F385203

General Info

Members Datasets Scaffolds Average Seq Length
282 213 234 327

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0051637|Ga0501034_0051637_3061_4041
Length 315
Sequence MRFFVRRGIFYVVTLWAAITINFFLPRMMPGDPISALIASRQGQITPEQAESIRVLFGLDNEQSLWQQYTSYIGQILHGDLGIAFSQFPTPVSQIIRDTLPWTLGLVGLSTIIAVWRRGTKADIILPITTFFSSVPYFWFGLVAVLLFSVTWKIFPSSKGYQPGLIPGWNWVFISSVLWHGALPAITIVLSSVAGWILGMRNMMVTVGSEDYVTVAQAKGLPERRVMVSYAARNAVLPQISSFALALGFVVGGTLIMEMVFSYPGIGYALFQAVQAKDYPLMQGCFLVITLSILLFNLIADVVYAFLDPRTRQEG

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
4 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
5 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221630 Microbacterium sp. Root322 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
12 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
13 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
14 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
15 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
16 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
17 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
18 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
19 2808606394 Promicromonospora sp. C35 Isolate Unclassified
20 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
21 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
22 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
23 2855683550 Micromonospora sp. RP3T Isolate Unclassified
24 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
25 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
26 2858868258 Micromonospora sp. MH33 Isolate Unclassified
27 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
28 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
29 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
30 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
31 2902582711 Micromonospora sp. AP08 Isolate Unclassified
32 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
33 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
34 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
35 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
36 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
37 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
38 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
39 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
46 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
47 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
48 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
107 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
108 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
109 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
124 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 649633069 Micromonospora sp. L5 Isolate Unclassified
206 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
207 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
208 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
209 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
210 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
211 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
212 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
213 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.27
Metatranscriptomes 0.71
Isolates 17.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 0.35
Rhizoplane 6.03
Rhizosphere 68.79
Stem 0
Stem Tuber 0
Unclassified 19.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001713 3300001979 Bacteria 10073
2 JGI24740J21852_10017113 3300001979 Bacteria 2601
3 JGI24739J22299_10004962 3300001989 Bacteria 5064
4 JGI24737J22298_10019621 3300001990 Bacteria 2161
5 JGI24735J21928_10033909 3300002067 Bacteria 1507
6 JGI25406J46586_10002316 3300003203 Bacteria 8994
7 Ga0007423J48922_101409 3300003285 Bacteria 2359
8 Ga0007423J48922_101410 3300003285 Bacteria 1980
9 Ga0055527_1000032 3300003760 Bacteria 153292
10 Ga0055542_1000164 3300003762 Bacteria 83529
11 Ga0055529_1000379 3300003763 Bacteria 48129
12 Ga0070668_100000137 3300005347 Bacteria 46061
