F385300

General Info

Members Datasets Scaffolds Average Seq Length
283 194 280 148

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10000908|JGI24739J22299_1000090811
Length 160
Sequence MIVFDLNCANGHVFEAWFGSSDDYESQRQRGLVSCPMCDSPKVEKAVMAPRVGRKGNQQQTLPVPAKGKAVPMASDESGPAPEQVKEMLRALAEAQTEILKKSDWVGDKFADEARSMHLGETEHRAIHGQTTPEQARSLIEDGVPVAPLPFPVRPPNADN

Samples

Sample ID Description Type Environment
1 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
2 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
3 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
167 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
168 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
173 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
176 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
177 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
178 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
179 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
180 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
183 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
184 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
185 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
186 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
187 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
193 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 3.89
Rhizosphere 87.63
Stem 0
Stem Tuber 0
Unclassified 6.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000129 3300001904 Bacteria 12926
2 JGI24741J21665_1035473 3300001915 Bacteria 741
3 JGI24752J21851_1000008 3300001976 Bacteria 23142
4 JGI24740J21852_10004226 3300001979 Bacteria 6202
5 JGI24739J22299_10000908 3300001989 Bacteria 10973
6 JGI24739J22299_10009175 3300001989 Bacteria 3691
7 JGI24739J22299_10064713 3300001989 Bacteria 1149
8 JGI24737J22298_10001786 3300001990 Bacteria 7698
9 JGI24735J21928_10003205 3300002067 Bacteria 5592
10 JGI24750J21931_1000652 3300002070 Bacteria 5164
11 JGI24748J21848_1000037 3300002074 Bacteria 72188
12 JGI24738J21930_10008664 3300002075 Bacteria 2311
13 JGI24738J21930_10009269 3300002075 Bacteria 2220
14 JGI24749J21850_1001527 3300002076 Bacteria 3275
15 JGI24034J26672_10000024 3300002239 Bacteria 114754
16 JGI24742J22300_10005059 3300002244 Bacteria 2168
17 JGI24751J29686_10026235 3300002459 Bacteria 1209
18 Ga0065165_1006091 3300005262 Bacteria 6464
19 Ga0065704_10461211 3300005289 Bacteria 697
20 Ga0065707_10082120 3300005295 Bacteria 21423
21 Ga0070658_10000002 3300005327 Bacteria 637290
22 Ga0070658_10765458 3300005327 Bacteria 839
23 Ga0070690_100000016 3300005330 Bacteria 85515
24 Ga0070670_101263148 3300005331 Bacteria 676
25 Ga0070666_10000011 3300005335 Bacteria 261736
26 Ga0070660_100004200 3300005339 Bacteria 9947
27 Ga0070660_101224289 3300005339 Bacteria 637
28 Ga0070689_100004152 3300005340 Bacteria 9766
29 Ga0070661_100184077 3300005344 Bacteria 1590
30 Ga0070668_100082728 3300005347 Bacteria 2518
31 Ga0070668_100183533 3300005347 Bacteria 1710
32 Ga0070669_100000009 3300005353 Bacteria 224683
33 Ga0070669_100420387 3300005353 Bacteria 1097
34 Ga0070669_101233096 3300005353 Bacteria 647
35 Ga0070675_101236601 3300005354 Bacteria 688
36 Ga0070671_100139542 3300005355 Bacteria 2045
37 Ga0070671_101116562 3300005355 Bacteria 693
38 Ga0070674_100220552 3300005356 Bacteria 1475
39 Ga0070673_100123348 3300005364 Bacteria 2165
40 Ga0070688_100016323 3300005365 Bacteria 4244
41 Ga0070688_101100531 3300005365 Bacteria 635
42 Ga0070659_100748587 3300005366 Bacteria 847
43 Ga0070667_100097255 3300005367 Bacteria 2539
44 Ga0070667_101622712 3300005367 Bacteria 608
45 Ga0070667_102351889 3300005367 Bacteria 502
46 Ga0070714_101330574 3300005435 Bacteria 701
47 Ga0070700_100762091 3300005441 Bacteria 776
48 Ga0070663_100731221 3300005455 Bacteria 843
49 Ga0070662_100044303 3300005457 Bacteria 3187
50 Ga0070681_10756982 3300005458 Bacteria 888
51 Ga0070685_10000186 3300005466 Bacteria 41567
52 Ga0070679_100197979 3300005530 Bacteria 1976
