102304 3300009147 Bacteria 3962
91 Ga0114129_11319281 3300009147 Bacteria 894
92 Ga0105243_10747104 3300009148 Bacteria 959
93 Ga0105241_10445141 3300009174 Bacteria 1145
94 Ga0105242_10050036 3300009176 Bacteria 3401
95 Ga0105242_10692556 3300009176 Bacteria 996
96 Ga0105242_10723239 3300009176 Bacteria 977
97 Ga0105237_10022946 3300009545 Bacteria 6400
98 Ga0105249_10580163 3300009553 Bacteria 1174
99 Ga0105249_11064460 3300009553 Bacteria 878
100 Ga0099796_10033267 3300010159 Bacteria 1695
101 Ga0105239_10014300 3300010375 Bacteria 8807
102 Ga0105239_10416637 3300010375 Bacteria 1521
103 Ga0105239_10526834 3300010375 Bacteria 1345
104 Ga0157373_10001178 3300013100 Bacteria 19992
105 Ga0157371_10052304 3300013102 Bacteria 2901
106 Ga0157371_10079307 3300013102 Bacteria 2325
107 Ga0157371_10379691 3300013102 Bacteria 1032
108 Ga0157371_10591576 3300013102 Bacteria 825
109 Ga0157370_10063710 3300013104 Bacteria 3492
110 Ga0157370_10745450 3300013104 Bacteria 892
111 Ga0157370_11277729 3300013104 Unclassified 661
112 Ga0157369_10039893 3300013105 Bacteria 5130
113 Ga0157369_10225107 3300013105 Bacteria 1962
114 Ga0157369_10385464 3300013105 Bacteria 1454
115 Ga0157374_10077681 3300013296 Bacteria 3142
116 Ga0157374_10124604 3300013296 Bacteria 2490
117 Ga0157374_10137638 3300013296 Bacteria 2369
118 Ga0157378_10020917 3300013297 Bacteria 5757
119 Ga0157378_10062964 3300013297 Bacteria 3314
120 Ga0163162_10049012 3300013306 Bacteria 4233
121 Ga0163162_10084022 3300013306 Bacteria 3258
122 Ga0163162_10154564 3300013306 Bacteria 2413
123 Ga0163162_10940217 3300013306 Bacteria 976
124 Ga0163162_11483847 3300013306 Unclassified 772
125 Ga0157372_10015076 3300013307 Bacteria 8273
126 Ga0157372_10069116 3300013307 Bacteria 3972
127 Ga0157372_10082015 3300013307 Bacteria 3650
128 Ga0157372_10114082 3300013307 Bacteria 3097
129 Ga0157372_10127474 3300013307 Unclassified 2926
130 Ga0157372_10306949 3300013307 Bacteria 1846
131 Ga0157372_11313405 3300013307 Bacteria 835
132 Ga0157372_11666769 3300013307 Unclassified 734
133 Ga0157372_11798124 3300013307 Unclassified 705
134 Ga0157372_11954400 3300013307 Bacteria 674
135 Ga0157372_12007125 3300013307 Bacteria 665
136 Ga0157375_10681747 3300013308 Bacteria 1182
137 Ga0157375_10876979 3300013308 Bacteria 1042
138 Ga0157375_11689279 3300013308 Bacteria 750
139 Ga0157379_10853608 3300014968 Bacteria 862
140 Ga0157376_10308855 3300014969 Bacteria 1500
141 Ga0157376_10695785 3300014969 Bacteria 1021
142 Ga0163161_10828795 3300017792 Bacteria 779
143 Ga0213876_10005276 3300021384 Bacteria 7117
144 Ga0213876_10519014 3300021384 Bacteria 634
145 Ga0213876_10692738 3300021384 Bacteria 542
146 Ga0207656_10504617 3300025321 Bacteria 614
147 Ga0207642_10202142 3300025899 Bacteria 1098
148 Ga0207680_10430062 3300025903 Bacteria 935
149 Ga0207680_10933279 3300025903 Bacteria 622
150 Ga0207647_10236022 3300025904 Bacteria 1051
151 Ga0207647_10285146 3300025904 Bacteria 942
152 Ga0207705_10062721 3300025909 Bacteria 2685
153 Ga0207654_10879149 3300025911 Bacteria 649
154 Ga0207695_10002995 3300025913 Bacteria 24274
155 Ga0207671_10019466 3300025914 Bacteria 5189
156 Ga0207660_10349799 3300025917 Bacteria 1184
157 Ga0207660_10386782 3300025917 Bacteria 1125
158 Ga0207649_10433274 3300025920 Bacteria 989
159 Ga0207652_10067209 3300025921 Bacteria 3107
160 Ga0207650_10114990 3300025925 Bacteria 2088
