F385317

General Info

Members Datasets Scaffolds Average Seq Length
283 183 273 241

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10002437|rootH2_100024374
Length 253
Sequence MINCVIIDDEPLAREGLASYVREIDFLHLVDTCENPLELIKLMNRHVIDLIFLDIQMPKMNGLDFLKAVQNPPIVVITTAYPTYALEGFQLNVLDYLLKPITFDRFFKSVKKAGDYYHLINKPAGSTPAQSDPAVMKTNPAEDYFFIRCGSKYEKIHFDQILYIEGMQNYITIYTQKGKFVTLLYLKNLEENLDSRSFIRVHKSYIVSIDKIQGIEGNEIFIQSHRIPMSRNYREQVLQQVVAKKLWTRPPIS

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
147 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
148 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
152 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
153 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
154 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
155 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
156 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
157 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
160 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
170 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
177 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
182 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
183 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.19
Nodule 0
Rhizoplane 0.71
Rhizosphere 71.73
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007351 3300001989 Bacteria 4136
2 JGI24739J22299_10044513 3300001989 Bacteria 1461
3 JGI24737J22298_10000298 3300001990 Bacteria 16486
4 JGI24735J21928_10000044 3300002067 Bacteria 57824
5 JGI25158J39367_1020710 3300002739 Bacteria 802
6 rootH1_10138601 3300003316 Bacteria 5803
7 rootH2_10001944 3300003320 Bacteria 18158
8 rootH2_10002437 3300003320 Bacteria 6611
9 rootH2_10030514 3300003320 Bacteria 37510
10 rootH2_10073481 3300003320 Bacteria 9274
11 rootH2_10076271 3300003320 Bacteria 4282
12 rootL2_10035847 3300003322 Bacteria 3312
13 rootL2_10070756 3300003322 Bacteria 8491
14 rootL2_10079312 3300003322 Bacteria 16705
15 rootL2_10103611 3300003322 Bacteria 2500
16 rootH1_10017298 3300003323 Bacteria 12898
17 rootH1_10039172 3300003323 Bacteria 21612
18 rootH1_10090464 3300003323 Bacteria 4957
19 rootH1_10164930 3300003316 Bacteria 1728
20 rootH1_10164930 3300003323 Bacteria 1286
21 JGI25160J50197_1006712 3300003354 Bacteria 4622
22 Ga0055536_1010028 3300003781 Bacteria 3826
23 Ga0055531_10000076 3300003794 Bacteria 106998
24 Ga0065165_1000085 3300005262 Bacteria 154355
25 Ga0065165_1006588 3300005262 Bacteria 6033
26 Ga0065165_1024468 3300005262 Bacteria 2027
27 Ga0065714_10069197 3300005288 Bacteria 4343
28 Ga0070670_100441026 3300005331 Bacteria 1153
29 Ga0068869_100058696 3300005334 Bacteria 2814
30 Ga0070666_10017970 3300005335 Unclassified 4539
31 Ga0068868_100094211 3300005338 Bacteria 2415
32 Ga0070669_100213794 3300005353 Unclassified 1522
33 Ga0070674_100263770 3300005356 Bacteria 1358
34 Ga0070667_100014864 3300005367 Bacteria 6430
35 Ga0070663_100318851 3300005455 Bacteria 1249
36 Ga0068867_100024015 3300005459 Bacteria 4369
37 Ga0070698_100045856 3300005471 Bacteria 4473
38 Ga0070699_100420655 3300005518 Bacteria 1209
39 Ga0068853_100002461 3300005539 Bacteria 13862
40 Ga0068853_100235762 3300005539 Bacteria 1675
41 Ga0070672_100640306 3300005543 Unclassified 928
42 Ga0070665_100000008 3300005548 Bacteria 606341
43 Ga0070665_100000083 3300005548 Bacteria 181044
44 Ga0070665_100353886 3300005548 Bacteria 1474
45 Ga0068855_100055331 3300005563 Unclassified 4661
46 Ga0068855_100245444 3300005563 Bacteria 1999
47 Ga0068855_100256886 3300005563 Bacteria 1948
48 Ga0068855_100372997 3300005563 Bacteria 1568
49 Ga0068856_100030559 3300005614 Bacteria 5265
50 Ga0068856_100114365 3300005614 Bacteria 2698
51 Ga0068852_100414736 3300005616 Bacteria 1327
52 Ga0068859_100056318 3300005617 Bacteria 3956
53 Ga0068864_100240847 3300005618 Bacteria 1676
54 Ga0068861_100361874 3300005719 Bacteria 1276
55 Ga0068851_10006220 3300005834 Bacteria 5448
56 Ga0068860_100000059 3300005843 Bacteria 196400
57 Ga0068860_100002928 3300005843 Bacteria 17676
58 Ga0075366_10000785 3300006195 Bacteria 15187
59 Ga0075366_10008516 3300006195 Bacteria 5706