53 Ga0068853_100005287 3300005539 Bacteria 10106
54 Ga0068853_100242725 3300005539 Bacteria 1651
55 Ga0068853_100712960 3300005539 Bacteria 957
56 Ga0070686_100000001 3300005544 Bacteria 515830
57 Ga0070665_100000004 3300005548 Bacteria 785500
58 Ga0070665_100000921 3300005548 Bacteria 37702
59 Ga0070665_100024078 3300005548 Bacteria 6130
60 Ga0070665_100488271 3300005548 Bacteria 1243
61 Ga0068855_100129449 3300005563 Bacteria 2884
62 Ga0068855_100225501 3300005563 Bacteria 2100
63 Ga0068855_100558541 3300005563 Bacteria 1238
64 Ga0068855_100880182 3300005563 Bacteria 947
65 Ga0068855_101583152 3300005563 Unclassified 671
66 Ga0070664_100291452 3300005564 Bacteria 1473
67 Ga0070664_102238933 3300005564 Bacteria 518
68 Ga0068857_100047204 3300005577 Bacteria 3823
69 Ga0068857_100213205 3300005577 Bacteria 1762
70 Ga0068857_100440249 3300005577 Bacteria 1217
71 Ga0068854_100050612 3300005578 Bacteria 2973
72 Ga0068854_100315272 3300005578 Bacteria 1269
73 Ga0068854_100748798 3300005578 Bacteria 847
74 Ga0068856_101015891 3300005614 Bacteria 847
75 Ga0068852_100060712 3300005616 Bacteria 3283
76 Ga0068852_100225422 3300005616 Bacteria 1784
77 Ga0068852_101017383 3300005616 Bacteria 847
78 Ga0068859_100005061 3300005617 Bacteria 13383
79 Ga0068864_100000827 3300005618 Bacteria 26094
80 Ga0068864_100553000 3300005618 Bacteria 1113
81 Ga0068861_100014131 3300005719 Bacteria 5599
82 Ga0068851_10016266 3300005834 Bacteria 3557
83 Ga0068851_10878264 3300005834 Bacteria 561
84 Ga0068863_100000010 3300005841 Bacteria 237758
85 Ga0068863_100501042 3300005841 Bacteria 1196
86 Ga0068858_100000360 3300005842 Bacteria 48023
87 Ga0068860_100000030 3300005843 Bacteria 256364
88 Ga0068862_100007850 3300005844 Bacteria 8828
89 Ga0068862_100443611 3300005844 Bacteria 1222
90 Ga0068862_101182766 3300005844 Bacteria 762
91 Ga0081455_10000220 3300005937 Bacteria 73579
92 Ga0097620_100005061 3300006931 Bacteria 13383
93 Ga0105250_10154112 3300009092 Bacteria 957
94 Ga0105240_10266043 3300009093 Bacteria 1976
95 Ga0105240_10304841 3300009093 Bacteria 1821
96 Ga0105240_11574726 3300009093 Bacteria 688
97 Ga0105247_10057032 3300009101 Bacteria 2414
98 Ga0105241_10581881 3300009174 Bacteria 1009
99 Ga0105242_13217973 3300009176 Bacteria 507
100 Ga0105248_10021880 3300009177 Bacteria 7085
101 Ga0105248_10121971 3300009177 Bacteria 2940
102 Ga0105248_12744386 3300009177 Bacteria 562
103 Ga0105237_10407908 3300009545 Bacteria 1364
104 Ga0105237_10554057 3300009545 Bacteria 1156
105 Ga0105237_11726561 3300009545 Bacteria 633
106 Ga0105238_10043475 3300009551 Bacteria 4546
107 Ga0105238_10071573 3300009551 Bacteria 3465
108 Ga0105238_10260862 3300009551 Bacteria 1712
109 Ga0105238_11408163 3300009551 Bacteria 724
110 Ga0105249_10000016 3300009553 Bacteria 278643
111 Ga0105249_10332166 3300009553 Bacteria 1534
112 Ga0105239_10158490 3300010375 Bacteria 2528
113 Ga0105239_10360256 3300010375 Bacteria 1642
114 Ga0105239_11959449 3300010375 Bacteria 680
115 Ga0157373_10057705 3300013100 Bacteria 2753
116 Ga0157370_10083140 3300013104 Bacteria 3011
117 Ga0157369_10004086 3300013105 Bacteria 17279
118 Ga0157369_10063936 3300013105 Bacteria 3964
119 Ga0157378_10223356 3300013297 Bacteria 1791
120 Ga0163163_10036729 3300014325 Bacteria 4761
121 Ga0157380_10000375 3300014326 Bacteria 26888
122 Ga0157380_10001265 3300014326 Bacteria 16405
123 Ga0157380_10687790 3300014326 Bacteria 1026
124 Ga0157379_10172630 3300014968 Bacteria 1951
125 Ga0157376_12862577 3300014969 Bacteria 522
126 Ga0163161_10000044 3300017792 Bacteria 132739
127 Ga0213874_10035865 3300021377 Bacteria 1459
128 Ga0209050_1042388 3300025298 Bacteria 1243
129 Ga0207656_10109142 3300025321 Bacteria 1277
130 Ga0207656_10291639 3300025321 Bacteria 806
131 Ga0207680_10000008 3300025903 Bacteria 518177
132 Ga0207680_10343448 3300025903 Bacteria 1047
133 Ga0207647_10000283 3300025904 Bacteria 41512
134 Ga0207645_10945051 3300025907 Bacteria 585
135 Ga0207705_10000008 3300025909 Bacteria 589717
136 Ga0207654_10012084 3300025911 Bacteria 4418
