F385300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 283 | 194 | 280 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10000908|JGI24739J22299_1000090811 |
| Length | 160 |
| Sequence | MIVFDLNCANGHVFEAWFGSSDDYESQRQRGLVSCPMCDSPKVEKAVMAPRVGRKGNQQQTLPVPAKGKAVPMASDESGPAPEQVKEMLRALAEAQTEILKKSDWVGDKFADEARSMHLGETEHRAIHGQTTPEQARSLIEDGVPVAPLPFPVRPPNADN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 2 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 3 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 128 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 135 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 138 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 139 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 164 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 167 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 168 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 169 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 173 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 174 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 175 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 177 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 178 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 179 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 180 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 181 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 182 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 183 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 184 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 185 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 186 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 187 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 188 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 191 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 192 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 193 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 194 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 0 |
| Isolates | 1.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.12 |
| Nodule | 0 |
| Rhizoplane | 3.89 |
| Rhizosphere | 87.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000129 | 3300001904 | Bacteria | 12926 |
| 2 | JGI24741J21665_1035473 | 3300001915 | Bacteria | 741 |
| 3 | JGI24752J21851_1000008 | 3300001976 | Bacteria | 23142 |
| 4 | JGI24740J21852_10004226 | 3300001979 | Bacteria | 6202 |
| 5 | JGI24739J22299_10000908 | 3300001989 | Bacteria | 10973 |
| 6 | JGI24739J22299_10009175 | 3300001989 | Bacteria | 3691 |
| 7 | JGI24739J22299_10064713 | 3300001989 | Bacteria | 1149 |
| 8 | JGI24737J22298_10001786 | 3300001990 | Bacteria | 7698 |
| 9 | JGI24735J21928_10003205 | 3300002067 | Bacteria | 5592 |
| 10 | JGI24750J21931_1000652 | 3300002070 | Bacteria | 5164 |
| 11 | JGI24748J21848_1000037 | 3300002074 | Bacteria | 72188 |
| 12 | JGI24738J21930_10008664 | 3300002075 | Bacteria | 2311 |
| 13 | JGI24738J21930_10009269 | 3300002075 | Bacteria | 2220 |
| 14 | JGI24749J21850_1001527 | 3300002076 | Bacteria | 3275 |
| 15 | JGI24034J26672_10000024 | 3300002239 | Bacteria | 114754 |
| 16 | JGI24742J22300_10005059 | 3300002244 | Bacteria | 2168 |
| 17 | JGI24751J29686_10026235 | 3300002459 | Bacteria | 1209 |
| 18 | Ga0065165_1006091 | 3300005262 | Bacteria | 6464 |
| 19 | Ga0065704_10461211 | 3300005289 | Bacteria | 697 |
| 20 | Ga0065707_10082120 | 3300005295 | Bacteria | 21423 |
| 21 | Ga0070658_10000002 | 3300005327 | Bacteria | 637290 |
| 22 | Ga0070658_10765458 | 3300005327 | Bacteria | 839 |
| 23 | Ga0070690_100000016 | 3300005330 | Bacteria | 85515 |
| 24 | Ga0070670_101263148 | 3300005331 | Bacteria | 676 |
| 25 | Ga0070666_10000011 | 3300005335 | Bacteria | 261736 |
| 26 | Ga0070660_100004200 | 3300005339 | Bacteria | 9947 |
| 27 | Ga0070660_101224289 | 3300005339 | Bacteria | 637 |
| 28 | Ga0070689_100004152 | 3300005340 | Bacteria | 9766 |
| 29 | Ga0070661_100184077 | 3300005344 | Bacteria | 1590 |
| 30 | Ga0070668_100082728 | 3300005347 | Bacteria | 2518 |
| 31 | Ga0070668_100183533 | 3300005347 | Bacteria | 1710 |
| 32 | Ga0070669_100000009 | 3300005353 | Bacteria | 224683 |
| 33 | Ga0070669_100420387 | 3300005353 | Bacteria | 1097 |
| 34 | Ga0070669_101233096 | 3300005353 | Bacteria | 647 |
| 35 | Ga0070675_101236601 | 3300005354 | Bacteria | 688 |
| 36 | Ga0070671_100139542 | 3300005355 | Bacteria | 2045 |
| 37 | Ga0070671_101116562 | 3300005355 | Bacteria | 693 |
| 38 | Ga0070674_100220552 | 3300005356 | Bacteria | 1475 |
| 39 | Ga0070673_100123348 | 3300005364 | Bacteria | 2165 |
| 40 | Ga0070688_100016323 | 3300005365 | Bacteria | 4244 |
| 41 | Ga0070688_101100531 | 3300005365 | Bacteria | 635 |
| 42 | Ga0070659_100748587 | 3300005366 | Bacteria | 847 |
| 43 | Ga0070667_100097255 | 3300005367 | Bacteria | 2539 |
| 44 | Ga0070667_101622712 | 3300005367 | Bacteria | 608 |