60 Ga0075366_10119038 3300006195 Unclassified 1591
61 Ga0068871_100076216 3300006358 Bacteria 2769
62 Ga0097620_100056318 3300006931 Bacteria 3956
63 Ga0105240_10000383 3300009093 Bacteria 83057
64 Ga0105240_10000767 3300009093 Bacteria 58332
65 Ga0105240_10058723 3300009093 Bacteria 4802
66 Ga0105240_10310673 3300009093 Bacteria 1800
67 Ga0105240_10450532 3300009093 Unclassified 1440
68 Ga0105241_10007401 3300009174 Bacteria 8078
69 Ga0105241_10148488 3300009174 Bacteria 1915
70 Ga0105241_10229208 3300009174 Bacteria 1565
71 Ga0105242_10046829 3300009176 Bacteria 3510
72 Ga0105237_10001181 3300009545 Bacteria 34916
73 Ga0105237_10007518 3300009545 Bacteria 11914
74 Ga0105237_10009320 3300009545 Bacteria 10517
75 Ga0105237_10011754 3300009545 Bacteria 9262
76 Ga0105237_10023294 3300009545 Bacteria 6346
77 Ga0105237_10031458 3300009545 Bacteria 5381
78 Ga0105237_10072336 3300009545 Bacteria 3442
79 Ga0105238_10002718 3300009551 Bacteria 17614
80 Ga0105238_10017652 3300009551 Bacteria 7254
81 Ga0105238_10074957 3300009551 Bacteria 3376
82 Ga0105238_10128742 3300009551 Bacteria 2510
83 Ga0105249_10137114 3300009553 Bacteria 2343
84 Ga0105239_10000006 3300010375 Bacteria 442319
85 Ga0105239_10000101 3300010375 Bacteria 119610
86 Ga0105239_10007622 3300010375 Bacteria 12404
87 Ga0105239_10040793 3300010375 Bacteria 5086
88 Ga0105239_10050865 3300010375 Bacteria 4543
89 Ga0105239_10050920 3300010375 Bacteria 4541
90 Ga0105239_10402984 3300010375 Unclassified 1548
91 Ga0157373_10094136 3300013100 Bacteria 2110
92 Ga0157371_10014581 3300013102 Bacteria 5925
93 Ga0157371_10397059 3300013102 Bacteria 1009
94 Ga0157370_10320241 3300013104 Unclassified 1430
95 Ga0157370_10382361 3300013104 Bacteria 1297
96 Ga0157374_10000002 3300013296 Bacteria 1054226
97 Ga0157378_10020057 3300013297 Bacteria 5879
98 Ga0157378_10073597 3300013297 Bacteria 3072
99 Ga0157378_10266284 3300013297 Bacteria 1646
100 Ga0163162_10000068 3300013306 Bacteria 97068
101 Ga0163162_10000164 3300013306 Bacteria 60866
102 Ga0163162_10010031 3300013306 Bacteria 9211
103 Ga0157372_10001255 3300013307 Bacteria 27453
104 Ga0157372_10009524 3300013307 Bacteria 10326
105 Ga0157375_10090357 3300013308 Bacteria 3121
106 Ga0163163_10679380 3300014325 Bacteria 1093
107 Ga0163163_10819201 3300014325 Bacteria 994
108 Ga0163163_11431316 3300014325 Unclassified 753
109 Ga0157380_10064499 3300014326 Bacteria 2941
110 Ga0157380_10603183 3300014326 Bacteria 1087
111 Ga0157376_10007195 3300014969 Bacteria 7913
112 Ga0182005_1000876 3300015265 Bacteria 13338
113 Ga0163161_10010871 3300017792 Bacteria 6309
114 Ga0209436_101312 3300025208 Bacteria 8843
115 Ga0209455_1001540 3300025272 Bacteria 10253
116 Ga0209676_1000695 3300025292 Bacteria 47271
117 Ga0209050_1001379 3300025298 Bacteria 26506
118 Ga0209050_1019679 3300025298 Bacteria 2550
119 Ga0209050_1035851 3300025298 Bacteria 1460
120 Ga0207426_1000258 3300025302 Bacteria 114759
121 Ga0207426_1002492 3300025302 Bacteria 11668
122 Ga0209257_1000064 3300025304 Bacteria 356803
123 Ga0207656_10023684 3300025321 Bacteria 2475
124 Ga0207680_10017049 3300025903 Unclassified 3829
125 Ga0207647_10060307 3300025904 Bacteria 2319
126 Ga0207654_10005646 3300025911 Bacteria 6324
127 Ga0207654_10088393 3300025911 Bacteria 1883
128 Ga0207695_10000300 3300025913 Bacteria 122104
129 Ga0207695_10000425 3300025913 Bacteria 93523
130 Ga0207695_10045234 3300025913 Unclassified 4674
131 Ga0207695_10098906 3300025913 Bacteria 2916
132 Ga0207695_10224248 3300025913 Bacteria 1786
133 Ga0207695_10328519 3300025913 Unclassified 1418
134 Ga0207671_10001986 3300025914 Bacteria 22556
135 Ga0207671_10003135 3300025914 Bacteria 16794
136 Ga0207671_10004571 3300025914 Bacteria 13146
137 Ga0207671_10008950 3300025914 Bacteria 8424
138 Ga0207671_10020482 3300025914 Bacteria 5033
139 Ga0207671_10041005 3300025914 Bacteria 3426
140 Ga0207671_10106360 3300025914 Bacteria 2130
141 Ga0207671_10109747 3300025914 Bacteria 2098
142 Ga0207681_10400003 3300025923 Unclassified 1109
143 Ga0207694_10026658 3300025924 Unclassified 4398
144 Ga0207694_10112718 3300025924 Unclassified 2164