137 Ga0207695_10142910 3300025913 Bacteria 2340
138 Ga0207695_10233272 3300025913 Bacteria 1744
139 Ga0207695_10428477 3300025913 Bacteria 1207
140 Ga0207671_10001568 3300025914 Bacteria 26104
141 Ga0207657_10000676 3300025919 Bacteria 36328
142 Ga0207657_10065984 3300025919 Bacteria 3082
143 Ga0207657_10627219 3300025919 Bacteria 838
144 Ga0207649_10323248 3300025920 Bacteria 1134
145 Ga0207649_10614233 3300025920 Bacteria 837
146 Ga0207652_10057347 3300025921 Bacteria 3354
147 Ga0207681_10000020 3300025923 Bacteria 240498
148 Ga0207681_10223723 3300025923 Bacteria 1457
149 Ga0207694_10024684 3300025924 Bacteria 4566
150 Ga0207694_10181302 3300025924 Bacteria 1708
151 Ga0207650_10060015 3300025925 Bacteria 2837
152 Ga0207650_11305096 3300025925 Bacteria 618
153 Ga0207659_10218147 3300025926 Bacteria 1532
154 Ga0207644_10003251 3300025931 Bacteria 10484
155 Ga0207690_10472168 3300025932 Bacteria 1011
156 Ga0207706_10003179 3300025933 Bacteria 15784
157 Ga0207706_10094682 3300025933 Bacteria 2627
158 Ga0207706_11090419 3300025933 Bacteria 668
159 Ga0207670_10006832 3300025936 Bacteria 6347
160 Ga0207670_10400314 3300025936 Bacteria 1097
161 Ga0207669_10302677 3300025937 Bacteria 1216
162 Ga0207691_11040181 3300025940 Bacteria 682
163 Ga0207711_10050587 3300025941 Bacteria 3557
164 Ga0207661_11284835 3300025944 Bacteria 673
165 Ga0207679_10715171 3300025945 Bacteria 909
166 Ga0207667_10005214 3300025949 Bacteria 15859
167 Ga0207667_10118495 3300025949 Bacteria 2728
168 Ga0207667_11626939 3300025949 Bacteria 614
169 Ga0207651_10476134 3300025960 Bacteria 1075
170 Ga0207712_10000009 3300025961 Bacteria 518177
171 Ga0207712_10306941 3300025961 Bacteria 1304
172 Ga0207668_10000489 3300025972 Bacteria 24856
173 Ga0207668_10102724 3300025972 Bacteria 2127
174 Ga0207640_10472135 3300025981 Bacteria 1038
175 Ga0207640_10669745 3300025981 Bacteria 886
176 Ga0207658_10000305 3300025986 Bacteria 50588
177 Ga0207703_10343072 3300026035 Bacteria 1373
178 Ga0207639_10020538 3300026041 Bacteria 4728
179 Ga0207639_10165202 3300026041 Bacteria 1869
180 Ga0207678_10001025 3300026067 Bacteria 25479
181 Ga0207708_10480591 3300026075 Bacteria 1038
182 Ga0207702_10041490 3300026078 Bacteria 3859
183 Ga0207641_10000171 3300026088 Bacteria 90550
184 Ga0207676_10001337 3300026095 Bacteria 18342
185 Ga0207676_10064082 3300026095 Bacteria 2921
186 Ga0207674_10002464 3300026116 Bacteria 23363
187 Ga0207674_11261273 3300026116 Bacteria 708
188 Ga0207674_11263213 3300026116 Bacteria 708
189 Ga0207675_100003112 3300026118 Bacteria 16274
190 Ga0207698_10029577 3300026142 Bacteria 3926
191 Ga0207698_10082375 3300026142 Bacteria 2601
192 Ga0207698_11278410 3300026142 Bacteria 748
193 Ga0268266_10000009 3300028379 Bacteria 1097737
194 Ga0268266_10782811 3300028379 Bacteria 921
195 Ga0268265_10000785 3300028380 Bacteria 30390
196 Ga0268265_10307762 3300028380 Bacteria 1429
197 Ga0268265_10350292 3300028380 Bacteria 1348
198 Ga0268264_10000003 3300028381 Bacteria 1141976
199 Ga0307517_10021826 3300028786 Bacteria 8058
200 Ga0265327_10098816 3300031251 Bacteria 1412
201 Ga0307513_10003525 3300031456 Bacteria 21166
202 Ga0307513_10009571 3300031456 Bacteria 12240
203 Ga0307410_10046896 3300031852 Bacteria 2885
204 Ga0307412_10311462 3300031911 Bacteria 1248
205 Ga0307412_11349462 3300031911 Bacteria 643
206 Ga0316583_10346732 3300032133 Bacteria 514
207 Ga0307510_10021457 3300033180 Bacteria 7525
208 Ga0436364_1239369 3300037853 Bacteria 1154
209 Ga0400483_027582 3300039062 Bacteria 2730
210 Ga0400483_273484 3300039062 Bacteria 1643
211 Ga0436365_1728448 3300039437 Bacteria 2360
212 Ga0436363_1687018 3300039450 Bacteria 1520
213 Ga0466969_0362827 3300044656 Bacteria 656
214 Ga0466963_0038233 3300044694 Bacteria 3137
215 Ga0466957_0005536 3300044842 Bacteria 7092
216 Ga0466960_0688150 3300044901 Bacteria 613
217 Ga0451576_0003127 3300045051 Bacteria 23211
218 Ga0466967_0168273 3300045976 Bacteria 2060
219 Ga0466967_0563603 3300045976 Bacteria 1122