13 Ga0070668_100027138 3300005347 Bacteria 4346
14 Ga0070668_100150085 3300005347 Bacteria 1884
15 Ga0070668_100255148 3300005347 Bacteria 1457
16 Ga0070663_100002607 3300005455 Bacteria 10190
17 Ga0070684_100362678 3300005535 Bacteria 1334
18 Ga0070665_100037473 3300005548 Bacteria 4877
19 Ga0068855_100461528 3300005563 Bacteria 1385
20 Ga0070664_100035599 3300005564 Bacteria 4180
21 Ga0068857_100077545 3300005577 Bacteria 2965
22 Ga0068852_100032907 3300005616 Bacteria 4299
23 Ga0068864_100019177 3300005618 Bacteria 5717
24 Ga0068863_100174240 3300005841 Bacteria 2064
25 Ga0068858_100475275 3300005842 Bacteria 1206
26 Ga0068862_100035142 3300005844 Bacteria 4242
27 Ga0081455_10076057 3300005937 Bacteria 2767
28 Ga0081540_1005682 3300005983 Bacteria 9268
29 Ga0081539_10000121 3300005985 Bacteria 183432
30 Ga0075364_10006348 3300006051 Bacteria 6945
31 Ga0075428_100104537 3300006844 Bacteria 3088
32 Ga0105244_10049118 3300009036 Bacteria 2158
33 Ga0105244_10054805 3300009036 Bacteria 2022
34 Ga0114129_10133063 3300009147 Bacteria 3414
35 Ga0105243_10006417 3300009148 Bacteria 9089
36 Ga0105248_10025408 3300009177 Bacteria 6585
37 Ga0105248_10029276 3300009177 Bacteria 6143
38 Ga0105246_10026725 3300011119 Bacteria 3774
39 Ga0157371_10036336 3300013102 Bacteria 3528
40 Ga0157370_10183440 3300013104 Bacteria 1944
41 Ga0157369_10050301 3300013105 Bacteria 4514
42 Ga0157369_10204951 3300013105 Bacteria 2069
43 Ga0157369_10255173 3300013105 Bacteria 1830
44 Ga0157369_10420159 3300013105 Bacteria 1386
45 Ga0163162_10323295 3300013306 Bacteria 1675
46 Ga0157372_10188574 3300013307 Bacteria 2388
47 Ga0157372_10379482 3300013307 Bacteria 1647
48 Ga0157375_10273217 3300013308 Bacteria 1852
49 Ga0157375_10379750 3300013308 Bacteria 1580
50 Ga0157375_10609867 3300013308 Bacteria 1250
51 Ga0157375_10653936 3300013308 Bacteria 1207
52 Ga0163163_10042380 3300014325 Bacteria 4457
53 Ga0157377_10246613 3300014745 Bacteria 1155
54 Ga0157376_10474073 3300014969 Bacteria 1225
55 Ga0209672_100006 3300025228 Bacteria 1004497
56 Ga0209147_100515 3300025229 Bacteria 22436
57 Ga0209258_101390 3300025242 Bacteria 8706
58 Ga0209646_1000085 3300025246 Bacteria 197351
59 Ga0209148_1000152 3300025254 Bacteria 153782
60 Ga0209455_1000134 3300025272 Bacteria 153783
61 Ga0209455_1000867 3300025272 Bacteria 16045
62 Ga0207655_1006431 3300025728 Bacteria 7788
63 Ga0207692_10002059 3300025898 Bacteria 7679
64 Ga0207680_10221264 3300025903 Bacteria 1298
65 Ga0207647_10008055 3300025904 Bacteria 7576
66 Ga0207663_10303473 3300025916 Bacteria 1194
67 Ga0207694_10056801 3300025924 Bacteria 3041
68 Ga0207700_10138172 3300025928 Bacteria 1999
69 Ga0207709_10003818 3300025935 Bacteria 8845
70 Ga0207691_10422097 3300025940 Bacteria 1136
71 Ga0207711_10014438 3300025941 Bacteria 6561
72 Ga0207711_10097741 3300025941 Bacteria 2593
73 Ga0207711_10118640 3300025941 Bacteria 2360
74 Ga0207679_10058497 3300025945 Bacteria 2857
75 Ga0207679_10304994 3300025945 Bacteria 1374
76 Ga0207668_10001462 3300025972 Bacteria 13864
77 Ga0207668_10019359 3300025972 Bacteria 4301
78 Ga0207668_10137802 3300025972 Bacteria 1872
79 Ga0207677_10119934 3300026023 Bacteria 1976
80 Ga0207678_10000283 3300026067 Bacteria 46141
81 Ga0207678_10089930 3300026067 Bacteria 2624
82 Ga0207678_10394142 3300026067 Bacteria 1198
83 Ga0207676_10103813 3300026095 Bacteria 2363
84 Ga0207674_10024678 3300026116 Bacteria 6419
85 Ga0207674_10770315 3300026116 Bacteria 929
86 Ga0207698_10021945 3300026142 Bacteria 4426
87 Ga0268266_10069373 3300028379 Bacteria 3054
88 Ga0268266_10234506 3300028379 Bacteria 1691
89 Ga0307515_10000044 3300028794 Bacteria 303041
90 Ga0307515_10104943 3300028794 Bacteria 3370
91 Ga0307515_10262737 3300028794 Bacteria 1460
92 Ga0307511_10000690 3300030521 Bacteria 36120
93 Ga0307512_10006028 3300030522 Bacteria 12421
94 Ga0307512_10182523 3300030522 Bacteria 1176
95 Ga0316177_1038656 3300030731 Bacteria 2582
96 Ga0314311_1250668 3300030733 Bacteria 4754
97 Ga0316180_1182021 3300030736 Bacteria 1277
98 Ga0307513_10009159 3300031456 Bacteria 12541