| 45 | Ga0070667_102351889 | 3300005367 | Bacteria | 502 |
| 46 | Ga0070714_101330574 | 3300005435 | Bacteria | 701 |
| 47 | Ga0070700_100762091 | 3300005441 | Bacteria | 776 |
| 48 | Ga0070663_100731221 | 3300005455 | Bacteria | 843 |
| 49 | Ga0070662_100044303 | 3300005457 | Bacteria | 3187 |
| 50 | Ga0070681_10756982 | 3300005458 | Bacteria | 888 |
| 51 | Ga0070685_10000186 | 3300005466 | Bacteria | 41567 |
| 52 | Ga0070679_100197979 | 3300005530 | Bacteria | 1976 |
| 53 | Ga0068853_100005287 | 3300005539 | Bacteria | 10106 |
| 54 | Ga0068853_100242725 | 3300005539 | Bacteria | 1651 |
| 55 | Ga0068853_100712960 | 3300005539 | Bacteria | 957 |
| 56 | Ga0070686_100000001 | 3300005544 | Bacteria | 515830 |
| 57 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 58 | Ga0070665_100000921 | 3300005548 | Bacteria | 37702 |
| 59 | Ga0070665_100024078 | 3300005548 | Bacteria | 6130 |
| 60 | Ga0070665_100488271 | 3300005548 | Bacteria | 1243 |
| 61 | Ga0068855_100129449 | 3300005563 | Bacteria | 2884 |
| 62 | Ga0068855_100225501 | 3300005563 | Bacteria | 2100 |
| 63 | Ga0068855_100558541 | 3300005563 | Bacteria | 1238 |
| 64 | Ga0068855_100880182 | 3300005563 | Bacteria | 947 |
| 65 | Ga0068855_101583152 | 3300005563 | Unclassified | 671 |
| 66 | Ga0070664_100291452 | 3300005564 | Bacteria | 1473 |
| 67 | Ga0070664_102238933 | 3300005564 | Bacteria | 518 |
| 68 | Ga0068857_100047204 | 3300005577 | Bacteria | 3823 |
| 69 | Ga0068857_100213205 | 3300005577 | Bacteria | 1762 |
| 70 | Ga0068857_100440249 | 3300005577 | Bacteria | 1217 |
| 71 | Ga0068854_100050612 | 3300005578 | Bacteria | 2973 |
| 72 | Ga0068854_100315272 | 3300005578 | Bacteria | 1269 |
| 73 | Ga0068854_100748798 | 3300005578 | Bacteria | 847 |
| 74 | Ga0068856_101015891 | 3300005614 | Bacteria | 847 |
| 75 | Ga0068852_100060712 | 3300005616 | Bacteria | 3283 |
| 76 | Ga0068852_100225422 | 3300005616 | Bacteria | 1784 |
| 77 | Ga0068852_101017383 | 3300005616 | Bacteria | 847 |
| 78 | Ga0068859_100005061 | 3300005617 | Bacteria | 13383 |
| 79 | Ga0068864_100000827 | 3300005618 | Bacteria | 26094 |
| 80 | Ga0068864_100553000 | 3300005618 | Bacteria | 1113 |
| 81 | Ga0068861_100014131 | 3300005719 | Bacteria | 5599 |
| 82 | Ga0068851_10016266 | 3300005834 | Bacteria | 3557 |
| 83 | Ga0068851_10878264 | 3300005834 | Bacteria | 561 |
| 84 | Ga0068863_100000010 | 3300005841 | Bacteria | 237758 |
| 85 | Ga0068863_100501042 | 3300005841 | Bacteria | 1196 |
| 86 | Ga0068858_100000360 | 3300005842 | Bacteria | 48023 |
| 87 | Ga0068860_100000030 | 3300005843 | Bacteria | 256364 |
| 88 | Ga0068862_100007850 | 3300005844 | Bacteria | 8828 |
| 89 | Ga0068862_100443611 | 3300005844 | Bacteria | 1222 |
| 90 | Ga0068862_101182766 | 3300005844 | Bacteria | 762 |
| 91 | Ga0081455_10000220 | 3300005937 | Bacteria | 73579 |
| 92 | Ga0097620_100005061 | 3300006931 | Bacteria | 13383 |
| 93 | Ga0105250_10154112 | 3300009092 | Bacteria | 957 |
| 94 | Ga0105240_10266043 | 3300009093 | Bacteria | 1976 |
| 95 | Ga0105240_10304841 | 3300009093 | Bacteria | 1821 |
| 96 | Ga0105240_11574726 | 3300009093 | Bacteria | 688 |
| 97 | Ga0105247_10057032 | 3300009101 | Bacteria | 2414 |
| 98 | Ga0105241_10581881 | 3300009174 | Bacteria | 1009 |
| 99 | Ga0105242_13217973 | 3300009176 | Bacteria | 507 |
| 100 | Ga0105248_10021880 | 3300009177 | Bacteria | 7085 |
| 101 | Ga0105248_10121971 | 3300009177 | Bacteria | 2940 |
| 102 | Ga0105248_12744386 | 3300009177 | Bacteria | 562 |
| 103 | Ga0105237_10407908 | 3300009545 | Bacteria | 1364 |
| 104 | Ga0105237_10554057 | 3300009545 | Bacteria | 1156 |
| 105 | Ga0105237_11726561 | 3300009545 | Bacteria | 633 |
| 106 | Ga0105238_10043475 | 3300009551 | Bacteria | 4546 |
| 107 | Ga0105238_10071573 | 3300009551 | Bacteria | 3465 |
| 108 | Ga0105238_10260862 | 3300009551 | Bacteria | 1712 |
| 109 | Ga0105238_11408163 | 3300009551 | Bacteria | 724 |
| 110 | Ga0105249_10000016 | 3300009553 | Bacteria | 278643 |
| 111 | Ga0105249_10332166 | 3300009553 | Bacteria | 1534 |
| 112 | Ga0105239_10158490 | 3300010375 | Bacteria | 2528 |
| 113 | Ga0105239_10360256 | 3300010375 | Bacteria | 1642 |
| 114 | Ga0105239_11959449 | 3300010375 | Bacteria | 680 |
| 115 | Ga0157373_10057705 | 3300013100 | Bacteria | 2753 |
| 116 | Ga0157370_10083140 | 3300013104 | Bacteria | 3011 |
| 117 | Ga0157369_10004086 | 3300013105 | Bacteria | 17279 |
| 118 | Ga0157369_10063936 | 3300013105 | Bacteria | 3964 |
| 119 | Ga0157378_10223356 | 3300013297 | Bacteria | 1791 |
| 120 | Ga0163163_10036729 | 3300014325 | Bacteria | 4761 |
| 121 | Ga0157380_10000375 | 3300014326 | Bacteria | 26888 |
| 122 | Ga0157380_10001265 | 3300014326 | Bacteria | 16405 |
| 123 | Ga0157380_10687790 | 3300014326 | Bacteria | 1026 |
| 124 | Ga0157379_10172630 | 3300014968 | Bacteria | 1951 |
| 125 | Ga0157376_12862577 | 3300014969 | Bacteria | 522 |
| 126 | Ga0163161_10000044 | 3300017792 | Bacteria | 132739 |