220 Ga0495606_0113188 3300046507 Bacteria 1634
221 Ga0495620_0095116 3300046515 Bacteria 1192
222 Ga0495648_0070216 3300046524 Bacteria 2036
223 Ga0495621_0018181 3300046539 Bacteria 2280
224 Ga0495668_0003779 3300046616 Bacteria 11097
225 Ga0495668_0031307 3300046616 Bacteria 2998
226 Ga0495668_0763752 3300046616 Bacteria 535
227 Ga0495668_0856317 3300046616 Bacteria 504
228 Ga0495625_0163664 3300046660 Bacteria 1489
229 Ga0495669_0001598 3300046684 Bacteria 9304
230 Ga0495669_0033764 3300046684 Bacteria 2253
231 Ga0495677_0120067 3300047445 Bacteria 1002
232 Ga0495681_0321678 3300047470 Bacteria 594
233 Ga0496101_0485140 3300048904 Bacteria 976
234 Ga0496102_0001580 3300048905 Bacteria 20091
235 Ga0496103_0001164 3300048906 Bacteria 18083
236 Ga0496104_0191362 3300048907 Bacteria 1957
237 Ga0496105_0041313 3300048908 Bacteria 3801
238 Ga0496106_0085797 3300048909 Bacteria 2424
239 Ga0496107_0141504 3300048910 Bacteria 1778
240 Ga0496108_0863620 3300048911 Bacteria 778
241 Ga0496111_0353877 3300048914 Bacteria 1087
242 Ga0496115_0000546 3300048918 Bacteria 29331
243 Ga0496115_0021459 3300048918 Bacteria 4991
244 Ga0496117_0002767 3300048920 Bacteria 21473
245 Ga0496117_0003644 3300048920 Bacteria 17744
246 Ga0496118_0000525 3300048921 Bacteria 62968
247 Ga0496118_0171353 3300048921 Bacteria 1325
248 Ga0496121_0079990 3300048924 Bacteria 2593
249 Ga0496121_0354307 3300048924 Bacteria 976
250 Ga0501290_000181 3300049513 Bacteria 10137
251 Ga0501292_000065 3300049515 Bacteria 21691
252 Ga0501294_001000 3300049517 Bacteria 3003
253 Ga0501033_0439221 3300049570 Bacteria 907
254 Ga0501043_0178954 3300049579 Bacteria 1653
255 Ga0501047_0397122 3300049581 Bacteria 1212
256 Ga0501202_014387 3300049652 Bacteria 1515
257 Ga0501207_010988 3300049654 Bacteria 1342
258 Ga0501223_000850 3300049663 Bacteria 7243
259 Ga0501224_012560 3300049664 Bacteria 1248
260 Ga0501227_001588 3300049665 Bacteria 5067
261 Ga0501235_002813 3300049669 Bacteria 3746
262 Ga0501259_003446 3300049688 Bacteria 2521
263 Ga0501261_002563 3300049690 Bacteria 2227
264 Ga0501221_008186 3300049704 Bacteria 1812
265 Ga0501225_0012801 3300049705 Bacteria 2353
266 Ga0501245_010458 3300049708 Bacteria 1340
267 Ga0501279_000621 3300049775 Bacteria 4674
268 Ga0501280_000132 3300049776 Bacteria 19443
269 Ga0501281_00203 3300049777 Bacteria 6784
270 Ga0501281_04736 3300049777 Bacteria 953
271 Ga0501282_000894 3300049778 Bacteria 3376
272 Ga0501283_006793 3300049779 Bacteria 1612
273 Ga0501035_0146036 3300049822 Bacteria 2054
274 Ga0501044_0012138 3300049823 Bacteria 9329
275 Ga0501044_0265463 3300049823 Bacteria 1654
276 Ga0500592_000347 3300053116 Bacteria 7787
277 Ga0500594_0001365 3300053118 Bacteria 5297
278 Ga0500604_0021754 3300053151 Bacteria 1815
279 Ga0500627_0001445 3300053158 Bacteria 6626
280 Ga0501082_0679612 3300060353 Bacteria 901

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10000002 Ga0070658_10000002512 119
2 3300025909 Ga0207705_10000008 Ga0207705_10000008278 119
3 3300049513 Ga0501290_000181 Ga0501290_000181_2100_2582 128
4 3300049515 Ga0501292_000065 Ga0501292_000065_3840_4322 128
5 3300049517 Ga0501294_001000 Ga0501294_001000_36_518 128
6 3300049652 Ga0501202_014387 Ga0501202_014387_237_719 128
7 3300049654 Ga0501207_010988 Ga0501207_010988_230_712 128
8 3300049663 Ga0501223_000850 Ga0501223_000850_1792_2274 128
9 3300049665 Ga0501227_001588 Ga0501227_001588_1758_2240 128
10 3300049669 Ga0501235_002813 Ga0501235_002813_3143_3625 128
11 3300049704 Ga0501221_008186 Ga0501221_008186_61_543 128
12 3300049775 Ga0501279_000621 Ga0501279_000621_515_997 128
13 3300049776 Ga0501280_000132 Ga0501280_000132_3718_4200 128
14 3300049777 Ga0501281_04736 Ga0501281_04736_50_532 128
15 3300049778 Ga0501282_000894 Ga0501282_000894_2398_2880 128
16 3300049779 Ga0501283_006793 Ga0501283_006793_742_1224 128
17 3300005458 Ga0070681_10756982 Ga0070681_107569822 129
18 3300005530 Ga0070679_100197979 Ga0070679_1001979792 129
19 3300025913 Ga0207695_10428477 Ga0207695_104284772 129