145 Ga0207694_10142269 3300025924 Bacteria 1929
146 Ga0207686_10401267 3300025934 Bacteria 1044
147 Ga0207709_10201910 3300025935 Unclassified 1420
148 Ga0207689_10106876 3300025942 Unclassified 2299
149 Ga0207689_10260953 3300025942 Bacteria 1433
150 Ga0207667_10043790 3300025949 Bacteria 4748
151 Ga0207667_10044499 3300025949 Unclassified 4704
152 Ga0207667_10184673 3300025949 Bacteria 2141
153 Ga0207667_10244394 3300025949 Bacteria 1836
154 Ga0207640_10572928 3300025981 Bacteria 952
155 Ga0207658_10025533 3300025986 Bacteria 4137
156 Ga0207677_10087726 3300026023 Bacteria 2253
157 Ga0207639_10013034 3300026041 Bacteria 5804
158 Ga0207639_10244588 3300026041 Bacteria 1562
159 Ga0207678_10868781 3300026067 Unclassified 797
160 Ga0207702_10072282 3300026078 Bacteria 2973
161 Ga0207702_10078082 3300026078 Bacteria 2865
162 Ga0207702_10085795 3300026078 Bacteria 2744
163 Ga0207641_10035801 3300026088 Bacteria 4139
164 Ga0207648_10113924 3300026089 Bacteria 2375
165 Ga0207675_100146461 3300026118 Unclassified 2246
166 Ga0207698_10129704 3300026142 Unclassified 2152
167 Ga0207698_10202307 3300026142 Bacteria 1779
168 Ga0268266_10000016 3300028379 Bacteria 629101
169 Ga0268266_10000095 3300028379 Bacteria 186169
170 Ga0268264_10000015 3300028381 Bacteria 508501
171 Ga0268264_10007740 3300028381 Bacteria 8946
172 Ga0307515_10000012 3300028794 Bacteria 582232
173 Ga0307515_10000927 3300028794 Bacteria 67260
174 Ga0307515_10003662 3300028794 Bacteria 32273
175 Ga0307515_10062430 3300028794 Bacteria 5260
176 Ga0316181_1186262 3300030744 Bacteria 2090
177 Ga0307513_10032064 3300031456 Bacteria 5934
178 Ga0307513_10126265 3300031456 Bacteria 2513
179 Ga0307509_10017722 3300031507 Bacteria 8186
180 Ga0307509_10090161 3300031507 Bacteria 3142
181 Ga0307509_10105449 3300031507 Bacteria 2840
182 Ga0307509_10123642 3300031507 Unclassified 2559
183 Ga0307508_10000784 3300031616 Bacteria 37429
184 Ga0307414_10575790 3300032004 Bacteria 1007
185 Ga0395900_0004442 3300037418 Bacteria 14859
186 Ga0395898_0203374 3300037466 Bacteria 1890
187 Ga0395905_0000686 3300037471 Bacteria 44822
188 Ga0395901_0017450 3300038443 Bacteria 7325
189 Ga0451849_0163260 3300041505 Bacteria 1292
190 Ga0439448_0034248 3300042005 Bacteria 1622
191 Ga0466972_0003919 3300044658 Bacteria 7420
192 Ga0466961_0015765 3300044693 Bacteria 4849
193 Ga0466971_0082275 3300044719 Bacteria 1469
194 Ga0466968_0029033 3300044735 Unclassified 2285
195 Ga0466970_0055483 3300044765 Bacteria 2116
196 Ga0466960_0193048 3300044901 Unclassified 1109
197 Ga0466959_0008565 3300045049 Bacteria 7239
198 Ga0495638_0000006 3300046460 Bacteria 668846
199 Ga0495638_0025176 3300046460 Bacteria 3872
200 Ga0495651_0143486 3300046462 Bacteria 1729
201 Ga0495650_0000231 3300046471 Bacteria 113969
202 Ga0495585_0000037 3300046492 Bacteria 133335
203 Ga0495585_0000763 3300046492 Bacteria 28491
204 Ga0495606_0000060 3300046507 Bacteria 185907
205 Ga0495610_0001259 3300046512 Bacteria 22719
206 Ga0495616_0002773 3300046513 Bacteria 11442
207 Ga0495637_0041890 3300046520 Bacteria 1962
208 Ga0495648_0002202 3300046524 Bacteria 18263
209 Ga0495609_0021762 3300046538 Bacteria 2958
210 Ga0495622_0007405 3300046557 Bacteria 5092
211 Ga0495633_0004772 3300046558 Bacteria 8502
212 Ga0495611_0151896 3300046648 Bacteria 1081
213 Ga0495625_0000018 3300046660 Bacteria 299567
214 Ga0495625_0033460 3300046660 Bacteria 3802
215 Ga0495661_0007901 3300046665 Bacteria 7390
216 Ga0495649_0000111 3300046694 Bacteria 71877
217 Ga0495649_0023631 3300046694 Bacteria 3434
218 Ga0495649_0230488 3300046694 Unclassified 956
219 Ga0495589_0195751 3300046794 Bacteria 955
220 Ga0495672_0036260 3300047320 Bacteria 3029
221 Ga0495683_0086331 3300047323 Bacteria 1525
222 Ga0495687_000004 3300047443 Bacteria 779298
223 Ga0495687_000220 3300047443 Bacteria 80993
224 Ga0495686_0009592 3300047472 Bacteria 6958
225 Ga0495686_0019608 3300047472 Bacteria 4519
226 Ga0496101_0416360 3300048904 Bacteria 1059
227 Ga0496121_0000007 3300048924 Bacteria 942516
228 Ga0496126_0012177 3300048929 Bacteria 8828
229 Ga0501300_000512 3300049523 Bacteria 5800