| 127 | Ga0213874_10035865 | 3300021377 | Bacteria | 1459 |
| 128 | Ga0209050_1042388 | 3300025298 | Bacteria | 1243 |
| 129 | Ga0207656_10109142 | 3300025321 | Bacteria | 1277 |
| 130 | Ga0207656_10291639 | 3300025321 | Bacteria | 806 |
| 131 | Ga0207680_10000008 | 3300025903 | Bacteria | 518177 |
| 132 | Ga0207680_10343448 | 3300025903 | Bacteria | 1047 |
| 133 | Ga0207647_10000283 | 3300025904 | Bacteria | 41512 |
| 134 | Ga0207645_10945051 | 3300025907 | Bacteria | 585 |
| 135 | Ga0207705_10000008 | 3300025909 | Bacteria | 589717 |
| 136 | Ga0207654_10012084 | 3300025911 | Bacteria | 4418 |
| 137 | Ga0207695_10142910 | 3300025913 | Bacteria | 2340 |
| 138 | Ga0207695_10233272 | 3300025913 | Bacteria | 1744 |
| 139 | Ga0207695_10428477 | 3300025913 | Bacteria | 1207 |
| 140 | Ga0207671_10001568 | 3300025914 | Bacteria | 26104 |
| 141 | Ga0207657_10000676 | 3300025919 | Bacteria | 36328 |
| 142 | Ga0207657_10065984 | 3300025919 | Bacteria | 3082 |
| 143 | Ga0207657_10627219 | 3300025919 | Bacteria | 838 |
| 144 | Ga0207649_10323248 | 3300025920 | Bacteria | 1134 |
| 145 | Ga0207649_10614233 | 3300025920 | Bacteria | 837 |
| 146 | Ga0207652_10057347 | 3300025921 | Bacteria | 3354 |
| 147 | Ga0207681_10000020 | 3300025923 | Bacteria | 240498 |
| 148 | Ga0207681_10223723 | 3300025923 | Bacteria | 1457 |
| 149 | Ga0207694_10024684 | 3300025924 | Bacteria | 4566 |
| 150 | Ga0207694_10181302 | 3300025924 | Bacteria | 1708 |
| 151 | Ga0207650_10060015 | 3300025925 | Bacteria | 2837 |
| 152 | Ga0207650_11305096 | 3300025925 | Bacteria | 618 |
| 153 | Ga0207659_10218147 | 3300025926 | Bacteria | 1532 |
| 154 | Ga0207644_10003251 | 3300025931 | Bacteria | 10484 |
| 155 | Ga0207690_10472168 | 3300025932 | Bacteria | 1011 |
| 156 | Ga0207706_10003179 | 3300025933 | Bacteria | 15784 |
| 157 | Ga0207706_10094682 | 3300025933 | Bacteria | 2627 |
| 158 | Ga0207706_11090419 | 3300025933 | Bacteria | 668 |
| 159 | Ga0207670_10006832 | 3300025936 | Bacteria | 6347 |
| 160 | Ga0207670_10400314 | 3300025936 | Bacteria | 1097 |
| 161 | Ga0207669_10302677 | 3300025937 | Bacteria | 1216 |
| 162 | Ga0207691_11040181 | 3300025940 | Bacteria | 682 |
| 163 | Ga0207711_10050587 | 3300025941 | Bacteria | 3557 |
| 164 | Ga0207661_11284835 | 3300025944 | Bacteria | 673 |
| 165 | Ga0207679_10715171 | 3300025945 | Bacteria | 909 |
| 166 | Ga0207667_10005214 | 3300025949 | Bacteria | 15859 |
| 167 | Ga0207667_10118495 | 3300025949 | Bacteria | 2728 |
| 168 | Ga0207667_11626939 | 3300025949 | Bacteria | 614 |
| 169 | Ga0207651_10476134 | 3300025960 | Bacteria | 1075 |
| 170 | Ga0207712_10000009 | 3300025961 | Bacteria | 518177 |
| 171 | Ga0207712_10306941 | 3300025961 | Bacteria | 1304 |
| 172 | Ga0207668_10000489 | 3300025972 | Bacteria | 24856 |
| 173 | Ga0207668_10102724 | 3300025972 | Bacteria | 2127 |
| 174 | Ga0207640_10472135 | 3300025981 | Bacteria | 1038 |
| 175 | Ga0207640_10669745 | 3300025981 | Bacteria | 886 |
| 176 | Ga0207658_10000305 | 3300025986 | Bacteria | 50588 |
| 177 | Ga0207703_10343072 | 3300026035 | Bacteria | 1373 |
| 178 | Ga0207639_10020538 | 3300026041 | Bacteria | 4728 |
| 179 | Ga0207639_10165202 | 3300026041 | Bacteria | 1869 |
| 180 | Ga0207678_10001025 | 3300026067 | Bacteria | 25479 |
| 181 | Ga0207708_10480591 | 3300026075 | Bacteria | 1038 |
| 182 | Ga0207702_10041490 | 3300026078 | Bacteria | 3859 |
| 183 | Ga0207641_10000171 | 3300026088 | Bacteria | 90550 |
| 184 | Ga0207676_10001337 | 3300026095 | Bacteria | 18342 |
| 185 | Ga0207676_10064082 | 3300026095 | Bacteria | 2921 |
| 186 | Ga0207674_10002464 | 3300026116 | Bacteria | 23363 |
| 187 | Ga0207674_11261273 | 3300026116 | Bacteria | 708 |
| 188 | Ga0207674_11263213 | 3300026116 | Bacteria | 708 |
| 189 | Ga0207675_100003112 | 3300026118 | Bacteria | 16274 |
| 190 | Ga0207698_10029577 | 3300026142 | Bacteria | 3926 |
| 191 | Ga0207698_10082375 | 3300026142 | Bacteria | 2601 |
| 192 | Ga0207698_11278410 | 3300026142 | Bacteria | 748 |
| 193 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 194 | Ga0268266_10782811 | 3300028379 | Bacteria | 921 |
| 195 | Ga0268265_10000785 | 3300028380 | Bacteria | 30390 |
| 196 | Ga0268265_10307762 | 3300028380 | Bacteria | 1429 |
| 197 | Ga0268265_10350292 | 3300028380 | Bacteria | 1348 |
| 198 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 199 | Ga0307517_10021826 | 3300028786 | Bacteria | 8058 |
| 200 | Ga0265327_10098816 | 3300031251 | Bacteria | 1412 |
| 201 | Ga0307513_10003525 | 3300031456 | Bacteria | 21166 |
| 202 | Ga0307513_10009571 | 3300031456 | Bacteria | 12240 |
| 203 | Ga0307410_10046896 | 3300031852 | Bacteria | 2885 |
| 204 | Ga0307412_10311462 | 3300031911 | Bacteria | 1248 |
| 205 | Ga0307412_11349462 | 3300031911 | Bacteria | 643 |
| 206 | Ga0316583_10346732 | 3300032133 | Bacteria | 514 |
| 207 | Ga0307510_10021457 | 3300033180 | Bacteria | 7525 |
| 208 | Ga0436364_1239369 | 3300037853 | Bacteria | 1154 |