20 3300025921 Ga0207652_10057347 Ga0207652_100573472 129
21 3300031852 Ga0307410_10046896 Ga0307410_100468964 131
22 3300049664 Ga0501224_012560 Ga0501224_012560_533_1015 131
23 3300049688 Ga0501259_003446 Ga0501259_003446_1537_2019 131
24 3300049690 Ga0501261_002563 Ga0501261_002563_134_616 131
25 3300049708 Ga0501245_010458 Ga0501245_010458_424_906 131
26 3300005331 Ga0070670_101263148 Ga0070670_1012631482 132
27 3300005364 Ga0070673_100123348 Ga0070673_1001233482 132
28 3300005548 Ga0070665_100488271 Ga0070665_1004882713 132
29 3300025925 Ga0207650_11305096 Ga0207650_113050961 132
30 3300025936 Ga0207670_10400314 Ga0207670_104003142 132
31 3300025960 Ga0207651_10476134 Ga0207651_104761342 132
32 3300028379 Ga0268266_10782811 Ga0268266_107828112 132
33 3300044656 Ga0466969_0362827 Ga0466969_0362827_231_632 132
34 3300044694 Ga0466963_0038233 Ga0466963_0038233_339_740 132
35 3300044842 Ga0466957_0005536 Ga0466957_0005536_455_856 132
36 3300045976 Ga0466967_0168273 Ga0466967_0168273_300_701 132
37 3300046507 Ga0495606_0113188 Ga0495606_0113188_999_1400 132
38 3300046515 Ga0495620_0095116 Ga0495620_0095116_118_519 132
39 3300046616 Ga0495668_0031307 Ga0495668_0031307_2100_2501 132
40 3300046660 Ga0495625_0163664 Ga0495625_0163664_160_561 132
41 3300046684 Ga0495669_0001598 Ga0495669_0001598_8304_8705 132
42 3300046684 Ga0495669_0033764 Ga0495669_0033764_1354_1755 132
43 3300047445 Ga0495677_0120067 Ga0495677_0120067_411_812 132
44 3300047470 Ga0495681_0321678 Ga0495681_0321678_55_456 132
45 3300049705 Ga0501225_0012801 Ga0501225_0012801_140_622 132
46 3300049777 Ga0501281_00203 Ga0501281_00203_5000_5482 132
47 3300032133 Ga0316583_10346732 Ga0316583_103467321 133
48 3300005339 Ga0070660_100004200 Ga0070660_1000042006 134
49 3300005367 Ga0070667_102351889 Ga0070667_1023518891 134
50 3300025919 Ga0207657_10000676 Ga0207657_1000067611 134
51 3300039062 Ga0400483_273484 Ga0400483_273484_96_539 134
52 3300046616 Ga0495668_0856317 Ga0495668_0856317_53_484 135
53 3300060353 Ga0501082_0679612 Ga0501082_0679612_173_589 135
54 3300005353 Ga0070669_101233096 Ga0070669_1012330961 136
55 3300005354 Ga0070675_101236601 Ga0070675_1012366011 136
56 3300005356 Ga0070674_100220552 Ga0070674_1002205522 136
57 3300005441 Ga0070700_100762091 Ga0070700_1007620912 136
58 3300009093 Ga0105240_10304841 Ga0105240_103048412 136
59 3300009545 Ga0105237_10554057 Ga0105237_105540572 136
60 3300010375 Ga0105239_10158490 Ga0105239_101584901 136
61 3300014326 Ga0157380_10687790 Ga0157380_106877903 136
62 3300025907 Ga0207645_10945051 Ga0207645_109450512 136
63 3300025926 Ga0207659_10218147 Ga0207659_102181473 136
64 3300025937 Ga0207669_10302677 Ga0207669_103026772 136
65 3300025940 Ga0207691_11040181 Ga0207691_110401812 136
66 3300026075 Ga0207708_10480591 Ga0207708_104805912 136
67 3300005262 Ga0065165_1006091 Ga0065165_10060917 137
68 3300005563 Ga0068855_100880182 Ga0068855_1008801822 137
69 3300025913 Ga0207695_10233272 Ga0207695_102332722 137
70 3300028786 Ga0307517_10021826 Ga0307517_100218263 137
71 3300031456 Ga0307513_10003525 Ga0307513_100035255 137
72 iso_pu_bacteria 2854681122 2854684122 137
73 3300039062 Ga0400483_027582 Ga0400483_027582_1318_1743 138
74 3300002076 JGI24749J21850_1001527 JGI24749J21850_10015275 139
75 3300005347 Ga0070668_100082728 Ga0070668_1000827282 139
76 3300005353 Ga0070669_100420387 Ga0070669_1004203871 139
77 3300005435 Ga0070714_101330574 Ga0070714_1013305741 139
78 3300005844 Ga0068862_100443611 Ga0068862_1004436112 139
79 3300005844 Ga0068862_101182766 Ga0068862_1011827662 139
80 3300009177 Ga0105248_10121971 Ga0105248_101219712 139
81 3300025923 Ga0207681_10223723 Ga0207681_102237232 139
82 3300025972 Ga0207668_10000489 Ga0207668_1000048922 139
83 3300028380 Ga0268265_10307762 Ga0268265_103077622 139
84 3300028380 Ga0268265_10350292 Ga0268265_103502922 139
85 3300048920 Ga0496117_0003644 Ga0496117_0003644_9996_10415 139
86 3300048921 Ga0496118_0000525 Ga0496118_0000525_41456_41875 139
87 3300048924 Ga0496121_0354307 Ga0496121_0354307_204_623 139