230 Ga0501037_0225491 3300049573 Bacteria 1317
231 Ga0501047_0031404 3300049581 Bacteria 5123
232 Ga0501198_022994 3300049649 Unclassified 1001
233 Ga0501199_001666 3300049650 Bacteria 2033
234 Ga0501206_003792 3300049653 Bacteria 1919
235 Ga0501207_002697 3300049654 Bacteria 2316
236 Ga0501217_000984 3300049661 Bacteria 5128
237 Ga0501222_003649 3300049662 Bacteria 2098
238 Ga0501233_070698 3300049668 Unclassified 884
239 Ga0501238_005975 3300049671 Unclassified 1558
240 Ga0501242_000033 3300049674 Bacteria 8609
241 Ga0501247_000648 3300049677 Bacteria 2919
242 Ga0501257_000206 3300049686 Bacteria 11793
243 Ga0501259_002061 3300049688 Bacteria 3318
244 Ga0501225_0002633 3300049705 Bacteria 5513
245 Ga0501225_0021935 3300049705 Unclassified 1763
246 Ga0501232_003142 3300049757 Bacteria 1488
247 Ga0501241_005001 3300049758 Bacteria 2478
248 Ga0501035_0352721 3300049822 Bacteria 1231
249 Ga0501044_0062989 3300049823 Bacteria 3790
250 nmdc:mga0k408_293_c1 3300050493 Bacteria 24289
251 Ga0500578_0001015 3300053086 Bacteria 30967
252 Ga0500644_0000202 3300053088 Bacteria 36222
253 Ga0500583_0009292 3300053092 Bacteria 3584
254 Ga0500583_0074703 3300053092 Unclassified 1627
255 Ga0500651_0127938 3300053093 Bacteria 1538
256 Ga0500641_0005531 3300053096 Bacteria 4474
257 Ga0500569_000108 3300053109 Bacteria 12916
258 Ga0500607_214726 3300053121 Bacteria 809
259 Ga0500618_019925 3300053125 Bacteria 1647
260 Ga0500642_0256404 3300053130 Unclassified 801
261 Ga0500658_0002250 3300053134 Bacteria 7480
262 Ga0500559_0035854 3300053136 Unclassified 2144
263 Ga0500568_0009857 3300053139 Bacteria 4514
264 Ga0500577_0003804 3300053142 Bacteria 3942
265 Ga0500590_054509 3300053148 Unclassified 2025
266 Ga0500616_0000065 3300053153 Bacteria 239287
267 Ga0500619_084749 3300053154 Bacteria 1067
268 Ga0500622_0000203 3300053156 Bacteria 63042
269 Ga0500622_0000922 3300053156 Bacteria 24956
270 Ga0500622_0054539 3300053156 Bacteria 2050
271 Ga0500624_000362 3300053157 Bacteria 14665
272 Ga0500611_000109 3300053727 Bacteria 19729
273 Ga0500661_006883 3300055283 Unclassified 2110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0007405 Ga0495622_0007405_13_576 187
2 3300053130 Ga0500642_0256404 Ga0500642_0256404_47_670 204
3 3300053154 Ga0500619_084749 Ga0500619_084749_427_1041 204
4 3300005617 Ga0068859_100056318 Ga0068859_1000563183 217
5 3300006931 Ga0097620_100056318 Ga0097620_1000563183 217
6 3300013297 Ga0157378_10073597 Ga0157378_100735972 217
7 3300005539 Ga0068853_100235762 Ga0068853_1002357622 218
8 3300006195 Ga0075366_10000785 Ga0075366_100007859 222
9 3300050493 nmdc:mga0k408_293_c1 nmdc:mga0k408_293_c1_8727_9461 222
10 3300005543 Ga0070672_100640306 Ga0070672_1006403061 224
11 3300025942 Ga0207689_10106876 Ga0207689_101068763 224
12 3300013306 Ga0163162_10000068 Ga0163162_1000006837 226
13 3300025935 Ga0207709_10201910 Ga0207709_102019102 226
14 3300005356 Ga0070674_100263770 Ga0070674_1002637702 228
15 3300005539 Ga0068853_100002461 Ga0068853_1000024613 228
16 3300005548 Ga0070665_100000083 Ga0070665_10000008338 228
17 3300025949 Ga0207667_10043790 Ga0207667_100437902 228
18 3300026041 Ga0207639_10013034 Ga0207639_100130343 228
19 3300028379 Ga0268266_10000095 Ga0268266_1000009542 228
20 iso_pu_bacteria 2896109856 2896109896 230
21 3300005331 Ga0070670_100441026 Ga0070670_1004410262 231
22 3300014325 Ga0163163_11431316 Ga0163163_114313161 231
23 3300026067 Ga0207678_10868781 Ga0207678_108687811 231
24 3300042005 Ga0439448_0034248 Ga0439448_0034248_440_1183 231
25 3300044901 Ga0466960_0193048 Ga0466960_0193048_92_928 231
26 3300053088 Ga0500644_0000202 Ga0500644_0000202_31955_32650 231
27 3300053109 Ga0500569_000108 Ga0500569_000108_12047_12742 231
28 3300053134 Ga0500658_0002250 Ga0500658_0002250_6537_7232 231
29 iso_pu_bacteria 2929239360 2929241170 231
30 3300028794 Ga0307515_10003662 Ga0307515_100036626 232
31 3300046694 Ga0495649_0230488 Ga0495649_0230488_138_872 232
32 3300031507 Ga0307509_10017722 Ga0307509_100177222 234
33 3300047472 Ga0495686_0009592 Ga0495686_0009592_1930_2634 234
34 3300005353 Ga0070669_100213794 Ga0070669_1002137941 235