161 Ga0207659_10036540 3300025926 Bacteria 3403
162 Ga0207659_10298830 3300025926 Bacteria 1322
163 Ga0207644_11307197 3300025931 Bacteria 609
164 Ga0207706_10001682 3300025933 Bacteria 21820
165 Ga0207689_10108591 3300025942 Bacteria 2280
166 Ga0207661_10075631 3300025944 Bacteria 2764
167 Ga0207661_10160931 3300025944 Bacteria 1947
168 Ga0207661_10240246 3300025944 Bacteria 1607
169 Ga0207679_10059249 3300025945 Bacteria 2840
170 Ga0207679_10516403 3300025945 Bacteria 1068
171 Ga0207667_10072921 3300025949 Bacteria 3568
172 Ga0207651_11040416 3300025960 Bacteria 733
173 Ga0207712_10779214 3300025961 Bacteria 839
174 Ga0207640_10064262 3300025981 Bacteria 2443
175 Ga0207677_10022183 3300026023 Bacteria 3897
176 Ga0207639_10078451 3300026041 Bacteria 2606
177 Ga0207639_10614049 3300026041 Bacteria 1003
178 Ga0207678_10401402 3300026067 Bacteria 1187
179 Ga0207702_10207329 3300026078 Bacteria 1820
180 Ga0207641_10421370 3300026088 Unclassified 1285
181 Ga0207676_10128036 3300026095 Bacteria 2154
182 Ga0207674_10212590 3300026116 Bacteria 1883
183 Ga0207675_100076870 3300026118 Bacteria 3126
184 Ga0207683_10472049 3300026121 Bacteria 1157
185 Ga0207698_10782758 3300026142 Bacteria 955
186 Ga0207698_12488780 3300026142 Bacteria 528
187 Ga0265338_10316266 3300028800 Bacteria 1131
188 Ga0265324_10040568 3300029957 Bacteria 1612
189 Ga0265765_1002236 3300030879 Bacteria 1860
190 Ga0265760_10017368 3300031090 Bacteria 2066
191 Ga0265325_10065154 3300031241 Bacteria 1841
192 Ga0265316_10000050 3300031344 Bacteria 127118
193 Ga0307513_10405878 3300031456 Bacteria 1096
194 Ga0316575_10000172 3300031665 Bacteria 16621
195 Ga0316575_10020377 3300031665 Bacteria 2544
196 Ga0316579_10003131 3300031691 Bacteria 6391
197 Ga0316576_10000182 3300031727 Bacteria 26139
198 Ga0316576_10196493 3300031727 Bacteria 1520
199 Ga0316578_10002088 3300031728 Bacteria 8561
200 Ga0316578_10099807 3300031728 Bacteria 1740
201 Ga0316578_10355791 3300031728 Bacteria 871
202 Ga0316578_10469521 3300031728 Bacteria 743
203 Ga0316578_10628245 3300031728 Bacteria 628
204 Ga0316577_10000724 3300031733 Bacteria 14047
205 Ga0316577_10688360 3300031733 Bacteria 581
206 Ga0307410_10132269 3300031852 Bacteria 1834
207 Ga0307406_10667066 3300031901 Bacteria 865
208 Ga0307411_10606141 3300032005 Bacteria 942
209 Ga0316583_10000234 3300032133 Bacteria 15012
210 Ga0316583_10008025 3300032133 Bacteria 3803
211 Ga0316583_10085375 3300032133 Bacteria 1102
212 Ga0316583_10150261 3300032133 Bacteria 811
213 Ga0316585_10000324 3300032137 Bacteria 10753
214 Ga0316580_10002165 3300032139 Bacteria 5350
215 Ga0373923_0126846 3300035111 Bacteria 1144
216 Ga0373936_0218351 3300035113 Bacteria 845
217 Ga0373955_0486069 3300035172 Bacteria 754
218 Ga0316574_0000019 3300035398 Bacteria 40791
219 Ga0316574_0001195 3300035398 Bacteria 12054
220 Ga0316574_0286672 3300035398 Bacteria 1048
221 Ga0373927_0355494 3300035695 Unclassified 965
222 Ga0373933_0020349 3300035724 Bacteria 3762
223 Ga0373947_0149924 3300035725 Bacteria 1501
224 Ga0373937_0670511 3300036401 Bacteria 983
225 Ga0316582_0000214 3300036647 Bacteria 18775
226 Ga0316582_0006270 3300036647 Bacteria 6227
227 Ga0316582_0055003 3300036647 Bacteria 2536
228 Ga0316582_0121291 3300036647 Bacteria 1749
229 Ga0316582_1239077 3300036647 Bacteria 507
230 Ga0316584_0000373 3300036712 Bacteria 23058