| 209 | Ga0400483_027582 | 3300039062 | Bacteria | 2730 |
| 210 | Ga0400483_273484 | 3300039062 | Bacteria | 1643 |
| 211 | Ga0436365_1728448 | 3300039437 | Bacteria | 2360 |
| 212 | Ga0436363_1687018 | 3300039450 | Bacteria | 1520 |
| 213 | Ga0466969_0362827 | 3300044656 | Bacteria | 656 |
| 214 | Ga0466963_0038233 | 3300044694 | Bacteria | 3137 |
| 215 | Ga0466957_0005536 | 3300044842 | Bacteria | 7092 |
| 216 | Ga0466960_0688150 | 3300044901 | Bacteria | 613 |
| 217 | Ga0451576_0003127 | 3300045051 | Bacteria | 23211 |
| 218 | Ga0466967_0168273 | 3300045976 | Bacteria | 2060 |
| 219 | Ga0466967_0563603 | 3300045976 | Bacteria | 1122 |
| 220 | Ga0495606_0113188 | 3300046507 | Bacteria | 1634 |
| 221 | Ga0495620_0095116 | 3300046515 | Bacteria | 1192 |
| 222 | Ga0495648_0070216 | 3300046524 | Bacteria | 2036 |
| 223 | Ga0495621_0018181 | 3300046539 | Bacteria | 2280 |
| 224 | Ga0495668_0003779 | 3300046616 | Bacteria | 11097 |
| 225 | Ga0495668_0031307 | 3300046616 | Bacteria | 2998 |
| 226 | Ga0495668_0763752 | 3300046616 | Bacteria | 535 |
| 227 | Ga0495668_0856317 | 3300046616 | Bacteria | 504 |
| 228 | Ga0495625_0163664 | 3300046660 | Bacteria | 1489 |
| 229 | Ga0495669_0001598 | 3300046684 | Bacteria | 9304 |
| 230 | Ga0495669_0033764 | 3300046684 | Bacteria | 2253 |
| 231 | Ga0495677_0120067 | 3300047445 | Bacteria | 1002 |
| 232 | Ga0495681_0321678 | 3300047470 | Bacteria | 594 |
| 233 | Ga0496101_0485140 | 3300048904 | Bacteria | 976 |
| 234 | Ga0496102_0001580 | 3300048905 | Bacteria | 20091 |
| 235 | Ga0496103_0001164 | 3300048906 | Bacteria | 18083 |
| 236 | Ga0496104_0191362 | 3300048907 | Bacteria | 1957 |
| 237 | Ga0496105_0041313 | 3300048908 | Bacteria | 3801 |
| 238 | Ga0496106_0085797 | 3300048909 | Bacteria | 2424 |
| 239 | Ga0496107_0141504 | 3300048910 | Bacteria | 1778 |
| 240 | Ga0496108_0863620 | 3300048911 | Bacteria | 778 |
| 241 | Ga0496111_0353877 | 3300048914 | Bacteria | 1087 |
| 242 | Ga0496115_0000546 | 3300048918 | Bacteria | 29331 |
| 243 | Ga0496115_0021459 | 3300048918 | Bacteria | 4991 |
| 244 | Ga0496117_0002767 | 3300048920 | Bacteria | 21473 |
| 245 | Ga0496117_0003644 | 3300048920 | Bacteria | 17744 |
| 246 | Ga0496118_0000525 | 3300048921 | Bacteria | 62968 |
| 247 | Ga0496118_0171353 | 3300048921 | Bacteria | 1325 |
| 248 | Ga0496121_0079990 | 3300048924 | Bacteria | 2593 |
| 249 | Ga0496121_0354307 | 3300048924 | Bacteria | 976 |
| 250 | Ga0501290_000181 | 3300049513 | Bacteria | 10137 |
| 251 | Ga0501292_000065 | 3300049515 | Bacteria | 21691 |
| 252 | Ga0501294_001000 | 3300049517 | Bacteria | 3003 |
| 253 | Ga0501033_0439221 | 3300049570 | Bacteria | 907 |
| 254 | Ga0501043_0178954 | 3300049579 | Bacteria | 1653 |
| 255 | Ga0501047_0397122 | 3300049581 | Bacteria | 1212 |
| 256 | Ga0501202_014387 | 3300049652 | Bacteria | 1515 |
| 257 | Ga0501207_010988 | 3300049654 | Bacteria | 1342 |
| 258 | Ga0501223_000850 | 3300049663 | Bacteria | 7243 |
| 259 | Ga0501224_012560 | 3300049664 | Bacteria | 1248 |
| 260 | Ga0501227_001588 | 3300049665 | Bacteria | 5067 |
| 261 | Ga0501235_002813 | 3300049669 | Bacteria | 3746 |
| 262 | Ga0501259_003446 | 3300049688 | Bacteria | 2521 |
| 263 | Ga0501261_002563 | 3300049690 | Bacteria | 2227 |
| 264 | Ga0501221_008186 | 3300049704 | Bacteria | 1812 |
| 265 | Ga0501225_0012801 | 3300049705 | Bacteria | 2353 |
| 266 | Ga0501245_010458 | 3300049708 | Bacteria | 1340 |
| 267 | Ga0501279_000621 | 3300049775 | Bacteria | 4674 |
| 268 | Ga0501280_000132 | 3300049776 | Bacteria | 19443 |
| 269 | Ga0501281_00203 | 3300049777 | Bacteria | 6784 |
| 270 | Ga0501281_04736 | 3300049777 | Bacteria | 953 |
| 271 | Ga0501282_000894 | 3300049778 | Bacteria | 3376 |
| 272 | Ga0501283_006793 | 3300049779 | Bacteria | 1612 |
| 273 | Ga0501035_0146036 | 3300049822 | Bacteria | 2054 |
| 274 | Ga0501044_0012138 | 3300049823 | Bacteria | 9329 |
| 275 | Ga0501044_0265463 | 3300049823 | Bacteria | 1654 |
| 276 | Ga0500592_000347 | 3300053116 | Bacteria | 7787 |
| 277 | Ga0500594_0001365 | 3300053118 | Bacteria | 5297 |
| 278 | Ga0500604_0021754 | 3300053151 | Bacteria | 1815 |
| 279 | Ga0500627_0001445 | 3300053158 | Bacteria | 6626 |
| 280 | Ga0501082_0679612 | 3300060353 | Bacteria | 901 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10000002 | Ga0070658_10000002512 | 119 |
| 2 | 3300025909 | Ga0207705_10000008 | Ga0207705_10000008278 | 119 |
| 3 | 3300049513 | Ga0501290_000181 | Ga0501290_000181_2100_2582 | 128 |
| 4 | 3300049515 | Ga0501292_000065 | Ga0501292_000065_3840_4322 | 128 |
| 5 | 3300049517 | Ga0501294_001000 | Ga0501294_001000_36_518 | 128 |
| 6 | 3300049652 | Ga0501202_014387 | Ga0501202_014387_237_719 | 128 |
| 7 | 3300049654 | Ga0501207_010988 | Ga0501207_010988_230_712 | 128 |
| 8 | 3300049663 | Ga0501223_000850 | Ga0501223_000850_1792_2274 | 128 |
| 9 | 3300049665 | Ga0501227_001588 | Ga0501227_001588_1758_2240 | 128 |
| 10 | 3300049669 | Ga0501235_002813 | Ga0501235_002813_3143_3625 | 128 |