99 Ga0307513_10009872 3300031456 Bacteria 12046
100 Ga0307509_10004174 3300031507 Bacteria 21103
101 Ga0307508_10003279 3300031616 Bacteria 16498
102 Ga0307508_10065068 3300031616 Bacteria 3213
103 Ga0307508_10202979 3300031616 Bacteria 1583
104 Ga0307516_10000267 3300031730 Bacteria 67005
105 Ga0307516_10097631 3300031730 Bacteria 2757
106 Ga0307405_10012971 3300031731 Bacteria 4433
107 Ga0307405_10085391 3300031731 Bacteria 2075
108 Ga0307409_100310351 3300031995 Bacteria 1472
109 Ga0307416_100295244 3300032002 Bacteria 1607
110 Ga0307415_100088838 3300032126 Bacteria 2231
111 Ga0307415_100249104 3300032126 Bacteria 1442
112 Ga0307507_10034188 3300033179 Bacteria 5259
113 Ga0307507_10051918 3300033179 Bacteria 3940
114 Ga0307510_10097042 3300033180 Bacteria 2760
115 Ga0307510_10168311 3300033180 Bacteria 1775
116 Ga0395898_0014520 3300037466 Bacteria 8088
117 Ga0395898_0062084 3300037466 Bacteria 3630
118 Ga0395905_0105246 3300037471 Bacteria 2649
119 Ga0395901_0044033 3300038443 Bacteria 4629
120 Ga0451791_0256774 3300041451 Bacteria 2676
121 Ga0451797_0655792 3300041453 Bacteria 1534
122 Ga0451853_0016136 3300041512 Bacteria 2663
123 Ga0439431_0003258 3300041997 Bacteria 3572
124 Ga0466969_0011682 3300044656 Bacteria 4646
125 Ga0466969_0051480 3300044656 Bacteria 2026
126 Ga0466972_0000707 3300044658 Bacteria 15937
127 Ga0466972_0001294 3300044658 Bacteria 12082
128 Ga0466972_0025719 3300044658 Bacteria 2915
129 Ga0466965_0003032 3300044683 Bacteria 7301
130 Ga0466965_0003488 3300044683 Bacteria 6902
131 Ga0466965_0007797 3300044683 Bacteria 4931
132 Ga0466965_0018219 3300044683 Bacteria 3364
133 Ga0466966_0006455 3300044684 Bacteria 7759
134 Ga0466966_0013849 3300044684 Bacteria 5337
135 Ga0466961_0003291 3300044693 Bacteria 10066
136 Ga0466961_0243797 3300044693 Bacteria 1104
137 Ga0466971_0000275 3300044719 Bacteria 19775
138 Ga0466968_0031923 3300044735 Bacteria 2188
139 Ga0466970_0000085 3300044765 Bacteria 38719
140 Ga0466970_0008246 3300044765 Bacteria 5235
141 Ga0466957_0097252 3300044842 Bacteria 1851
142 Ga0466960_0003189 3300044901 Bacteria 6290
143 Ga0466960_0004642 3300044901 Bacteria 5388
144 Ga0466960_0038649 3300044901 Bacteria 2246
145 Ga0466960_0142825 3300044901 Bacteria 1273
146 Ga0466959_0003897 3300045049 Bacteria 9906
147 Ga0466959_0005220 3300045049 Bacteria 8864
148 Ga0466958_0022343 3300045836 Bacteria 3704
149 Ga0466958_0078133 3300045836 Bacteria 2033
150 Ga0466967_0065014 3300045976 Bacteria 3246
151 Ga0466967_0141365 3300045976 Bacteria 2242
152 Ga0495627_019368 3300046453 Bacteria 2283
153 Ga0495592_0002377 3300046454 Bacteria 13265
154 Ga0495592_0077920 3300046454 Bacteria 2401
155 Ga0495603_0001516 3300046455 Bacteria 13555
156 Ga0495603_0001913 3300046455 Bacteria 12281
157 Ga0495629_0000414 3300046459 Bacteria 35799
158 Ga0495629_0003675 3300046459 Bacteria 11591
159 Ga0495638_0100472 3300046460 Bacteria 1731
160 Ga0495638_0135420 3300046460 Bacteria 1443
161 Ga0495651_0001434 3300046462 Bacteria 18454
162 Ga0495651_0025905 3300046462 Bacteria 4566
163 Ga0495580_0040415 3300046472 Bacteria 3331
164 Ga0495582_0144177 3300046473 Bacteria 1351
165 Ga0495662_0000316 3300046476 Bacteria 21004
166 Ga0495664_0001280 3300046477 Bacteria 13167
167 Ga0495664_0031352 3300046477 Bacteria 3116
168 Ga0495594_0000784 3300046499 Bacteria 16366
169 Ga0495608_0001532 3300046511 Bacteria 16465
170 Ga0495618_0019542 3300046514 Bacteria 4169
171 Ga0495628_0004838 3300046516 Bacteria 11847
172 Ga0495630_0043098 3300046517 Bacteria 3370
173 Ga0495666_0001077 3300046526 Bacteria 12999
174 Ga0495652_0033654 3300046529 Bacteria 4471
175 Ga0495665_0000346 3300046531 Bacteria 23339
176 Ga0495586_0006730 3300046535 Bacteria 6139
177 Ga0495645_0036656 3300046543 Bacteria 3574
178 Ga0495622_0002142 3300046557 Bacteria 9619
179 Ga0495667_0001088 3300046559 Bacteria 17635
180 Ga0495634_0036175 3300046642 Bacteria 3377
181 Ga0495625_0195728 3300046660 Bacteria 1337
182 Ga0495657_0005278 3300046675 Bacteria 10225
183 Ga0495599_0002673 3300046678 Bacteria 10406
184 Ga0495623_0061181 3300046679 Bacteria 2361