231 Ga0316584_0009726 3300036712 Bacteria 6688
232 Ga0316584_0036940 3300036712 Bacteria 3626
233 Ga0316584_0061899 3300036712 Bacteria 2803
234 Ga0316584_0340964 3300036712 Bacteria 1077
235 Ga0316584_0581653 3300036712 Bacteria 778
236 Ga0373925_0028801 3300037068 Bacteria 4072
237 Ga0395900_0335837 3300037418 Bacteria 1488
238 Ga0436365_0591445 3300039437 Bacteria 1771
239 Ga0436365_0705242 3300039437 Bacteria 25927
240 Ga0436365_1060028 3300039437 Bacteria 1021
241 Ga0436365_1603259 3300039437 Bacteria 2661
242 Ga0436365_1755635 3300039437 Bacteria 919
243 Ga0436365_1770326 3300039437 Bacteria 570
244 Ga0436361_1110619 3300039447 Bacteria 1020
245 Ga0436362_0367136 3300039453 Bacteria 2154
246 Ga0451791_1041733 3300041451 Bacteria 623
247 Ga0451800_0212300 3300041459 Bacteria 505
248 Ga0451800_1261863 3300041459 Unclassified 857
249 Ga0451843_0687871 3300041509 Bacteria 931
250 Ga0451855_0812595 3300041511 Bacteria 624
251 Ga0439456_127935 3300042013 Unclassified 585
252 Ga0451577_0027664 3300042876 Bacteria 5132
253 Ga0451577_0152197 3300042876 Bacteria 2082
254 Ga0466972_0000020 3300044658 Bacteria 197336
255 Ga0453683_0103253 3300044673 Bacteria 1790
256 Ga0453683_0142146 3300044673 Bacteria 1515
257 Ga0453684_0000669 3300044712 Bacteria 122669
258 Ga0453684_0050714 3300044712 Bacteria 5454
259 Ga0453684_0116308 3300044712 Bacteria 3239
260 Ga0453684_0962322 3300044712 Bacteria 910
261 Ga0466968_0033522 3300044735 Bacteria 2140
262 Ga0466970_0000491 3300044765 Bacteria 19409
263 Ga0466960_0481254 3300044901 Bacteria 725
264 Ga0451576_0009497 3300045051 Bacteria 11271
265 Ga0466967_1096016 3300045976 Bacteria 793
266 Ga0495629_0423494 3300046459 Unclassified 903
267 Ga0495629_1101083 3300046459 Unclassified 513
268 Ga0495653_0515863 3300046463 Bacteria 743
269 Ga0495640_0107599 3300046533 Bacteria 1825
270 Ga0495645_0365960 3300046543 Bacteria 926
271 Ga0495604_0054500 3300047317 Bacteria 3085
272 Ga0495680_0040583 3300047322 Bacteria 3707
273 Ga0495684_0167716 3300047471 Unclassified 1635
274 Ga0495602_0071114 3300048088 Bacteria 2973
275 Ga0501034_0749246 3300049571 Bacteria 872
276 Ga0501075_0470360 3300049591 Bacteria 959
277 Ga0501076_1047734 3300049592 Bacteria 672
278 Ga0501198_003358 3300049649 Bacteria 2182
279 Ga0501080_0256443 3300049742 Bacteria 1594
280 Ga0501080_1099784 3300049742 Bacteria 686
281 Ga0501270_015835 3300049767 Bacteria 1082
282 Ga0495612_0045646 3300053078 Bacteria 1794
283 Ga0495612_0233701 3300053078 Bacteria 816
284 Ga0070717_11552592
285 JGI24740J21852_10018970
286 JGI24739J22299_10167720
287 JGI24738J21930_10079622
288 rootH2_10020391
289 rootH2_10183957
290 rootL2_10108323
291 rootH1_10293160
292 Ga0070658_10041994
293 Ga0070676_10101853
294 Ga0070683_100013409
295 Ga0070683_100840280
296 Ga0070683_101114099
297 Ga0070670_100022847
298 Ga0070670_100169843
299 Ga0070670_101039361
300 Ga0070666_10143025
301 Ga0070666_10206872
302 Ga0070680_100608993
303 Ga0070680_101505426
304 Ga0070682_100005234
305 Ga0068868_100928024
306 Ga0070689_101033203
307 Ga0070661_100011248
308 Ga0070661_100213400
309 Ga0070669_100143006
310 Ga0070675_100154942
311 Ga0070675_100172177
312 Ga0070675_100872134
313 Ga0070671_100053117
314 Ga0070674_100103343
315 Ga0070673_100826322
316 Ga0070688_100277020
317 Ga0070659_100010357
318 Ga0070659_100288294
319 Ga0070667_101053452
320 Ga0070663_100675706
321 Ga0070678_100669628