88 iso_pu_bacteria 2919679072 2919680767 139
89 3300021377 Ga0213874_10035865 Ga0213874_100358653 140
90 3300039450 Ga0436363_1687018 Ga0436363_1687018_551_997 140
91 iso_pu_bacteria 2898795034 2898798712 140
92 3300005563 Ga0068855_100225501 Ga0068855_1002255012 141
93 3300009176 Ga0105242_13217973 Ga0105242_132179731 141
94 3300009545 Ga0105237_11726561 Ga0105237_117265612 141
95 3300025920 Ga0207649_10614233 Ga0207649_106142332 141
96 3300025949 Ga0207667_11626939 Ga0207667_116269391 141
97 3300005327 Ga0070658_10765458 Ga0070658_107654582 142
98 3300005355 Ga0070671_101116562 Ga0070671_1011165621 142
99 3300005548 Ga0070665_100000921 Ga0070665_1000009215 142
100 3300005548 Ga0070665_100024078 Ga0070665_1000240782 142
101 3300005618 Ga0068864_100553000 Ga0068864_1005530003 142
102 3300005841 Ga0068863_100501042 Ga0068863_1005010423 142
103 3300009093 Ga0105240_11574726 Ga0105240_115747261 142
104 3300009177 Ga0105248_12744386 Ga0105248_127443862 142
105 3300009553 Ga0105249_10332166 Ga0105249_103321662 142
106 3300010375 Ga0105239_10360256 Ga0105239_103602562 142
107 3300014969 Ga0157376_12862577 Ga0157376_128625771 142
108 3300025961 Ga0207712_10306941 Ga0207712_103069412 142
109 3300026095 Ga0207676_10064082 Ga0207676_100640825 142
110 3300031251 Ga0265327_10098816 Ga0265327_100988162 142
111 3300031456 Ga0307513_10009571 Ga0307513_100095719 142
112 3300033180 Ga0307510_10021457 Ga0307510_100214577 142
113 3300044901 Ga0466960_0688150 Ga0466960_0688150_119_550 142
114 3300045976 Ga0466967_0563603 Ga0466967_0563603_354_809 142
115 3300046539 Ga0495621_0018181 Ga0495621_0018181_878_1309 142
116 3300048918 Ga0496115_0000546 Ga0496115_0000546_3067_3498 142
117 3300048918 Ga0496115_0021459 Ga0496115_0021459_759_1190 142
118 3300049570 Ga0501033_0439221 Ga0501033_0439221_97_525 142
119 3300049579 Ga0501043_0178954 Ga0501043_0178954_811_1239 142
120 3300049822 Ga0501035_0146036 Ga0501035_0146036_1344_1772 142
121 3300049823 Ga0501044_0012138 Ga0501044_0012138_926_1354 142
122 3300005367 Ga0070667_101622712 Ga0070667_1016227121 143
123 3300009551 Ga0105238_10043475 Ga0105238_100434751 143
124 3300037853 Ga0436364_1239369 Ga0436364_1239369_13_450 143
125 3300026142 Ga0207698_11278410 Ga0207698_112784101 144
126 3300045051 Ga0451576_0003127 Ga0451576_0003127_6139_6588 144
127 3300049581 Ga0501047_0397122 Ga0501047_0397122_405_842 145
128 3300049823 Ga0501044_0265463 Ga0501044_0265463_1109_1546 145
129 3300005539 Ga0068853_100242725 Ga0068853_1002427253 146
130 3300039437 Ga0436365_1728448 Ga0436365_1728448_1849_2307 146
131 3300013105 Ga0157369_10004086 Ga0157369_100040865 147
132 3300005365 Ga0070688_101100531 Ga0070688_1011005311 148
133 3300025298 Ga0209050_1042388 Ga0209050_10423882 148
134 3300025903 Ga0207680_10343448 Ga0207680_103434481 150
135 3300046524 Ga0495648_0070216 Ga0495648_0070216_63_527 154
136 3300053118 Ga0500594_0001365 Ga0500594_0001365_2788_3252 154
137 3300005563 Ga0068855_101583152 Ga0068855_1015831522 155
138 3300005289 Ga0065704_10461211 Ga0065704_104612112 156
139 3300005295 Ga0065707_10082120 Ga0065707_1008212023 156
140 3300014326 Ga0157380_10000375 Ga0157380_100003759 156
141 3300053116 Ga0500592_000347 Ga0500592_000347_6600_7073 156
142 3300001904 JGI24736J21556_1000129 JGI24736J21556_10001299 157
143 3300001915 JGI24741J21665_1035473 JGI24741J21665_10354731 157
144 3300001976 JGI24752J21851_1000008 JGI24752J21851_100000823 157
145 3300001979 JGI24740J21852_10004226 JGI24740J21852_100042268 157
146 3300001989 JGI24739J22299_10000908 JGI24739J22299_1000090811 157
147 3300001989 JGI24739J22299_10009175 JGI24739J22299_100091751 157
148 3300001989 JGI24739J22299_10064713 JGI24739J22299_100647132 157
149 3300001990 JGI24737J22298_10001786 JGI24737J22298_1000178613 157
150 3300002067 JGI24735J21928_10003205 JGI24735J21928_100032051 157
151 3300002070 JGI24750J21931_1000652 JGI24750J21931_10006524 157
152 3300002074 JGI24748J21848_1000037 JGI24748J21848_100003710 157
153 3300002075 JGI24738J21930_10008664 JGI24738J21930_100086644 157