185 Ga0495646_0002071 3300046680 Bacteria 12161
186 Ga0495658_0104179 3300046683 Bacteria 1698
187 Ga0495613_0001175 3300046689 Bacteria 19978
188 Ga0495589_0051444 3300046794 Bacteria 2037
189 Ga0495600_0002785 3300046809 Bacteria 10147
190 Ga0495600_0032665 3300046809 Bacteria 3377
191 Ga0495604_0001376 3300047317 Bacteria 19927
192 Ga0495674_0037015 3300047319 Bacteria 4386
193 Ga0495676_0000473 3300047321 Bacteria 32896
194 Ga0495676_0000666 3300047321 Bacteria 28573
195 Ga0495683_0049950 3300047323 Bacteria 2094
196 Ga0495675_0031642 3300047444 Bacteria 3377
197 Ga0495593_0017285 3300047673 Bacteria 4059
198 Ga0495602_0096694 3300048088 Bacteria 2435
199 Ga0495614_0000363 3300048089 Bacteria 18200
200 Ga0496103_0142101 3300048906 Bacteria 1535
201 Ga0496104_0001818 3300048907 Bacteria 18503
202 Ga0496104_0355558 3300048907 Bacteria 1377
203 Ga0496105_0011733 3300048908 Bacteria 6934
204 Ga0496108_0000007 3300048911 Bacteria 351492
205 Ga0496108_0053382 3300048911 Bacteria 3389
206 Ga0496108_0205112 3300048911 Bacteria 1711
207 Ga0496109_0003349 3300048912 Bacteria 13409
208 Ga0496110_0290962 3300048913 Bacteria 1488
209 Ga0496112_0044334 3300048915 Bacteria 4357
210 Ga0496112_0090736 3300048915 Bacteria 3024
211 Ga0496113_0007637 3300048916 Bacteria 6977
212 Ga0496114_0147584 3300048917 Bacteria 2039
213 Ga0496114_0151439 3300048917 Bacteria 2012
214 Ga0496115_0095324 3300048918 Bacteria 2435
215 Ga0496117_0000668 3300048920 Bacteria 54828
216 Ga0496117_0088659 3300048920 Bacteria 2001
217 Ga0496120_0012295 3300048923 Bacteria 5834
218 Ga0496122_0231411 3300048925 Bacteria 1050
219 Ga0496125_0003267 3300048928 Bacteria 19944
220 Ga0496126_0059368 3300048929 Bacteria 3445
221 Ga0496126_0075049 3300048929 Bacteria 3002
222 Ga0501034_0051637 3300049571 Bacteria 4146
223 Ga0501044_0318587 3300049823 Bacteria 1480
224 Ga0501044_0451594 3300049823 Bacteria 1192
225 nmdc:mga00v17_4714_c1 3300050491 Bacteria 7126
226 Ga0495601_0007160 3300053077 Bacteria 6543
227 Ga0495601_0007892 3300053077 Bacteria 6269
228 Ga0495601_0099685 3300053077 Bacteria 1875
229 Ga0495612_0004735 3300053078 Bacteria 5631
230 Ga0495619_0060447 3300053085 Bacteria 2519
231 Ga0500644_0010457 3300053088 Bacteria 2513
232 Ga0500646_0000222 3300053090 Bacteria 17146
233 Ga0500616_0001667 3300053153 Bacteria 20489
234 Ga0466962_0012271 3300061719 Bacteria 4119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10474073 Ga0157376_104740732 277
2 3300046660 Ga0495625_0195728 Ga0495625_0195728_472_1320 282
3 3300026116 Ga0207674_10770315 Ga0207674_107703151 287
4 3300061719 Ga0466962_0012271 Ga0466962_0012271_21_920 299
5 3300048925 Ga0496122_0231411 Ga0496122_0231411_10_957 315
6 3300049571 Ga0501034_0051637 Ga0501034_0051637_3061_4041 315
7 3300041997 Ga0439431_0003258 Ga0439431_0003258_804_1787 316
8 3300046453 Ga0495627_019368 Ga0495627_019368_796_1779 316
9 3300046454 Ga0495592_0002377 Ga0495592_0002377_9539_10519 321
10 3300046462 Ga0495651_0001434 Ga0495651_0001434_2770_3750 321
11 3300046472 Ga0495580_0040415 Ga0495580_0040415_603_1583 321
12 3300046476 Ga0495662_0000316 Ga0495662_0000316_15203_16183 321
13 3300046477 Ga0495664_0001280 Ga0495664_0001280_9266_10246 321
14 3300046511 Ga0495608_0001532 Ga0495608_0001532_9160_10140 321
15 3300046516 Ga0495628_0004838 Ga0495628_0004838_870_1850 321
16 3300046517 Ga0495630_0043098 Ga0495630_0043098_512_1492 321
17 3300046526 Ga0495666_0001077 Ga0495666_0001077_4607_5587 321
18 3300046531 Ga0495665_0000346 Ga0495665_0000346_9633_10613 321
19 3300046535 Ga0495586_0006730 Ga0495586_0006730_1961_2941 321
20 3300046559 Ga0495667_0001088 Ga0495667_0001088_5462_6442 321
21 3300046642 Ga0495634_0036175 Ga0495634_0036175_1400_2380 321
22 3300046675 Ga0495657_0005278 Ga0495657_0005278_6198_7178 321
23 3300046678 Ga0495599_0002673 Ga0495599_0002673_6657_7637 321
24 3300046679 Ga0495623_0061181 Ga0495623_0061181_998_1978 321
25 3300046680 Ga0495646_0002071 Ga0495646_0002071_9462_10442 321
26 3300046809 Ga0495600_0032665 Ga0495600_0032665_1400_2380 321
27 3300047317 Ga0495604_0001376 Ga0495604_0001376_16026_17006 321