322 Ga0070678_100932308
323 Ga0070662_100155881
324 Ga0070681_10149971
325 Ga0068867_100129613
326 Ga0068867_100881110
327 Ga0070706_100508272
328 Ga0070707_101043496
329 Ga0070679_100097874
330 Ga0070679_100124010
331 Ga0070684_100142957
332 Ga0070697_100605536
333 Ga0068853_100192958
334 Ga0068853_100420450
335 Ga0070686_101342901
336 Ga0070696_100275897
337 Ga0070693_100396517
338 Ga0070693_100400582
339 Ga0070693_100451095
340 Ga0070704_101647839
341 Ga0068855_100050887
342 Ga0068855_100143108
343 Ga0070664_100081033
344 Ga0070664_100329898
345 Ga0068857_100296823
346 Ga0068857_101709256
347 Ga0068854_100078280
348 Ga0068854_100080978
349 Ga0068856_100218938
350 Ga0068852_100052792
351 Ga0068852_100187900
352 Ga0068852_102168572
353 Ga0068859_100750703
354 Ga0068864_101247296
355 Ga0068866_10009251
356 Ga0068861_100739241
357 Ga0068851_10396037
358 Ga0068863_100815068
359 Ga0068860_100057178
360 Ga0068860_102014175
361 Ga0081539_10003232
362 Ga0081539_10289775
363 Ga0070716_101554178
364 Ga0075366_10014150
365 Ga0075366_10289720
366 Ga0097621_100013009
367 Ga0097621_102011114
368 Ga0068871_100060964
369 Ga0068865_101541011
370 Ga0097620_100750715
371 Ga0105240_10005685
372 Ga0111539_11179089
373 Ga0114129_10102304
374 Ga0114129_11319281
375 Ga0105243_10747104
376 Ga0105241_10445141
377 Ga0105242_10050036
378 Ga0105242_10692556
379 Ga0105242_10723239
380 Ga0105237_10022946
381 Ga0105249_10580163
382 Ga0105249_11064460
383 Ga0099796_10033267
384 Ga0105239_10014300
385 Ga0105239_10416637
386 Ga0105239_10526834
387 Ga0157373_10001178
388 Ga0157371_10052304
389 Ga0157371_10079307
390 Ga0157371_10379691
391 Ga0157371_10591576
392 Ga0157370_10063710
393 Ga0157370_10745450
394 Ga0157370_11277729
395 Ga0157369_10039893
396 Ga0157369_10225107
397 Ga0157369_10385464
398 Ga0157374_10077681
399 Ga0157374_10124604
400 Ga0157374_10137638
401 Ga0157378_10020917
402 Ga0157378_10062964
403 Ga0163162_10049012
404 Ga0163162_10084022
405 Ga0163162_10154564
406 Ga0163162_10940217
407 Ga0163162_11483847
408 Ga0157372_10015076
409 Ga0157372_10069116
410 Ga0157372_10082015
411 Ga0157372_10114082
412 Ga0157372_10127474
413 Ga0157372_10306949
414 Ga0157372_11313405
415 Ga0157372_11666769
416 Ga0157372_11798124
417 Ga0157372_11954400
418 Ga0157372_12007125
419 Ga0157375_10681747
420 Ga0157375_10876979
421 Ga0157375_11689279
422 Ga0157379_10853608
423 Ga0157376_10308855
424 Ga0157376_10695785
425 Ga0163161_10828795
426 Ga0213876_10005276
427 Ga0213876_10519014
428 Ga0213876_10692738
429 Ga0207656_10504617
430 Ga0207642_10202142
431 Ga0207680_10430062
432 Ga0207680_10933279
433 Ga0207647_10236022
434 Ga0207647_10285146
435 Ga0207705_10062721
436 Ga0207654_10879149
437 Ga0207695_10002995
438 Ga0207671_10019466
439 Ga0207660_10349799
440 Ga0207660_10386782
441 Ga0207649_10433274
442 Ga0207652_10067209
443 Ga0207650_10114990
444 Ga0207659_10036540
445 Ga0207659_10298830
446 Ga0207644_11307197
447 Ga0207706_10001682
448 Ga0207689_10108591
449 Ga0207661_10075631
450 Ga0207661_10160931
451 Ga0207661_10240246
452 Ga0207679_10059249
453 Ga0207679_10516403
454 Ga0207667_10072921
455 Ga0207651_11040416
456 Ga0207712_10779214
457 Ga0207640_10064262
458 Ga0207677_10022183
459 Ga0207639_10078451
460 Ga0207639_10614049
461 Ga0207678_10401402
462 Ga0207702_10207329
463 Ga0207641_10421370
464 Ga0207676_10128036
465 Ga0207674_10212590