35 3300025923 Ga0207681_10400003 Ga0207681_104000032 235
36 3300053092 Ga0500583_0074703 Ga0500583_0074703_62_769 235
37 3300053093 Ga0500651_0127938 Ga0500651_0127938_558_1265 235
38 3300053121 Ga0500607_214726 Ga0500607_214726_39_746 235
39 3300053136 Ga0500559_0035854 Ga0500559_0035854_132_839 235
40 3300053142 Ga0500577_0003804 Ga0500577_0003804_621_1328 235
41 3300053148 Ga0500590_054509 Ga0500590_054509_475_1182 235
42 3300055283 Ga0500661_006883 Ga0500661_006883_1275_1982 235
43 iso_pu_bacteria 2522125168 2522553258 235
44 iso_pu_bacteria 2842903701 2842904657 235
45 3300003322 rootL2_10035847 rootL2_100358473 236
46 3300003320 rootH2_10073481 rootH2_1007348111 237
47 3300003320 rootH2_10030514 rootH2_100305146 238
48 3300003354 JGI25160J50197_1006712 JGI25160J50197_10067123 238
49 3300005518 Ga0070699_100420655 Ga0070699_1004206552 238
50 3300005548 Ga0070665_100353886 Ga0070665_1003538862 238
51 3300025302 Ga0207426_1000258 Ga0207426_100025858 238
52 3300044693 Ga0466961_0015765 Ga0466961_0015765_430_1155 238
53 3300044719 Ga0466971_0082275 Ga0466971_0082275_168_893 238
54 3300044765 Ga0466970_0055483 Ga0466970_0055483_355_1080 238
55 3300045049 Ga0466959_0008565 Ga0466959_0008565_3575_4300 238
56 3300003781 Ga0055536_1010028 Ga0055536_10100284 239
57 3300005262 Ga0065165_1000085 Ga0065165_10000856 239
58 3300005334 Ga0068869_100058696 Ga0068869_1000586962 239
59 3300005338 Ga0068868_100094211 Ga0068868_1000942112 239
60 3300005455 Ga0070663_100318851 Ga0070663_1003188511 239
61 3300005459 Ga0068867_100024015 Ga0068867_1000240156 239
62 3300005471 Ga0070698_100045856 Ga0070698_1000458562 239
63 3300005563 Ga0068855_100055331 Ga0068855_1000553312 239
64 3300005616 Ga0068852_100414736 Ga0068852_1004147362 239
65 3300005618 Ga0068864_100240847 Ga0068864_1002408473 239
66 3300005719 Ga0068861_100361874 Ga0068861_1003618742 239
67 3300006195 Ga0075366_10008516 Ga0075366_100085162 239
68 3300006195 Ga0075366_10119038 Ga0075366_101190382 239
69 3300006358 Ga0068871_100076216 Ga0068871_1000762162 239
70 3300009176 Ga0105242_10046829 Ga0105242_100468293 239
71 3300009545 Ga0105237_10023294 Ga0105237_100232944 239
72 3300009551 Ga0105238_10017652 Ga0105238_100176524 239
73 3300009551 Ga0105238_10074957 Ga0105238_100749574 239
74 3300010375 Ga0105239_10000101 Ga0105239_1000010165 239
75 3300013104 Ga0157370_10320241 Ga0157370_103202411 239
76 3300013307 Ga0157372_10001255 Ga0157372_1000125522 239
77 3300014325 Ga0163163_10679380 Ga0163163_106793802 239
78 3300014325 Ga0163163_10819201 Ga0163163_108192011 239
79 3300025292 Ga0209676_1000695 Ga0209676_100069524 239
80 3300025298 Ga0209050_1035851 Ga0209050_10358512 239
81 3300025913 Ga0207695_10045234 Ga0207695_100452344 239
82 3300025914 Ga0207671_10020482 Ga0207671_100204823 239
83 3300025924 Ga0207694_10112718 Ga0207694_101127181 239
84 3300025924 Ga0207694_10142269 Ga0207694_101422692 239
85 3300025934 Ga0207686_10401267 Ga0207686_104012671 239
86 3300025942 Ga0207689_10260953 Ga0207689_102609532 239
87 3300025949 Ga0207667_10044499 Ga0207667_100444994 239
88 3300026023 Ga0207677_10087726 Ga0207677_100877262 239
89 3300026088 Ga0207641_10035801 Ga0207641_100358013 239
90 3300026089 Ga0207648_10113924 Ga0207648_101139243 239
91 3300026118 Ga0207675_100146461 Ga0207675_1001464612 239
92 3300030744 Ga0316181_1186262 Ga0316181_11862622 239
93 3300031456 Ga0307513_10126265 Ga0307513_101262651 239
94 3300031616 Ga0307508_10000784 Ga0307508_1000078431 239
95 3300032004 Ga0307414_10575790 Ga0307414_105757901 239
96 3300049705 Ga0501225_0021935 Ga0501225_0021935_84_803 239
97 3300049758 Ga0501241_005001 Ga0501241_005001_1372_2112 239
98 3300053086 Ga0500578_0001015 Ga0500578_0001015_1985_2707 239
99 3300053096 Ga0500641_0005531 Ga0500641_0005531_447_1169 239
100 3300053156 Ga0500622_0054539 Ga0500622_0054539_93_815 239
101 3300053727 Ga0500611_000109 Ga0500611_000109_7714_8436 239
102 iso_pu_bacteria 2818991442 2819575439 239
103 iso_pu_bacteria 2821136567 2821137983 239
104 iso_pu_bacteria 2904467357 2904468778 239
105 3300003322 rootL2_10070756 rootL2_100707561 240
106 3300005367 Ga0070667_100014864 Ga0070667_1000148643 240