28 3300047319 Ga0495674_0037015 Ga0495674_0037015_2007_2987 321
29 3300047444 Ga0495675_0031642 Ga0495675_0031642_1528_2508 321
30 3300053077 Ga0495601_0007892 Ga0495601_0007892_2122_3102 321
31 iso_pu_bacteria 2501939600 2501940706 321
32 iso_pu_bacteria 2855683550 2855683820 321
33 iso_pu_bacteria 2856858025 2856862797 321
34 iso_pu_bacteria 2858868258 2858869356 321
35 iso_pu_bacteria 2902582711 2902585050 321
36 iso_pu_bacteria 2929219909 2929224221 321
37 iso_pu_bacteria 2996221748 2996225610 321
38 iso_pu_bacteria 649633069 649815432 321
39 iso_pu_bacteria 8055412473 8055417375 321
40 iso_pu_bacteria 2558860280 2559431343 322
41 iso_pu_bacteria 2616644941 2616903867 322
42 iso_pu_bacteria 2622736626 2623589501 322
43 iso_pu_bacteria 2643221548 2643764155 322
44 iso_pu_bacteria 2643221578 2643902086 322
45 iso_pu_bacteria 2643221673 2644406759 322
46 iso_pu_bacteria 2643221682 2644461412 322
47 iso_pu_bacteria 2751185734 2753071378 322
48 iso_pu_bacteria 2751185782 2753267622 322
49 iso_pu_bacteria 2795385470 2795783021 322
50 iso_pu_bacteria 2816332119 2816426911 322
51 iso_pu_bacteria 2818991463 2819694478 322
52 iso_pu_bacteria 2858902515 2858904372 322
53 iso_pu_bacteria 2862705112 2862708207 322
54 iso_pu_bacteria 2870721527 2870721814 322
55 iso_pu_bacteria 2875391855 2875396886 322
56 iso_pu_bacteria 2912757875 2912762950 322
57 iso_pu_bacteria 2946045630 2946047677 322
58 iso_pu_bacteria 2966598605 2966600723 322
59 iso_pu_bacteria 2990044586 2990046750 322
60 iso_pu_bacteria 8003314358 8003319527 322
61 iso_pu_bacteria 8008485437 8008488076 322
62 iso_pu_bacteria 8025524527 8025527864 322
63 iso_pu_bacteria 8025530807 8025532575 322
64 iso_pu_bacteria 8047710418 8047716522 322
65 iso_pu_bacteria 2738541272 2738692342 323
66 iso_pu_bacteria 2738543027 2739323427 323
67 iso_pu_bacteria 2739367654 2739609120 323
68 iso_pu_bacteria 2758568522 2760303425 323
69 iso_pu_bacteria 2758568621 2760622677 323
70 iso_pu_bacteria 2808606394 2809027465 323
71 iso_pu_bacteria 2857729791 2857733256 323
72 iso_pu_bacteria 2928121344 2928121957 323
73 iso_pu_bacteria 8056579771 8056584177 323
74 3300006844 Ga0075428_100104537 Ga0075428_1001045371 324
75 3300009147 Ga0114129_10133063 Ga0114129_101330633 324
76 3300044684 Ga0466966_0006455 Ga0466966_0006455_5198_6181 324
77 3300044693 Ga0466961_0243797 Ga0466961_0243797_47_1030 324
78 3300045049 Ga0466959_0003897 Ga0466959_0003897_2749_3732 324
79 3300003285 Ga0007423J48922_101409 Ga0007423J48922_1014092 325
80 3300003285 Ga0007423J48922_101410 Ga0007423J48922_1014102 325
81 3300003760 Ga0055527_1000032 Ga0055527_100003292 325
82 3300003762 Ga0055542_1000164 Ga0055542_100016465 325
83 3300003763 Ga0055529_1000379 Ga0055529_100037920 325
84 3300013105 Ga0157369_10204951 Ga0157369_102049512 325
85 3300013308 Ga0157375_10273217 Ga0157375_102732172 325
86 3300025228 Ga0209672_100006 Ga0209672_10000665 325
87 3300025229 Ga0209147_100515 Ga0209147_1005152 325
88 3300025242 Ga0209258_101390 Ga0209258_1013902 325
89 3300025254 Ga0209148_1000152 Ga0209148_100015293 325
90 3300025272 Ga0209455_1000134 Ga0209455_100013493 325
91 3300026067 Ga0207678_10089930 Ga0207678_100899302 325
92 3300048917 Ga0496114_0151439 Ga0496114_0151439_682_1659 325
93 3300001979 JGI24740J21852_10017113 JGI24740J21852_100171132 326
94 3300001989 JGI24739J22299_10004962 JGI24739J22299_100049622 326
95 3300001990 JGI24737J22298_10019621 JGI24737J22298_100196212 326
96 3300002067 JGI24735J21928_10033909 JGI24735J21928_100339092 326
97 3300003203 JGI25406J46586_10002316 JGI25406J46586_100023166 326
98 3300005347 Ga0070668_100000137 Ga0070668_10000013716 326
99 3300005347 Ga0070668_100027138 Ga0070668_1000271384 326
100 3300005347 Ga0070668_100150085 Ga0070668_1001500852 326
101 3300005347 Ga0070668_100255148 Ga0070668_1002551482 326
102 3300005455 Ga0070663_100002607 Ga0070663_1000026073 326
103 3300005535 Ga0070684_100362678 Ga0070684_1003626782 326
104 3300005548 Ga0070665_100037473 Ga0070665_1000374733 326
105 3300005563 Ga0068855_100461528 Ga0068855_1004615282 326