466 Ga0207675_100076870
467 Ga0207683_10472049
468 Ga0207698_10782758
469 Ga0207698_12488780
470 Ga0265338_10316266
471 Ga0265324_10040568
472 Ga0265765_1002236
473 Ga0265760_10017368
474 Ga0265325_10065154
475 Ga0265316_10000050
476 Ga0307513_10405878
477 Ga0316575_10000172
478 Ga0316575_10020377
479 Ga0316579_10003131
480 Ga0316576_10000182
481 Ga0316576_10196493
482 Ga0316578_10002088
483 Ga0316578_10099807
484 Ga0316578_10355791
485 Ga0316578_10469521
486 Ga0316578_10628245
487 Ga0316577_10000724
488 Ga0316577_10688360
489 Ga0307410_10132269
490 Ga0307406_10667066
491 Ga0307411_10606141
492 Ga0316583_10000234
493 Ga0316583_10008025
494 Ga0316583_10085375
495 Ga0316583_10150261
496 Ga0316585_10000324
497 Ga0316580_10002165
498 Ga0373923_0126846
499 Ga0373936_0218351
500 Ga0373955_0486069
501 Ga0316574_0000019
502 Ga0316574_0001195
503 Ga0316574_0286672
504 Ga0373927_0355494
505 Ga0373933_0020349
506 Ga0373947_0149924
507 Ga0373937_0670511
508 Ga0316582_0000214
509 Ga0316582_0006270
510 Ga0316582_0055003
511 Ga0316582_0121291
512 Ga0316582_1239077
513 Ga0316584_0000373
514 Ga0316584_0009726
515 Ga0316584_0036940
516 Ga0316584_0061899
517 Ga0316584_0340964
518 Ga0316584_0581653
519 Ga0373925_0028801
520 Ga0395900_0335837
521 Ga0436365_0591445
522 Ga0436365_0705242
523 Ga0436365_1060028
524 Ga0436365_1603259
525 Ga0436365_1755635
526 Ga0436365_1770326
527 Ga0436361_1110619
528 Ga0436362_0367136
529 Ga0451791_1041733
530 Ga0451800_0212300
531 Ga0451800_1261863
532 Ga0451843_0687871
533 Ga0451855_0812595
534 Ga0439456_127935
535 Ga0451577_0027664
536 Ga0451577_0152197
537 Ga0466972_0000020
538 Ga0453683_0103253
539 Ga0453683_0142146
540 Ga0453684_0000669
541 Ga0453684_0050714
542 Ga0453684_0116308
543 Ga0453684_0962322
544 Ga0466968_0033522
545 Ga0466970_0000491
546 Ga0466960_0481254
547 Ga0451576_0009497
548 Ga0466967_1096016
549 Ga0495629_0423494
550 Ga0495629_1101083
551 Ga0495653_0515863
552 Ga0495640_0107599
553 Ga0495645_0365960
554 Ga0495604_0054500
555 Ga0495680_0040583
556 Ga0495684_0167716
557 Ga0495602_0071114
558 Ga0501034_0749246
559 Ga0501075_0470360
560 Ga0501076_1047734
561 Ga0501198_003358
562 Ga0501080_0256443
563 Ga0501080_1099784
564 Ga0501270_015835
565 Ga0495612_0045646
566 Ga0495612_0233701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

19

161

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.9652 5 123
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9124 3 125
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.9021 3 125
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.8993 3 118
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.8907 3 125
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9612 5 124 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9175 2 123 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9102 2 123 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8888 5 124 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.7079 1 123 2.40.280.10
ID Description Score Start End GO Terms
AF-A0A660ZPQ7-F1-model_v4 SsrA-binding protein 0.9832 5 124 GO:0003723
GO:0005829
AF-A7L9H9-F1-model_v4 SmpB 0.9773 16 117 GO:0003723
GO:0005829
AF-A0A6G1V3L8-F1-model_v4 deleted 0.9758 4 124
AF-A0A5N9E9B2-F1-model_v4 SsrA-binding protein SmpB 0.9751 5 124 GO:0003723
GO:0005829
AF-A0A2E4CD78-F1-model_v4 SsrA-binding protein 0.9745 5 128 GO:0003723
GO:0005829

Map