107 3300005834 Ga0068851_10006220 Ga0068851_100062204 240
108 3300005843 Ga0068860_100002928 Ga0068860_1000029283 240
109 3300009093 Ga0105240_10000383 Ga0105240_1000038313 240
110 3300009093 Ga0105240_10000767 Ga0105240_1000076739 240
111 3300009174 Ga0105241_10007401 Ga0105241_100074016 240
112 3300009545 Ga0105237_10011754 Ga0105237_100117543 240
113 3300009545 Ga0105237_10031458 Ga0105237_100314583 240
114 3300009551 Ga0105238_10002718 Ga0105238_1000271813 240
115 3300010375 Ga0105239_10050865 Ga0105239_100508652 240
116 3300013100 Ga0157373_10094136 Ga0157373_100941362 240
117 3300013297 Ga0157378_10020057 Ga0157378_100200572 240
118 3300014326 Ga0157380_10603183 Ga0157380_106031831 240
119 3300025298 Ga0209050_1001379 Ga0209050_10013792 240
120 3300025298 Ga0209050_1019679 Ga0209050_10196794 240
121 3300025321 Ga0207656_10023684 Ga0207656_100236843 240
122 3300025911 Ga0207654_10005646 Ga0207654_100056464 240
123 3300025913 Ga0207695_10000300 Ga0207695_1000030061 240
124 3300025913 Ga0207695_10000425 Ga0207695_1000042533 240
125 3300025914 Ga0207671_10004571 Ga0207671_1000457112 240
126 3300025914 Ga0207671_10109747 Ga0207671_101097472 240
127 3300025924 Ga0207694_10026658 Ga0207694_100266585 240
128 3300025986 Ga0207658_10025533 Ga0207658_100255335 240
129 3300026041 Ga0207639_10244588 Ga0207639_102445882 240
130 3300026078 Ga0207702_10072282 Ga0207702_100722823 240
131 3300026142 Ga0207698_10202307 Ga0207698_102023072 240
132 3300028381 Ga0268264_10007740 Ga0268264_100077403 240
133 3300031456 Ga0307513_10032064 Ga0307513_100320644 240
134 3300046460 Ga0495638_0000006 Ga0495638_0000006_31101_31823 240
135 3300048924 Ga0496121_0000007 Ga0496121_0000007_370617_371339 240
136 3300053153 Ga0500616_0000065 Ga0500616_0000065_9248_9970 240
137 3300003320 rootH2_10001944 rootH2_1000194412 241
138 3300003322 rootL2_10079312 rootL2_100793125 241
139 3300003323 rootH1_10039172 rootH1_1003917211 241
140 3300005262 Ga0065165_1006588 Ga0065165_10065881 241
141 3300013296 Ga0157374_10000002 Ga0157374_10000002721 241
142 3300013308 Ga0157375_10090357 Ga0157375_100903573 241
143 3300014969 Ga0157376_10007195 Ga0157376_100071956 241
144 3300031507 Ga0307509_10105449 Ga0307509_101054492 241
145 3300031507 Ga0307509_10123642 Ga0307509_101236422 241
146 3300046694 Ga0495649_0023631 Ga0495649_0023631_977_1711 241
147 3300049523 Ga0501300_000512 Ga0501300_000512_2010_2741 241
148 3300049649 Ga0501198_022994 Ga0501198_022994_254_979 241
149 3300049650 Ga0501199_001666 Ga0501199_001666_1170_1895 241
150 3300049653 Ga0501206_003792 Ga0501206_003792_178_903 241
151 3300049654 Ga0501207_002697 Ga0501207_002697_73_798 241
152 3300049661 Ga0501217_000984 Ga0501217_000984_3394_4125 241
153 3300049662 Ga0501222_003649 Ga0501222_003649_939_1664 241
154 3300049668 Ga0501233_070698 Ga0501233_070698_96_821 241
155 3300049671 Ga0501238_005975 Ga0501238_005975_308_1039 241
156 3300049674 Ga0501242_000033 Ga0501242_000033_7602_8327 241
157 3300049677 Ga0501247_000648 Ga0501247_000648_878_1609 241
158 3300049686 Ga0501257_000206 Ga0501257_000206_7903_8628 241
159 3300049688 Ga0501259_002061 Ga0501259_002061_2303_3028 241
160 3300049705 Ga0501225_0002633 Ga0501225_0002633_1082_1807 241
161 3300049757 Ga0501232_003142 Ga0501232_003142_353_1078 241
162 3300005563 Ga0068855_100372997 Ga0068855_1003729972 242
163 3300005614 Ga0068856_100114365 Ga0068856_1001143655 242
164 3300009093 Ga0105240_10310673 Ga0105240_103106731 242
165 3300009174 Ga0105241_10148488 Ga0105241_101484882 242
166 3300009174 Ga0105241_10229208 Ga0105241_102292081 242
167 3300009545 Ga0105237_10072336 Ga0105237_100723362 242
168 3300010375 Ga0105239_10007622 Ga0105239_1000762210 242
169 3300014326 Ga0157380_10064499 Ga0157380_100644992 242
170 3300025272 Ga0209455_1001540 Ga0209455_10015409 242
171 3300025911 Ga0207654_10088393 Ga0207654_100883932 242
172 3300025913 Ga0207695_10224248 Ga0207695_102242482 242
173 3300025914 Ga0207671_10106360 Ga0207671_101063602 242
174 3300026078 Ga0207702_10085795 Ga0207702_100857952 242
175 3300031507 Ga0307509_10090161 Ga0307509_100901612 242