154 3300002075 JGI24738J21930_10009269 JGI24738J21930_100092692 157
155 3300002239 JGI24034J26672_10000024 JGI24034J26672_1000002431 157
156 3300002244 JGI24742J22300_10005059 JGI24742J22300_100050591 157
157 3300002459 JGI24751J29686_10026235 JGI24751J29686_100262351 157
158 3300005330 Ga0070690_100000016 Ga0070690_10000001646 157
159 3300005335 Ga0070666_10000011 Ga0070666_1000001127 157
160 3300005339 Ga0070660_101224289 Ga0070660_1012242891 157
161 3300005340 Ga0070689_100004152 Ga0070689_10000415210 157
162 3300005344 Ga0070661_100184077 Ga0070661_1001840772 157
163 3300005347 Ga0070668_100183533 Ga0070668_1001835332 157
164 3300005353 Ga0070669_100000009 Ga0070669_10000000964 157
165 3300005355 Ga0070671_100139542 Ga0070671_1001395423 157
166 3300005365 Ga0070688_100016323 Ga0070688_1000163232 157
167 3300005366 Ga0070659_100748587 Ga0070659_1007485871 157
168 3300005367 Ga0070667_100097255 Ga0070667_1000972554 157
169 3300005455 Ga0070663_100731221 Ga0070663_1007312211 157
170 3300005457 Ga0070662_100044303 Ga0070662_1000443032 157
171 3300005466 Ga0070685_10000186 Ga0070685_100001862 157
172 3300005539 Ga0068853_100005287 Ga0068853_10000528713 157
173 3300005539 Ga0068853_100712960 Ga0068853_1007129602 157
174 3300005544 Ga0070686_100000001 Ga0070686_100000001492 157
175 3300005548 Ga0070665_100000004 Ga0070665_100000004227 157
176 3300005563 Ga0068855_100129449 Ga0068855_1001294493 157
177 3300005563 Ga0068855_100558541 Ga0068855_1005585411 157
178 3300005564 Ga0070664_100291452 Ga0070664_1002914521 157
179 3300005564 Ga0070664_102238933 Ga0070664_1022389331 157
180 3300005577 Ga0068857_100047204 Ga0068857_1000472043 157
181 3300005577 Ga0068857_100213205 Ga0068857_1002132052 157
182 3300005577 Ga0068857_100440249 Ga0068857_1004402492 157
183 3300005578 Ga0068854_100050612 Ga0068854_1000506123 157
184 3300005578 Ga0068854_100315272 Ga0068854_1003152722 157
185 3300005578 Ga0068854_100748798 Ga0068854_1007487981 157
186 3300005614 Ga0068856_101015891 Ga0068856_1010158911 157
187 3300005616 Ga0068852_100060712 Ga0068852_1000607125 157
188 3300005616 Ga0068852_100225422 Ga0068852_1002254221 157
189 3300005616 Ga0068852_101017383 Ga0068852_1010173831 157
190 3300005617 Ga0068859_100005061 Ga0068859_10000506114 157
191 3300005618 Ga0068864_100000827 Ga0068864_1000008273 157
192 3300005719 Ga0068861_100014131 Ga0068861_1000141318 157
193 3300005834 Ga0068851_10016266 Ga0068851_100162662 157
194 3300005834 Ga0068851_10878264 Ga0068851_108782641 157
195 3300005841 Ga0068863_100000010 Ga0068863_10000001094 157
196 3300005842 Ga0068858_100000360 Ga0068858_10000036042 157
197 3300005843 Ga0068860_100000030 Ga0068860_100000030232 157
198 3300005844 Ga0068862_100007850 Ga0068862_10000785010 157
199 3300005937 Ga0081455_10000220 Ga0081455_1000022029 157
200 3300006931 Ga0097620_100005061 Ga0097620_1000050619 157
201 3300009092 Ga0105250_10154112 Ga0105250_101541122 157
202 3300009093 Ga0105240_10266043 Ga0105240_102660433 157
203 3300009101 Ga0105247_10057032 Ga0105247_100570324 157
204 3300009174 Ga0105241_10581881 Ga0105241_105818811 157
205 3300009177 Ga0105248_10021880 Ga0105248_1002188012 157
206 3300009545 Ga0105237_10407908 Ga0105237_104079082 157
207 3300009551 Ga0105238_10071573 Ga0105238_100715734 157
208 3300009551 Ga0105238_10260862 Ga0105238_102608621 157
209 3300009551 Ga0105238_11408163 Ga0105238_114081631 157
210 3300009553 Ga0105249_10000016 Ga0105249_10000016233 157
211 3300010375 Ga0105239_11959449 Ga0105239_119594491 157
212 3300013100 Ga0157373_10057705 Ga0157373_100577054 157
213 3300013104 Ga0157370_10083140 Ga0157370_100831405 157
214 3300013105 Ga0157369_10063936 Ga0157369_100639363 157
215 3300013297 Ga0157378_10223356 Ga0157378_102233562 157
216 3300014325 Ga0163163_10036729 Ga0163163_100367295 157
217 3300014326 Ga0157380_10001265 Ga0157380_1000126510 157
218 3300014968 Ga0157379_10172630 Ga0157379_101726302 157
219 3300017792 Ga0163161_10000044 Ga0163161_1000004481 157