106 3300005564 Ga0070664_100035599 Ga0070664_1000355993 326
107 3300005577 Ga0068857_100077545 Ga0068857_1000775453 326
108 3300005616 Ga0068852_100032907 Ga0068852_1000329073 326
109 3300005618 Ga0068864_100019177 Ga0068864_1000191775 326
110 3300005841 Ga0068863_100174240 Ga0068863_1001742402 326
111 3300005842 Ga0068858_100475275 Ga0068858_1004752752 326
112 3300005844 Ga0068862_100035142 Ga0068862_1000351424 326
113 3300005937 Ga0081455_10076057 Ga0081455_100760572 326
114 3300005983 Ga0081540_1005682 Ga0081540_10056829 326
115 3300005985 Ga0081539_10000121 Ga0081539_1000012163 326
116 3300009177 Ga0105248_10025408 Ga0105248_100254084 326
117 3300009177 Ga0105248_10029276 Ga0105248_100292765 326
118 3300011119 Ga0105246_10026725 Ga0105246_100267252 326
119 3300013104 Ga0157370_10183440 Ga0157370_101834402 326
120 3300013105 Ga0157369_10255173 Ga0157369_102551732 326
121 3300013306 Ga0163162_10323295 Ga0163162_103232952 326
122 3300013307 Ga0157372_10188574 Ga0157372_101885742 326
123 3300013307 Ga0157372_10379482 Ga0157372_103794822 326
124 3300013308 Ga0157375_10379750 Ga0157375_103797502 326
125 3300013308 Ga0157375_10609867 Ga0157375_106098671 326
126 3300013308 Ga0157375_10653936 Ga0157375_106539362 326
127 3300014325 Ga0163163_10042380 Ga0163163_100423802 326
128 3300014745 Ga0157377_10246613 Ga0157377_102466131 326
129 3300025898 Ga0207692_10002059 Ga0207692_100020597 326
130 3300025903 Ga0207680_10221264 Ga0207680_102212642 326
131 3300025904 Ga0207647_10008055 Ga0207647_100080554 326
132 3300025916 Ga0207663_10303473 Ga0207663_103034732 326
133 3300025924 Ga0207694_10056801 Ga0207694_100568013 326
134 3300025928 Ga0207700_10138172 Ga0207700_101381722 326
135 3300025940 Ga0207691_10422097 Ga0207691_104220972 326
136 3300025941 Ga0207711_10014438 Ga0207711_100144383 326
137 3300025941 Ga0207711_10097741 Ga0207711_100977412 326
138 3300025941 Ga0207711_10118640 Ga0207711_101186402 326
139 3300025945 Ga0207679_10058497 Ga0207679_100584973 326
140 3300025945 Ga0207679_10304994 Ga0207679_103049942 326
141 3300025972 Ga0207668_10001462 Ga0207668_100014627 326
142 3300025972 Ga0207668_10019359 Ga0207668_100193592 326
143 3300025972 Ga0207668_10137802 Ga0207668_101378022 326
144 3300026023 Ga0207677_10119934 Ga0207677_101199342 326
145 3300026067 Ga0207678_10000283 Ga0207678_1000028342 326
146 3300026067 Ga0207678_10394142 Ga0207678_103941422 326
147 3300026095 Ga0207676_10103813 Ga0207676_101038133 326
148 3300026116 Ga0207674_10024678 Ga0207674_100246784 326
149 3300026142 Ga0207698_10021945 Ga0207698_100219453 326
150 3300028379 Ga0268266_10069373 Ga0268266_100693732 326
151 3300028379 Ga0268266_10234506 Ga0268266_102345062 326
152 3300028794 Ga0307515_10000044 Ga0307515_10000044219 326
153 3300028794 Ga0307515_10104943 Ga0307515_101049432 326
154 3300028794 Ga0307515_10262737 Ga0307515_102627371 326
155 3300030521 Ga0307511_10000690 Ga0307511_1000069020 326
156 3300030522 Ga0307512_10006028 Ga0307512_100060283 326
157 3300030522 Ga0307512_10182523 Ga0307512_101825231 326
158 3300030731 Ga0316177_1038656 Ga0316177_10386561 326
159 3300030733 Ga0314311_1250668 Ga0314311_12506686 326
160 3300030736 Ga0316180_1182021 Ga0316180_11820212 326
161 3300031456 Ga0307513_10009159 Ga0307513_1000915910 326
162 3300031456 Ga0307513_10009872 Ga0307513_1000987211 326
163 3300031507 Ga0307509_10004174 Ga0307509_1000417414 326
164 3300031616 Ga0307508_10003279 Ga0307508_1000327912 326
165 3300031616 Ga0307508_10065068 Ga0307508_100650683 326
166 3300031616 Ga0307508_10202979 Ga0307508_102029792 326
167 3300031730 Ga0307516_10000267 Ga0307516_100002679 326
168 3300031730 Ga0307516_10097631 Ga0307516_100976312 326
169 3300031731 Ga0307405_10012971 Ga0307405_100129712 326
170 3300031995 Ga0307409_100310351 Ga0307409_1003103512 326
171 3300032126 Ga0307415_100249104 Ga0307415_1002491042 326
172 3300033179 Ga0307507_10034188 Ga0307507_100341884 326
173 3300033179 Ga0307507_10051918 Ga0307507_100519183 326
174 3300033180 Ga0307510_10097042 Ga0307510_100970423 326
175 3300033180 Ga0307510_10168311 Ga0307510_101683112 326