176 3300047320 Ga0495672_0036260 Ga0495672_0036260_86_814 242
177 3300053157 Ga0500624_000362 Ga0500624_000362_3533_4261 242
178 iso_pu_bacteria 2599185184 2599481471 242
179 iso_pu_bacteria 2928078545 2928082825 242
180 iso_pu_bacteria 2928147474 2928149842 242
181 iso_pu_bacteria 2932082852 2932086506 242
182 3300002739 JGI25158J39367_1020710 JGI25158J39367_10207101 243
183 3300005262 Ga0065165_1024468 Ga0065165_10244682 243
184 3300005288 Ga0065714_10069197 Ga0065714_100691973 243
185 3300015265 Ga0182005_1000876 Ga0182005_100087612 243
186 3300025208 Ga0209436_101312 Ga0209436_1013125 243
187 3300025302 Ga0207426_1002492 Ga0207426_10024925 243
188 3300028794 Ga0307515_10000927 Ga0307515_1000092742 243
189 3300044658 Ga0466972_0003919 Ga0466972_0003919_5987_6823 243
190 3300046462 Ga0495651_0143486 Ga0495651_0143486_115_849 243
191 3300046492 Ga0495585_0000763 Ga0495585_0000763_19338_20072 243
192 3300049573 Ga0501037_0225491 Ga0501037_0225491_359_1090 243
193 3300049581 Ga0501047_0031404 Ga0501047_0031404_4027_4758 243
194 3300049822 Ga0501035_0352721 Ga0501035_0352721_413_1144 243
195 3300049823 Ga0501044_0062989 Ga0501044_0062989_2064_2795 243
196 3300003794 Ga0055531_10000076 Ga0055531_1000007631 244
197 3300025304 Ga0209257_1000064 Ga0209257_100006432 244
198 3300025914 Ga0207671_10003135 Ga0207671_100031358 244
199 3300003316 rootH1_10138601 rootH1_101386015 245
200 3300003323 rootH1_10017298 rootH1_1001729813 245
201 3300003323 rootH1_10090464 rootH1_100904642 245
202 3300005335 Ga0070666_10017970 Ga0070666_100179702 245
203 3300005614 Ga0068856_100030559 Ga0068856_1000305592 245
204 3300009093 Ga0105240_10058723 Ga0105240_100587234 245
205 3300009551 Ga0105238_10128742 Ga0105238_101287422 245
206 3300010375 Ga0105239_10000006 Ga0105239_10000006249 245
207 3300025903 Ga0207680_10017049 Ga0207680_100170493 245
208 3300025913 Ga0207695_10098906 Ga0207695_100989063 245
209 3300026078 Ga0207702_10078082 Ga0207702_100780822 245
210 3300026142 Ga0207698_10129704 Ga0207698_101297043 245
211 3300028794 Ga0307515_10000012 Ga0307515_10000012492 245
212 3300028794 Ga0307515_10062430 Ga0307515_100624304 245
213 3300037418 Ga0395900_0004442 Ga0395900_0004442_12975_13718 245
214 3300037466 Ga0395898_0203374 Ga0395898_0203374_1033_1776 245
215 3300037471 Ga0395905_0000686 Ga0395905_0000686_11696_12439 245
216 3300038443 Ga0395901_0017450 Ga0395901_0017450_2754_3497 245
217 3300041505 Ga0451849_0163260 Ga0451849_0163260_105_842 245
218 3300046660 Ga0495625_0033460 Ga0495625_0033460_2354_3103 245
219 3300047443 Ga0495687_000004 Ga0495687_000004_643419_644165 245
220 3300048904 Ga0496101_0416360 Ga0496101_0416360_25_762 245
221 3300048929 Ga0496126_0012177 Ga0496126_0012177_2346_3083 245
222 3300001989 JGI24739J22299_10007351 JGI24739J22299_100073512 246
223 3300001989 JGI24739J22299_10044513 JGI24739J22299_100445132 246
224 3300001990 JGI24737J22298_10000298 JGI24737J22298_1000029813 246
225 3300002067 JGI24735J21928_10000044 JGI24735J21928_1000004439 246
226 3300003320 rootH2_10002437 rootH2_100024374 246
227 3300003320 rootH2_10076271 rootH2_100762713 246
228 3300003322 rootL2_10103611 rootL2_101036112 246
229 3300003323 rootH1_10164930 rootH1_101649302 246
230 3300005548 Ga0070665_100000008 Ga0070665_100000008486 246
231 3300005563 Ga0068855_100245444 Ga0068855_1002454442 246
232 3300005563 Ga0068855_100256886 Ga0068855_1002568862 246
233 3300005843 Ga0068860_100000059 Ga0068860_10000005990 246
234 3300009093 Ga0105240_10450532 Ga0105240_104505322 246
235 3300009545 Ga0105237_10001181 Ga0105237_1000118128 246
236 3300009545 Ga0105237_10007518 Ga0105237_100075189 246
237 3300009545 Ga0105237_10009320 Ga0105237_100093208 246
238 3300009553 Ga0105249_10137114 Ga0105249_101371143 246
239 3300010375 Ga0105239_10040793 Ga0105239_100407932 246
240 3300010375 Ga0105239_10050920 Ga0105239_100509203 246
241 3300010375 Ga0105239_10402984 Ga0105239_104029842 246
242 3300013102 Ga0157371_10014581 Ga0157371_100145814 246
243 3300013102 Ga0157371_10397059 Ga0157371_103970591 246
244 3300013104 Ga0157370_10382361 Ga0157370_103823612 246
245 3300013297 Ga0157378_10266284 Ga0157378_102662841 246