| 11 | 3300049704 | Ga0501221_008186 | Ga0501221_008186_61_543 | 128 |
| 12 | 3300049775 | Ga0501279_000621 | Ga0501279_000621_515_997 | 128 |
| 13 | 3300049776 | Ga0501280_000132 | Ga0501280_000132_3718_4200 | 128 |
| 14 | 3300049777 | Ga0501281_04736 | Ga0501281_04736_50_532 | 128 |
| 15 | 3300049778 | Ga0501282_000894 | Ga0501282_000894_2398_2880 | 128 |
| 16 | 3300049779 | Ga0501283_006793 | Ga0501283_006793_742_1224 | 128 |
| 17 | 3300005458 | Ga0070681_10756982 | Ga0070681_107569822 | 129 |
| 18 | 3300005530 | Ga0070679_100197979 | Ga0070679_1001979792 | 129 |
| 19 | 3300025913 | Ga0207695_10428477 | Ga0207695_104284772 | 129 |
| 20 | 3300025921 | Ga0207652_10057347 | Ga0207652_100573472 | 129 |
| 21 | 3300031852 | Ga0307410_10046896 | Ga0307410_100468964 | 131 |
| 22 | 3300049664 | Ga0501224_012560 | Ga0501224_012560_533_1015 | 131 |
| 23 | 3300049688 | Ga0501259_003446 | Ga0501259_003446_1537_2019 | 131 |
| 24 | 3300049690 | Ga0501261_002563 | Ga0501261_002563_134_616 | 131 |
| 25 | 3300049708 | Ga0501245_010458 | Ga0501245_010458_424_906 | 131 |
| 26 | 3300005331 | Ga0070670_101263148 | Ga0070670_1012631482 | 132 |
| 27 | 3300005364 | Ga0070673_100123348 | Ga0070673_1001233482 | 132 |
| 28 | 3300005548 | Ga0070665_100488271 | Ga0070665_1004882713 | 132 |
| 29 | 3300025925 | Ga0207650_11305096 | Ga0207650_113050961 | 132 |
| 30 | 3300025936 | Ga0207670_10400314 | Ga0207670_104003142 | 132 |
| 31 | 3300025960 | Ga0207651_10476134 | Ga0207651_104761342 | 132 |
| 32 | 3300028379 | Ga0268266_10782811 | Ga0268266_107828112 | 132 |
| 33 | 3300044656 | Ga0466969_0362827 | Ga0466969_0362827_231_632 | 132 |
| 34 | 3300044694 | Ga0466963_0038233 | Ga0466963_0038233_339_740 | 132 |
| 35 | 3300044842 | Ga0466957_0005536 | Ga0466957_0005536_455_856 | 132 |
| 36 | 3300045976 | Ga0466967_0168273 | Ga0466967_0168273_300_701 | 132 |
| 37 | 3300046507 | Ga0495606_0113188 | Ga0495606_0113188_999_1400 | 132 |
| 38 | 3300046515 | Ga0495620_0095116 | Ga0495620_0095116_118_519 | 132 |
| 39 | 3300046616 | Ga0495668_0031307 | Ga0495668_0031307_2100_2501 | 132 |
| 40 | 3300046660 | Ga0495625_0163664 | Ga0495625_0163664_160_561 | 132 |
| 41 | 3300046684 | Ga0495669_0001598 | Ga0495669_0001598_8304_8705 | 132 |
| 42 | 3300046684 | Ga0495669_0033764 | Ga0495669_0033764_1354_1755 | 132 |
| 43 | 3300047445 | Ga0495677_0120067 | Ga0495677_0120067_411_812 | 132 |
| 44 | 3300047470 | Ga0495681_0321678 | Ga0495681_0321678_55_456 | 132 |
| 45 | 3300049705 | Ga0501225_0012801 | Ga0501225_0012801_140_622 | 132 |
| 46 | 3300049777 | Ga0501281_00203 | Ga0501281_00203_5000_5482 | 132 |
| 47 | 3300032133 | Ga0316583_10346732 | Ga0316583_103467321 | 133 |
| 48 | 3300005339 | Ga0070660_100004200 | Ga0070660_1000042006 | 134 |
| 49 | 3300005367 | Ga0070667_102351889 | Ga0070667_1023518891 | 134 |
| 50 | 3300025919 | Ga0207657_10000676 | Ga0207657_1000067611 | 134 |
| 51 | 3300039062 | Ga0400483_273484 | Ga0400483_273484_96_539 | 134 |
| 52 | 3300046616 | Ga0495668_0856317 | Ga0495668_0856317_53_484 | 135 |
| 53 | 3300060353 | Ga0501082_0679612 | Ga0501082_0679612_173_589 | 135 |
| 54 | 3300005353 | Ga0070669_101233096 | Ga0070669_1012330961 | 136 |
| 55 | 3300005354 | Ga0070675_101236601 | Ga0070675_1012366011 | 136 |
| 56 | 3300005356 | Ga0070674_100220552 | Ga0070674_1002205522 | 136 |
| 57 | 3300005441 | Ga0070700_100762091 | Ga0070700_1007620912 | 136 |
| 58 | 3300009093 | Ga0105240_10304841 | Ga0105240_103048412 | 136 |
| 59 | 3300009545 | Ga0105237_10554057 | Ga0105237_105540572 | 136 |
| 60 | 3300010375 | Ga0105239_10158490 | Ga0105239_101584901 | 136 |
| 61 | 3300014326 | Ga0157380_10687790 | Ga0157380_106877903 | 136 |
| 62 | 3300025907 | Ga0207645_10945051 | Ga0207645_109450512 | 136 |
| 63 | 3300025926 | Ga0207659_10218147 | Ga0207659_102181473 | 136 |
| 64 | 3300025937 | Ga0207669_10302677 | Ga0207669_103026772 | 136 |
| 65 | 3300025940 | Ga0207691_11040181 | Ga0207691_110401812 | 136 |
| 66 | 3300026075 | Ga0207708_10480591 | Ga0207708_104805912 | 136 |
| 67 | 3300005262 | Ga0065165_1006091 | Ga0065165_10060917 | 137 |
| 68 | 3300005563 | Ga0068855_100880182 | Ga0068855_1008801822 | 137 |
| 69 | 3300025913 | Ga0207695_10233272 | Ga0207695_102332722 | 137 |
| 70 | 3300028786 | Ga0307517_10021826 | Ga0307517_100218263 | 137 |
| 71 | 3300031456 | Ga0307513_10003525 | Ga0307513_100035255 | 137 |
| 72 | iso_pu_bacteria | 2854681122 | 2854684122 | 137 |
| 73 | 3300039062 | Ga0400483_027582 | Ga0400483_027582_1318_1743 | 138 |
| 74 | 3300002076 | JGI24749J21850_1001527 | JGI24749J21850_10015275 | 139 |
| 75 | 3300005347 | Ga0070668_100082728 | Ga0070668_1000827282 | 139 |
| 76 | 3300005353 | Ga0070669_100420387 | Ga0070669_1004203871 | 139 |
| 77 | 3300005435 | Ga0070714_101330574 | Ga0070714_1013305741 | 139 |
| 78 | 3300005844 | Ga0068862_100443611 | Ga0068862_1004436112 | 139 |
| 79 | 3300005844 | Ga0068862_101182766 | Ga0068862_1011827662 | 139 |