220 3300025321 Ga0207656_10109142 Ga0207656_101091423 157
221 3300025321 Ga0207656_10291639 Ga0207656_102916391 157
222 3300025903 Ga0207680_10000008 Ga0207680_10000008485 157
223 3300025904 Ga0207647_10000283 Ga0207647_1000028331 157
224 3300025911 Ga0207654_10012084 Ga0207654_100120844 157
225 3300025913 Ga0207695_10142910 Ga0207695_101429102 157
226 3300025914 Ga0207671_10001568 Ga0207671_100015682 157
227 3300025919 Ga0207657_10065984 Ga0207657_100659841 157
228 3300025919 Ga0207657_10627219 Ga0207657_106272191 157
229 3300025920 Ga0207649_10323248 Ga0207649_103232482 157
230 3300025923 Ga0207681_10000020 Ga0207681_1000002048 157
231 3300025924 Ga0207694_10024684 Ga0207694_100246842 157
232 3300025924 Ga0207694_10181302 Ga0207694_101813023 157
233 3300025925 Ga0207650_10060015 Ga0207650_100600153 157
234 3300025931 Ga0207644_10003251 Ga0207644_1000325113 157
235 3300025932 Ga0207690_10472168 Ga0207690_104721682 157
236 3300025933 Ga0207706_10003179 Ga0207706_100031796 157
237 3300025933 Ga0207706_10094682 Ga0207706_100946822 157
238 3300025933 Ga0207706_11090419 Ga0207706_110904191 157
239 3300025936 Ga0207670_10006832 Ga0207670_100068326 157
240 3300025941 Ga0207711_10050587 Ga0207711_100505872 157
241 3300025944 Ga0207661_11284835 Ga0207661_112848351 157
242 3300025945 Ga0207679_10715171 Ga0207679_107151712 157
243 3300025949 Ga0207667_10005214 Ga0207667_1000521416 157
244 3300025949 Ga0207667_10118495 Ga0207667_101184954 157
245 3300025961 Ga0207712_10000009 Ga0207712_10000009485 157
246 3300025972 Ga0207668_10102724 Ga0207668_101027242 157
247 3300025981 Ga0207640_10472135 Ga0207640_104721351 157
248 3300025981 Ga0207640_10669745 Ga0207640_106697452 157
249 3300025986 Ga0207658_10000305 Ga0207658_1000030515 157
250 3300026035 Ga0207703_10343072 Ga0207703_103430722 157
251 3300026041 Ga0207639_10020538 Ga0207639_100205382 157
252 3300026041 Ga0207639_10165202 Ga0207639_101652021 157
253 3300026067 Ga0207678_10001025 Ga0207678_1000102524 157
254 3300026078 Ga0207702_10041490 Ga0207702_100414902 157
255 3300026088 Ga0207641_10000171 Ga0207641_1000017130 157
256 3300026095 Ga0207676_10001337 Ga0207676_1000133721 157
257 3300026116 Ga0207674_10002464 Ga0207674_1000246417 157
258 3300026116 Ga0207674_11261273 Ga0207674_112612732 157
259 3300026116 Ga0207674_11263213 Ga0207674_112632131 157
260 3300026118 Ga0207675_100003112 Ga0207675_10000311214 157
261 3300026142 Ga0207698_10029577 Ga0207698_100295776 157
262 3300026142 Ga0207698_10082375 Ga0207698_100823754 157
263 3300028379 Ga0268266_10000009 Ga0268266_10000009562 157
264 3300028380 Ga0268265_10000785 Ga0268265_100007856 157
265 3300028381 Ga0268264_10000003 Ga0268264_100000031107 157
266 3300031911 Ga0307412_10311462 Ga0307412_103114622 157
267 3300031911 Ga0307412_11349462 Ga0307412_113494621 157
268 3300046616 Ga0495668_0003779 Ga0495668_0003779_543_1022 157
269 3300046616 Ga0495668_0763752 Ga0495668_0763752_32_508 157
270 3300048904 Ga0496101_0485140 Ga0496101_0485140_208_681 157
271 3300048905 Ga0496102_0001580 Ga0496102_0001580_5736_6209 157
272 3300048906 Ga0496103_0001164 Ga0496103_0001164_935_1408 157
273 3300048907 Ga0496104_0191362 Ga0496104_0191362_785_1258 157
274 3300048908 Ga0496105_0041313 Ga0496105_0041313_2088_2561 157
275 3300048909 Ga0496106_0085797 Ga0496106_0085797_318_791 157
276 3300048910 Ga0496107_0141504 Ga0496107_0141504_131_604 157
277 3300048911 Ga0496108_0863620 Ga0496108_0863620_219_692 157
278 3300048914 Ga0496111_0353877 Ga0496111_0353877_170_643 157
279 3300048920 Ga0496117_0002767 Ga0496117_0002767_3760_4233 157
280 3300048921 Ga0496118_0171353 Ga0496118_0171353_565_1038 157
281 3300048924 Ga0496121_0079990 Ga0496121_0079990_1817_2290 157
282 3300053151 Ga0500604_0021754 Ga0500604_0021754_1317_1796 157
283 3300053158 Ga0500627_0001445 Ga0500627_0001445_183_659 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06676

DUF1178

Protein of unknown function (DUF1178)

1

154

0.93

Feature Viewer

pLDDT pTM Quality
82.29 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map