176 3300037466 Ga0395898_0014520 Ga0395898_0014520_2672_3652 326
177 3300037471 Ga0395905_0105246 Ga0395905_0105246_836_1816 326
178 3300038443 Ga0395901_0044033 Ga0395901_0044033_856_1836 326
179 3300041451 Ga0451791_0256774 Ga0451791_0256774_609_1589 326
180 3300041453 Ga0451797_0655792 Ga0451797_0655792_316_1296 326
181 3300041512 Ga0451853_0016136 Ga0451853_0016136_1465_2445 326
182 3300044656 Ga0466969_0011682 Ga0466969_0011682_298_1278 326
183 3300044656 Ga0466969_0051480 Ga0466969_0051480_594_1574 326
184 3300044658 Ga0466972_0000707 Ga0466972_0000707_13033_14013 326
185 3300044658 Ga0466972_0001294 Ga0466972_0001294_6628_7608 326
186 3300044658 Ga0466972_0025719 Ga0466972_0025719_367_1347 326
187 3300044683 Ga0466965_0003032 Ga0466965_0003032_3518_4498 326
188 3300044683 Ga0466965_0003488 Ga0466965_0003488_2932_3912 326
189 3300044683 Ga0466965_0007797 Ga0466965_0007797_3185_4165 326
190 3300044683 Ga0466965_0018219 Ga0466965_0018219_94_1074 326
191 3300044684 Ga0466966_0013849 Ga0466966_0013849_3568_4548 326
192 3300044693 Ga0466961_0003291 Ga0466961_0003291_1919_2899 326
193 3300044719 Ga0466971_0000275 Ga0466971_0000275_17494_18474 326
194 3300044735 Ga0466968_0031923 Ga0466968_0031923_404_1384 326
195 3300044765 Ga0466970_0008246 Ga0466970_0008246_1956_2936 326
196 3300044901 Ga0466960_0038649 Ga0466960_0038649_319_1299 326
197 3300044901 Ga0466960_0142825 Ga0466960_0142825_124_1104 326
198 3300045049 Ga0466959_0005220 Ga0466959_0005220_3626_4606 326
199 3300045836 Ga0466958_0022343 Ga0466958_0022343_345_1325 326
200 3300045976 Ga0466967_0065014 Ga0466967_0065014_2067_3047 326
201 3300046454 Ga0495592_0077920 Ga0495592_0077920_1359_2339 326
202 3300046455 Ga0495603_0001516 Ga0495603_0001516_5441_6421 326
203 3300046455 Ga0495603_0001913 Ga0495603_0001913_168_1148 326
204 3300046459 Ga0495629_0000414 Ga0495629_0000414_25161_26141 326
205 3300046459 Ga0495629_0003675 Ga0495629_0003675_9772_10752 326
206 3300046460 Ga0495638_0100472 Ga0495638_0100472_304_1284 326
207 3300046460 Ga0495638_0135420 Ga0495638_0135420_319_1299 326
208 3300046462 Ga0495651_0025905 Ga0495651_0025905_1484_2464 326
209 3300046473 Ga0495582_0144177 Ga0495582_0144177_96_1076 326
210 3300046477 Ga0495664_0031352 Ga0495664_0031352_1905_2885 326
211 3300046499 Ga0495594_0000784 Ga0495594_0000784_2376_3356 326
212 3300046514 Ga0495618_0019542 Ga0495618_0019542_1512_2492 326
213 3300046529 Ga0495652_0033654 Ga0495652_0033654_3321_4301 326
214 3300046543 Ga0495645_0036656 Ga0495645_0036656_1362_2342 326
215 3300046557 Ga0495622_0002142 Ga0495622_0002142_308_1288 326
216 3300046683 Ga0495658_0104179 Ga0495658_0104179_309_1289 326
217 3300046689 Ga0495613_0001175 Ga0495613_0001175_10444_11424 326
218 3300046794 Ga0495589_0051444 Ga0495589_0051444_393_1373 326
219 3300046809 Ga0495600_0002785 Ga0495600_0002785_885_1865 326
220 3300047321 Ga0495676_0000473 Ga0495676_0000473_24016_24996 326
221 3300047321 Ga0495676_0000666 Ga0495676_0000666_17238_18218 326
222 3300047323 Ga0495683_0049950 Ga0495683_0049950_593_1573 326
223 3300047673 Ga0495593_0017285 Ga0495593_0017285_1914_2894 326
224 3300048088 Ga0495602_0096694 Ga0495602_0096694_528_1508 326
225 3300048089 Ga0495614_0000363 Ga0495614_0000363_2957_3937 326
226 3300048906 Ga0496103_0142101 Ga0496103_0142101_253_1233 326
227 3300048907 Ga0496104_0001818 Ga0496104_0001818_6340_7320 326
228 3300048907 Ga0496104_0355558 Ga0496104_0355558_207_1187 326
229 3300048908 Ga0496105_0011733 Ga0496105_0011733_1344_2324 326
230 3300048911 Ga0496108_0000007 Ga0496108_0000007_295975_296955 326
231 3300048911 Ga0496108_0053382 Ga0496108_0053382_1241_2221 326
232 3300048911 Ga0496108_0205112 Ga0496108_0205112_509_1489 326
233 3300048912 Ga0496109_0003349 Ga0496109_0003349_10018_10998 326
234 3300048913 Ga0496110_0290962 Ga0496110_0290962_315_1295 326
235 3300048915 Ga0496112_0044334 Ga0496112_0044334_2535_3515 326
236 3300048915 Ga0496112_0090736 Ga0496112_0090736_1243_2223 326
237 3300048916 Ga0496113_0007637 Ga0496113_0007637_3777_4757 326
238 3300048929 Ga0496126_0059368 Ga0496126_0059368_1215_2195 326