| 80 | 3300009177 | Ga0105248_10121971 | Ga0105248_101219712 | 139 |
| 81 | 3300025923 | Ga0207681_10223723 | Ga0207681_102237232 | 139 |
| 82 | 3300025972 | Ga0207668_10000489 | Ga0207668_1000048922 | 139 |
| 83 | 3300028380 | Ga0268265_10307762 | Ga0268265_103077622 | 139 |
| 84 | 3300028380 | Ga0268265_10350292 | Ga0268265_103502922 | 139 |
| 85 | 3300048920 | Ga0496117_0003644 | Ga0496117_0003644_9996_10415 | 139 |
| 86 | 3300048921 | Ga0496118_0000525 | Ga0496118_0000525_41456_41875 | 139 |
| 87 | 3300048924 | Ga0496121_0354307 | Ga0496121_0354307_204_623 | 139 |
| 88 | iso_pu_bacteria | 2919679072 | 2919680767 | 139 |
| 89 | 3300021377 | Ga0213874_10035865 | Ga0213874_100358653 | 140 |
| 90 | 3300039450 | Ga0436363_1687018 | Ga0436363_1687018_551_997 | 140 |
| 91 | iso_pu_bacteria | 2898795034 | 2898798712 | 140 |
| 92 | 3300005563 | Ga0068855_100225501 | Ga0068855_1002255012 | 141 |
| 93 | 3300009176 | Ga0105242_13217973 | Ga0105242_132179731 | 141 |
| 94 | 3300009545 | Ga0105237_11726561 | Ga0105237_117265612 | 141 |
| 95 | 3300025920 | Ga0207649_10614233 | Ga0207649_106142332 | 141 |
| 96 | 3300025949 | Ga0207667_11626939 | Ga0207667_116269391 | 141 |
| 97 | 3300005327 | Ga0070658_10765458 | Ga0070658_107654582 | 142 |
| 98 | 3300005355 | Ga0070671_101116562 | Ga0070671_1011165621 | 142 |
| 99 | 3300005548 | Ga0070665_100000921 | Ga0070665_1000009215 | 142 |
| 100 | 3300005548 | Ga0070665_100024078 | Ga0070665_1000240782 | 142 |
| 101 | 3300005618 | Ga0068864_100553000 | Ga0068864_1005530003 | 142 |
| 102 | 3300005841 | Ga0068863_100501042 | Ga0068863_1005010423 | 142 |
| 103 | 3300009093 | Ga0105240_11574726 | Ga0105240_115747261 | 142 |
| 104 | 3300009177 | Ga0105248_12744386 | Ga0105248_127443862 | 142 |
| 105 | 3300009553 | Ga0105249_10332166 | Ga0105249_103321662 | 142 |
| 106 | 3300010375 | Ga0105239_10360256 | Ga0105239_103602562 | 142 |
| 107 | 3300014969 | Ga0157376_12862577 | Ga0157376_128625771 | 142 |
| 108 | 3300025961 | Ga0207712_10306941 | Ga0207712_103069412 | 142 |
| 109 | 3300026095 | Ga0207676_10064082 | Ga0207676_100640825 | 142 |
| 110 | 3300031251 | Ga0265327_10098816 | Ga0265327_100988162 | 142 |
| 111 | 3300031456 | Ga0307513_10009571 | Ga0307513_100095719 | 142 |
| 112 | 3300033180 | Ga0307510_10021457 | Ga0307510_100214577 | 142 |
| 113 | 3300044901 | Ga0466960_0688150 | Ga0466960_0688150_119_550 | 142 |
| 114 | 3300045976 | Ga0466967_0563603 | Ga0466967_0563603_354_809 | 142 |
| 115 | 3300046539 | Ga0495621_0018181 | Ga0495621_0018181_878_1309 | 142 |
| 116 | 3300048918 | Ga0496115_0000546 | Ga0496115_0000546_3067_3498 | 142 |
| 117 | 3300048918 | Ga0496115_0021459 | Ga0496115_0021459_759_1190 | 142 |
| 118 | 3300049570 | Ga0501033_0439221 | Ga0501033_0439221_97_525 | 142 |
| 119 | 3300049579 | Ga0501043_0178954 | Ga0501043_0178954_811_1239 | 142 |
| 120 | 3300049822 | Ga0501035_0146036 | Ga0501035_0146036_1344_1772 | 142 |
| 121 | 3300049823 | Ga0501044_0012138 | Ga0501044_0012138_926_1354 | 142 |
| 122 | 3300005367 | Ga0070667_101622712 | Ga0070667_1016227121 | 143 |
| 123 | 3300009551 | Ga0105238_10043475 | Ga0105238_100434751 | 143 |
| 124 | 3300037853 | Ga0436364_1239369 | Ga0436364_1239369_13_450 | 143 |
| 125 | 3300026142 | Ga0207698_11278410 | Ga0207698_112784101 | 144 |
| 126 | 3300045051 | Ga0451576_0003127 | Ga0451576_0003127_6139_6588 | 144 |
| 127 | 3300049581 | Ga0501047_0397122 | Ga0501047_0397122_405_842 | 145 |
| 128 | 3300049823 | Ga0501044_0265463 | Ga0501044_0265463_1109_1546 | 145 |
| 129 | 3300005539 | Ga0068853_100242725 | Ga0068853_1002427253 | 146 |
| 130 | 3300039437 | Ga0436365_1728448 | Ga0436365_1728448_1849_2307 | 146 |
| 131 | 3300013105 | Ga0157369_10004086 | Ga0157369_100040865 | 147 |
| 132 | 3300005365 | Ga0070688_101100531 | Ga0070688_1011005311 | 148 |
| 133 | 3300025298 | Ga0209050_1042388 | Ga0209050_10423882 | 148 |
| 134 | 3300025903 | Ga0207680_10343448 | Ga0207680_103434481 | 150 |
| 135 | 3300046524 | Ga0495648_0070216 | Ga0495648_0070216_63_527 | 154 |
| 136 | 3300053118 | Ga0500594_0001365 | Ga0500594_0001365_2788_3252 | 154 |
| 137 | 3300005563 | Ga0068855_101583152 | Ga0068855_1015831522 | 155 |
| 138 | 3300005289 | Ga0065704_10461211 | Ga0065704_104612112 | 156 |
| 139 | 3300005295 | Ga0065707_10082120 | Ga0065707_1008212023 | 156 |
| 140 | 3300014326 | Ga0157380_10000375 | Ga0157380_100003759 | 156 |
| 141 | 3300053116 | Ga0500592_000347 | Ga0500592_000347_6600_7073 | 156 |
| 142 | 3300001904 | JGI24736J21556_1000129 | JGI24736J21556_10001299 | 157 |
| 143 | 3300001915 | JGI24741J21665_1035473 | JGI24741J21665_10354731 | 157 |
| 144 | 3300001976 | JGI24752J21851_1000008 | JGI24752J21851_100000823 | 157 |
| 145 | 3300001979 | JGI24740J21852_10004226 | JGI24740J21852_100042268 | 157 |
| 146 | 3300001989 | JGI24739J22299_10000908 | JGI24739J22299_1000090811 | 157 |
| 147 | 3300001989 | JGI24739J22299_10009175 | JGI24739J22299_100091751 | 157 |