246 3300013306 Ga0163162_10000164 Ga0163162_1000016450 246
247 3300013306 Ga0163162_10010031 Ga0163162_100100315 246
248 3300013307 Ga0157372_10009524 Ga0157372_100095244 246
249 3300017792 Ga0163161_10010871 Ga0163161_100108712 246
250 3300025904 Ga0207647_10060307 Ga0207647_100603073 246
251 3300025913 Ga0207695_10328519 Ga0207695_103285192 246
252 3300025914 Ga0207671_10001986 Ga0207671_1000198623 246
253 3300025914 Ga0207671_10008950 Ga0207671_100089506 246
254 3300025914 Ga0207671_10041005 Ga0207671_100410054 246
255 3300025949 Ga0207667_10184673 Ga0207667_101846732 246
256 3300025949 Ga0207667_10244394 Ga0207667_102443942 246
257 3300025981 Ga0207640_10572928 Ga0207640_105729282 246
258 3300028379 Ga0268266_10000016 Ga0268266_10000016484 246
259 3300028381 Ga0268264_10000015 Ga0268264_10000015383 246
260 3300044735 Ga0466968_0029033 Ga0466968_0029033_620_1435 246
261 3300046460 Ga0495638_0025176 Ga0495638_0025176_2736_3485 246
262 3300046471 Ga0495650_0000231 Ga0495650_0000231_108857_109597 246
263 3300046492 Ga0495585_0000037 Ga0495585_0000037_111680_112420 246
264 3300046507 Ga0495606_0000060 Ga0495606_0000060_125174_125914 246
265 3300046512 Ga0495610_0001259 Ga0495610_0001259_13266_14006 246
266 3300046513 Ga0495616_0002773 Ga0495616_0002773_2958_3698 246
267 3300046520 Ga0495637_0041890 Ga0495637_0041890_1133_1873 246
268 3300046524 Ga0495648_0002202 Ga0495648_0002202_15806_16555 246
269 3300046538 Ga0495609_0021762 Ga0495609_0021762_2027_2767 246
270 3300046558 Ga0495633_0004772 Ga0495633_0004772_694_1434 246
271 3300046648 Ga0495611_0151896 Ga0495611_0151896_272_1021 246
272 3300046660 Ga0495625_0000018 Ga0495625_0000018_12638_13378 246
273 3300046665 Ga0495661_0007901 Ga0495661_0007901_2626_3366 246
274 3300046694 Ga0495649_0000111 Ga0495649_0000111_58501_59241 246
275 3300046794 Ga0495589_0195751 Ga0495589_0195751_167_907 246
276 3300047323 Ga0495683_0086331 Ga0495683_0086331_597_1337 246
277 3300047443 Ga0495687_000220 Ga0495687_000220_57081_57821 246
278 3300047472 Ga0495686_0019608 Ga0495686_0019608_267_1007 246
279 3300053092 Ga0500583_0009292 Ga0500583_0009292_1439_2188 246
280 3300053125 Ga0500618_019925 Ga0500618_019925_223_963 246
281 3300053139 Ga0500568_0009857 Ga0500568_0009857_2304_3053 246
282 3300053156 Ga0500622_0000203 Ga0500622_0000203_113_853 246
283 3300053156 Ga0500622_0000922 Ga0500622_0000922_3321_4070 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

151

241

0.94

PF00072

Response_reg

Response regulator receiver domain

4

111

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.8902 2 114
1udr-assembly1.cif.gz_C chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4) 0.8813 1 116
5uxv-assembly2.cif.gz_B crystal structure of anti-anti-sigma factor phyr i40v/s51c mutant from bartonella quintana 0.8806 3 119
5m7n-assembly1.cif.gz_A crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology 0.8791 3 122
3ffx-assembly2.cif.gz_B crystal structure of chey triple mutant f14e, n59r, e89h complexed with bef3- and mn2+ 0.8787 2 118
ID Description Score Start End Superfamily
af_P60611_135_244_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9304 137 234 2.40.50.1020
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9295 135 204 2.40.50.40
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9172 135 204 2.40.50.40
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9106 1 114 3.40.50.2300
af_P38684_4_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9014 4 79 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6N6KK57-F1-model_v4 LytTR family transcriptional regulator 0.9874 138 234 GO:0000156
GO:0003677
AF-A0A4Q5YUE0-F1-model_v4 LytTR family transcriptional regulator 0.9764 137 234 GO:0000156
GO:0003677
AF-A0A0F8ZVN2-F1-model_v4 HTH LytTR-type domain-containing protein 0.9678 147 237 GO:0000156
GO:0003677
AF-A0A1G8F6E8-F1-model_v4 Response regulator receiver domain-containing protein 0.9625 2 121 GO:0000160
AF-A0A4Q5YEC4-F1-model_v4 Response regulator 0.9581 2 122 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
84.75 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map