239 3300048929 Ga0496126_0075049 Ga0496126_0075049_1206_2186 326
240 3300049823 Ga0501044_0451594 Ga0501044_0451594_120_1100 326
241 3300053077 Ga0495601_0007160 Ga0495601_0007160_435_1415 326
242 3300053077 Ga0495601_0099685 Ga0495601_0099685_754_1734 326
243 3300053078 Ga0495612_0004735 Ga0495612_0004735_3543_4523 326
244 3300053085 Ga0495619_0060447 Ga0495619_0060447_500_1480 326
245 3300053088 Ga0500644_0010457 Ga0500644_0010457_375_1355 326
246 3300053090 Ga0500646_0000222 Ga0500646_0000222_5480_6460 326
247 3300053153 Ga0500616_0001667 Ga0500616_0001667_1344_2324 326
248 3300013105 Ga0157369_10050301 Ga0157369_100503013 327
249 3300031731 Ga0307405_10085391 Ga0307405_100853912 327
250 3300032002 Ga0307416_100295244 Ga0307416_1002952442 327
251 3300032126 Ga0307415_100088838 Ga0307415_1000888382 327
252 3300048920 Ga0496117_0088659 Ga0496117_0088659_256_1239 327
253 iso_pu_bacteria 2946080515 2946082594 327
254 3300044901 Ga0466960_0004642 Ga0466960_0004642_461_1453 330
255 3300006051 Ga0075364_10006348 Ga0075364_100063483 331
256 3300013105 Ga0157369_10420159 Ga0157369_104201592 331
257 3300037466 Ga0395898_0062084 Ga0395898_0062084_2595_3590 331
258 3300050491 nmdc:mga00v17_4714_c1 nmdc:mga00v17_4714_c1_4433_5428 331
259 3300009036 Ga0105244_10054805 Ga0105244_100548052 350
260 iso_pu_bacteria 2643221542 2643734367 351
261 iso_pu_bacteria 2643221630 2644172483 351
262 iso_pu_bacteria 2852663356 2852666440 351
263 iso_pu_bacteria 8004182704 8004183090 351
264 3300048917 Ga0496114_0147584 Ga0496114_0147584_68_1132 354
265 3300048918 Ga0496115_0095324 Ga0496115_0095324_1069_2133 354
266 3300009036 Ga0105244_10049118 Ga0105244_100491182 355
267 3300009148 Ga0105243_10006417 Ga0105243_100064176 355
268 3300025246 Ga0209646_1000085 Ga0209646_1000085173 355
269 3300025728 Ga0207655_1006431 Ga0207655_10064316 355
270 3300025935 Ga0207709_10003818 Ga0207709_100038185 355
271 3300048920 Ga0496117_0000668 Ga0496117_0000668_3471_4559 355
272 3300048923 Ga0496120_0012295 Ga0496120_0012295_3564_4694 355
273 3300048928 Ga0496125_0003267 Ga0496125_0003267_7099_8187 355
274 3300049823 Ga0501044_0318587 Ga0501044_0318587_247_1317 356
275 3300025272 Ga0209455_1000867 Ga0209455_10008674 357
276 3300044901 Ga0466960_0003189 Ga0466960_0003189_2671_3768 365
277 3300045836 Ga0466958_0078133 Ga0466958_0078133_615_1712 365
278 3300001979 JGI24740J21852_10001713 JGI24740J21852_100017132 367
279 3300013102 Ga0157371_10036336 Ga0157371_100363364 367
280 3300044765 Ga0466970_0000085 Ga0466970_0000085_4735_5838 367
281 3300044842 Ga0466957_0097252 Ga0466957_0097252_244_1347 367
282 3300045976 Ga0466967_0141365 Ga0466967_0141365_248_1351 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

107

313

0.98

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

107

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8509 135 359
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8276 135 359
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8182 135 359
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.796 135 359
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7617 135 351
ID Description Score Start End Superfamily
af_P9WFZ7_89_318_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9315 135 356 1.10.3720.10
af_P0AGH3_48_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9266 114 360 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9136 128 361 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9081 131 359 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9071 134 359 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A175J7T6-F1-model_v4 deleted 0.9515 150 366
AF-K0VC72-F1-model_v4 ABC transporter permease 0.941 155 365 GO:0005886
GO:0055085
AF-A0A7W0TV46-F1-model_v4 ABC transporter permease 0.9396 132 361 GO:0005886
GO:0071916
AF-A0A2W4K9Q3-F1-model_v4 Peptide ABC transporter permease 0.9393 112 363 GO:0005886
GO:0055085
AF-A0A847ADY8-F1-model_v4 ABC transporter permease 0.9384 141 361 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
76.61 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map