| 148 | 3300001989 | JGI24739J22299_10064713 | JGI24739J22299_100647132 | 157 |
| 149 | 3300001990 | JGI24737J22298_10001786 | JGI24737J22298_1000178613 | 157 |
| 150 | 3300002067 | JGI24735J21928_10003205 | JGI24735J21928_100032051 | 157 |
| 151 | 3300002070 | JGI24750J21931_1000652 | JGI24750J21931_10006524 | 157 |
| 152 | 3300002074 | JGI24748J21848_1000037 | JGI24748J21848_100003710 | 157 |
| 153 | 3300002075 | JGI24738J21930_10008664 | JGI24738J21930_100086644 | 157 |
| 154 | 3300002075 | JGI24738J21930_10009269 | JGI24738J21930_100092692 | 157 |
| 155 | 3300002239 | JGI24034J26672_10000024 | JGI24034J26672_1000002431 | 157 |
| 156 | 3300002244 | JGI24742J22300_10005059 | JGI24742J22300_100050591 | 157 |
| 157 | 3300002459 | JGI24751J29686_10026235 | JGI24751J29686_100262351 | 157 |
| 158 | 3300005330 | Ga0070690_100000016 | Ga0070690_10000001646 | 157 |
| 159 | 3300005335 | Ga0070666_10000011 | Ga0070666_1000001127 | 157 |
| 160 | 3300005339 | Ga0070660_101224289 | Ga0070660_1012242891 | 157 |
| 161 | 3300005340 | Ga0070689_100004152 | Ga0070689_10000415210 | 157 |
| 162 | 3300005344 | Ga0070661_100184077 | Ga0070661_1001840772 | 157 |
| 163 | 3300005347 | Ga0070668_100183533 | Ga0070668_1001835332 | 157 |
| 164 | 3300005353 | Ga0070669_100000009 | Ga0070669_10000000964 | 157 |
| 165 | 3300005355 | Ga0070671_100139542 | Ga0070671_1001395423 | 157 |
| 166 | 3300005365 | Ga0070688_100016323 | Ga0070688_1000163232 | 157 |
| 167 | 3300005366 | Ga0070659_100748587 | Ga0070659_1007485871 | 157 |
| 168 | 3300005367 | Ga0070667_100097255 | Ga0070667_1000972554 | 157 |
| 169 | 3300005455 | Ga0070663_100731221 | Ga0070663_1007312211 | 157 |
| 170 | 3300005457 | Ga0070662_100044303 | Ga0070662_1000443032 | 157 |
| 171 | 3300005466 | Ga0070685_10000186 | Ga0070685_100001862 | 157 |
| 172 | 3300005539 | Ga0068853_100005287 | Ga0068853_10000528713 | 157 |
| 173 | 3300005539 | Ga0068853_100712960 | Ga0068853_1007129602 | 157 |
| 174 | 3300005544 | Ga0070686_100000001 | Ga0070686_100000001492 | 157 |
| 175 | 3300005548 | Ga0070665_100000004 | Ga0070665_100000004227 | 157 |
| 176 | 3300005563 | Ga0068855_100129449 | Ga0068855_1001294493 | 157 |
| 177 | 3300005563 | Ga0068855_100558541 | Ga0068855_1005585411 | 157 |
| 178 | 3300005564 | Ga0070664_100291452 | Ga0070664_1002914521 | 157 |
| 179 | 3300005564 | Ga0070664_102238933 | Ga0070664_1022389331 | 157 |
| 180 | 3300005577 | Ga0068857_100047204 | Ga0068857_1000472043 | 157 |
| 181 | 3300005577 | Ga0068857_100213205 | Ga0068857_1002132052 | 157 |
| 182 | 3300005577 | Ga0068857_100440249 | Ga0068857_1004402492 | 157 |
| 183 | 3300005578 | Ga0068854_100050612 | Ga0068854_1000506123 | 157 |
| 184 | 3300005578 | Ga0068854_100315272 | Ga0068854_1003152722 | 157 |
| 185 | 3300005578 | Ga0068854_100748798 | Ga0068854_1007487981 | 157 |
| 186 | 3300005614 | Ga0068856_101015891 | Ga0068856_1010158911 | 157 |
| 187 | 3300005616 | Ga0068852_100060712 | Ga0068852_1000607125 | 157 |
| 188 | 3300005616 | Ga0068852_100225422 | Ga0068852_1002254221 | 157 |
| 189 | 3300005616 | Ga0068852_101017383 | Ga0068852_1010173831 | 157 |
| 190 | 3300005617 | Ga0068859_100005061 | Ga0068859_10000506114 | 157 |
| 191 | 3300005618 | Ga0068864_100000827 | Ga0068864_1000008273 | 157 |
| 192 | 3300005719 | Ga0068861_100014131 | Ga0068861_1000141318 | 157 |
| 193 | 3300005834 | Ga0068851_10016266 | Ga0068851_100162662 | 157 |
| 194 | 3300005834 | Ga0068851_10878264 | Ga0068851_108782641 | 157 |
| 195 | 3300005841 | Ga0068863_100000010 | Ga0068863_10000001094 | 157 |
| 196 | 3300005842 | Ga0068858_100000360 | Ga0068858_10000036042 | 157 |
| 197 | 3300005843 | Ga0068860_100000030 | Ga0068860_100000030232 | 157 |
| 198 | 3300005844 | Ga0068862_100007850 | Ga0068862_10000785010 | 157 |
| 199 | 3300005937 | Ga0081455_10000220 | Ga0081455_1000022029 | 157 |
| 200 | 3300006931 | Ga0097620_100005061 | Ga0097620_1000050619 | 157 |
| 201 | 3300009092 | Ga0105250_10154112 | Ga0105250_101541122 | 157 |
| 202 | 3300009093 | Ga0105240_10266043 | Ga0105240_102660433 | 157 |
| 203 | 3300009101 | Ga0105247_10057032 | Ga0105247_100570324 | 157 |
| 204 | 3300009174 | Ga0105241_10581881 | Ga0105241_105818811 | 157 |
| 205 | 3300009177 | Ga0105248_10021880 | Ga0105248_1002188012 | 157 |
| 206 | 3300009545 | Ga0105237_10407908 | Ga0105237_104079082 | 157 |
| 207 | 3300009551 | Ga0105238_10071573 | Ga0105238_100715734 | 157 |
| 208 | 3300009551 | Ga0105238_10260862 | Ga0105238_102608621 | 157 |
| 209 | 3300009551 | Ga0105238_11408163 | Ga0105238_114081631 | 157 |
| 210 | 3300009553 | Ga0105249_10000016 | Ga0105249_10000016233 | 157 |
| 211 | 3300010375 | Ga0105239_11959449 | Ga0105239_119594491 | 157 |
| 212 | 3300013100 | Ga0157373_10057705 | Ga0157373_100577054 | 157 |
| 213 | 3300013104 | Ga0157370_10083140 | Ga0157370_100831405 | 157 |
| 214 | 3300013105 | Ga0157369_10063936 | Ga0157369_100639363 | 157 |
| 215 | 3300013297 | Ga0157378_10223356 | Ga0157378_102233562 | 157 |
| 216 | 3300014325 | Ga0163163_10036729 | Ga0163163_100367295 | 157 |
| 217 | 3300014326 | Ga0157380_10001265 | Ga0157380_1000126510 | 157 |
| 218 | 3300014968 | Ga0157379_10172630 | Ga0157379_101726302 | 157 |
| 219 | 3300017792 | Ga0163161_10000044 | Ga0163161_1000004481 | 157 |
| 220 | 3300025321 | Ga0207656_10109142 | Ga0207656_101091423 | 157 |
| 221 | 3300025321 | Ga0207656_10291639 | Ga0207656_102916391 | 157 |
| 222 | 3300025903 | Ga0207680_10000008 | Ga0207680_10000008485 | 157 |
| 223 | 3300025904 | Ga0207647_10000283 | Ga0207647_1000028331 | 157 |
| 224 | 3300025911 | Ga0207654_10012084 | Ga0207654_100120844 | 157 |
| 225 | 3300025913 | Ga0207695_10142910 | Ga0207695_101429102 | 157 |
| 226 | 3300025914 | Ga0207671_10001568 | Ga0207671_100015682 | 157 |
| 227 | 3300025919 | Ga0207657_10065984 | Ga0207657_100659841 | 157 |
| 228 | 3300025919 | Ga0207657_10627219 | Ga0207657_106272191 | 157 |
| 229 | 3300025920 | Ga0207649_10323248 | Ga0207649_103232482 | 157 |
| 230 | 3300025923 | Ga0207681_10000020 | Ga0207681_1000002048 | 157 |
| 231 | 3300025924 | Ga0207694_10024684 | Ga0207694_100246842 | 157 |
| 232 | 3300025924 | Ga0207694_10181302 | Ga0207694_101813023 | 157 |
| 233 | 3300025925 | Ga0207650_10060015 | Ga0207650_100600153 | 157 |
| 234 | 3300025931 | Ga0207644_10003251 | Ga0207644_1000325113 | 157 |
| 235 | 3300025932 | Ga0207690_10472168 | Ga0207690_104721682 | 157 |
| 236 | 3300025933 | Ga0207706_10003179 | Ga0207706_100031796 | 157 |
| 237 | 3300025933 | Ga0207706_10094682 | Ga0207706_100946822 | 157 |
| 238 | 3300025933 | Ga0207706_11090419 | Ga0207706_110904191 | 157 |
| 239 | 3300025936 | Ga0207670_10006832 | Ga0207670_100068326 | 157 |
| 240 | 3300025941 | Ga0207711_10050587 | Ga0207711_100505872 | 157 |
| 241 | 3300025944 | Ga0207661_11284835 | Ga0207661_112848351 | 157 |
| 242 | 3300025945 | Ga0207679_10715171 | Ga0207679_107151712 | 157 |
| 243 | 3300025949 | Ga0207667_10005214 | Ga0207667_1000521416 | 157 |
| 244 | 3300025949 | Ga0207667_10118495 | Ga0207667_101184954 | 157 |
| 245 | 3300025961 | Ga0207712_10000009 | Ga0207712_10000009485 | 157 |
| 246 | 3300025972 | Ga0207668_10102724 | Ga0207668_101027242 | 157 |
| 247 | 3300025981 | Ga0207640_10472135 | Ga0207640_104721351 | 157 |
| 248 | 3300025981 | Ga0207640_10669745 | Ga0207640_106697452 | 157 |
| 249 | 3300025986 | Ga0207658_10000305 | Ga0207658_1000030515 | 157 |
| 250 | 3300026035 | Ga0207703_10343072 | Ga0207703_103430722 | 157 |
| 251 | 3300026041 | Ga0207639_10020538 | Ga0207639_100205382 | 157 |
| 252 | 3300026041 | Ga0207639_10165202 | Ga0207639_101652021 | 157 |
| 253 | 3300026067 | Ga0207678_10001025 | Ga0207678_1000102524 | 157 |
| 254 | 3300026078 | Ga0207702_10041490 | Ga0207702_100414902 | 157 |
| 255 | 3300026088 | Ga0207641_10000171 | Ga0207641_1000017130 | 157 |
| 256 | 3300026095 | Ga0207676_10001337 | Ga0207676_1000133721 | 157 |
| 257 | 3300026116 | Ga0207674_10002464 | Ga0207674_1000246417 | 157 |
| 258 | 3300026116 | Ga0207674_11261273 | Ga0207674_112612732 | 157 |
| 259 | 3300026116 | Ga0207674_11263213 | Ga0207674_112632131 | 157 |
| 260 | 3300026118 | Ga0207675_100003112 | Ga0207675_10000311214 | 157 |
| 261 | 3300026142 | Ga0207698_10029577 | Ga0207698_100295776 | 157 |
| 262 | 3300026142 | Ga0207698_10082375 | Ga0207698_100823754 | 157 |
| 263 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009562 | 157 |
| 264 | 3300028380 | Ga0268265_10000785 | Ga0268265_100007856 | 157 |
| 265 | 3300028381 | Ga0268264_10000003 | Ga0268264_100000031107 | 157 |
| 266 | 3300031911 | Ga0307412_10311462 | Ga0307412_103114622 | 157 |
| 267 | 3300031911 | Ga0307412_11349462 | Ga0307412_113494621 | 157 |
| 268 | 3300046616 | Ga0495668_0003779 | Ga0495668_0003779_543_1022 | 157 |
| 269 | 3300046616 | Ga0495668_0763752 | Ga0495668_0763752_32_508 | 157 |
| 270 | 3300048904 | Ga0496101_0485140 | Ga0496101_0485140_208_681 | 157 |
| 271 | 3300048905 | Ga0496102_0001580 | Ga0496102_0001580_5736_6209 | 157 |
| 272 | 3300048906 | Ga0496103_0001164 | Ga0496103_0001164_935_1408 | 157 |
| 273 | 3300048907 | Ga0496104_0191362 | Ga0496104_0191362_785_1258 | 157 |
| 274 | 3300048908 | Ga0496105_0041313 | Ga0496105_0041313_2088_2561 | 157 |
| 275 | 3300048909 | Ga0496106_0085797 | Ga0496106_0085797_318_791 | 157 |
| 276 | 3300048910 | Ga0496107_0141504 | Ga0496107_0141504_131_604 | 157 |
| 277 | 3300048911 | Ga0496108_0863620 | Ga0496108_0863620_219_692 | 157 |
| 278 | 3300048914 | Ga0496111_0353877 | Ga0496111_0353877_170_643 | 157 |
| 279 | 3300048920 | Ga0496117_0002767 | Ga0496117_0002767_3760_4233 | 157 |
| 280 | 3300048921 | Ga0496118_0171353 | Ga0496118_0171353_565_1038 | 157 |
| 281 | 3300048924 | Ga0496121_0079990 | Ga0496121_0079990_1817_2290 | 157 |
| 282 | 3300053151 | Ga0500604_0021754 | Ga0500604_0021754_1317_1796 | 157 |
| 283 | 3300053158 | Ga0500627_0001445 | Ga0500627_0001445_183_659 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar