F385075

General Info

Members Datasets Scaffolds Average Seq Length
282 181 564 199

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0007513|Ga0395900_0007513_8376_9032
Length 218
Sequence MKIVSIATYCKVRAMTGLWWALGGYLAGSIPFAVLVSRVMRLPDPRSYGSGNIGATNVLRSGNRRAALFTLLGDAMKGWAVVLAARAAGMPEDIVALAGAAAFAGHVFPVWLRFRGGKGVATAAGVLIAFDWRLGCGVLAVWLAVAVLTRYSSLAALVAAVAAPVVAWYLHGTGPLFAATLAMALVLIGRHHANIRKLLRGEESRIGGRKAPQSRAEP

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 1.42
Rhizosphere 96.81
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0007513 3300037418 Bacteria 11262
2 Ga0070658_10009395 3300005327 Bacteria 7855
3 Ga0070658_10058779 3300005327 Bacteria 3131
4 Ga0070658_10217927 3300005327 Bacteria 1613
5 Ga0070658_10287366 3300005327 Bacteria 1401
6 Ga0070676_10061286 3300005328 Bacteria 2236
7 Ga0070690_100415634 3300005330 Bacteria 991
8 Ga0070670_100770660 3300005331 Bacteria 867
9 Ga0068869_100235622 3300005334 Bacteria 1456
10 Ga0070680_100038838 3300005336 Bacteria 3851
11 Ga0068868_100066356 3300005338 Bacteria 2869
12 Ga0068868_100160753 3300005338 Bacteria 1855
13 Ga0070660_100127537 3300005339 Bacteria 2034
14 Ga0070660_100679333 3300005339 Bacteria 863
15 Ga0070660_100791837 3300005339 Unclassified 797
16 Ga0070689_100009947 3300005340 Bacteria 6766
17 Ga0070689_100138030 3300005340 Bacteria 1959
18 Ga0070661_100448731 3300005344 Bacteria 1026
19 Ga0070692_10030016 3300005345 Bacteria 2715
20 Ga0070669_100105902 3300005353 Bacteria 2128
21 Ga0070675_100015082 3300005354 Bacteria 6103
22 Ga0070675_100188274 3300005354 Bacteria 1787
23 Ga0070671_100337558 3300005355 Bacteria 1285
24 Ga0070671_101174680 3300005355 Bacteria 675
25 Ga0070674_100445438 3300005356 Bacteria 1068
26 Ga0070673_100107840 3300005364 Bacteria 2304
27 Ga0070688_100053730 3300005365 Bacteria 2521
28 Ga0070659_100082244 3300005366 Bacteria 2573
29 Ga0070659_100261848 3300005366 Bacteria 1435
30 Ga0070659_100500864 3300005366 Bacteria 1035
31 Ga0070667_100535198 3300005367 Bacteria 1076
32 Ga0070709_10055030 3300005434 Bacteria 2511
33 Ga0070714_100958277 3300005435 Unclassified 832
34 Ga0070713_100024615 3300005436 Bacteria 4692
35 Ga0070710_10179663 3300005437 Bacteria 1324
36 Ga0070710_10223443 3300005437 Bacteria 1199
37 Ga0070711_100078128 3300005439 Bacteria 2351
38 Ga0070700_100733933 3300005441 Bacteria 789
39 Ga0070708_100716735 3300005445 Bacteria 941
40 Ga0070678_100054072 3300005456 Bacteria 2923
41 Ga0070678_100472746 3300005456 Bacteria 1102
42 Ga0070681_10000270 3300005458 Bacteria 41405
43 Ga0070681_10007545 3300005458 Bacteria 10628
44 Ga0070681_10007777 3300005458 Bacteria 10479
45 Ga0070681_10043451 3300005458 Bacteria 4503
46 Ga0068867_100525439 3300005459 Bacteria 1021
47 Ga0070685_10033385 3300005466 Bacteria 2891
48 Ga0070698_100510710 3300005471 Bacteria 1140
49 Ga0070698_100561466 3300005471 Bacteria 1081
50 Ga0070679_100021353 3300005530 Bacteria 6319
51 Ga0070679_100111524 3300005530 Bacteria 2722
52 Ga0070679_100502162 3300005530 Bacteria 1157
53 Ga0070679_100595005 3300005530 Bacteria 1049
54 Ga0068853_100034390 3300005539 Bacteria 4302
55 Ga0068853_100099621 3300005539 Bacteria 2568
56 Ga0068853_100551465 3300005539 Bacteria 1092
57 Ga0068853_101114327 3300005539 Bacteria 761
58 Ga0070672_100027632 3300005543 Bacteria 4234
59 Ga0070686_100204359 3300005544 Bacteria 1418
60 Ga0070686_100254698 3300005544 Bacteria 1284
61 Ga0070695_100344753 3300005545 Bacteria 1114
62 Ga0070695_100536172 3300005545 Bacteria 910
63 Ga0070693_100002462 3300005547 Bacteria 8531
64 Ga0070693_100053776 3300005547 Bacteria 2313
65 Ga0070693_100128026 3300005547 Bacteria 1583
66 Ga0070693_100323348 3300005547 Bacteria 1047
67 Ga0070693_100378352 3300005547 Bacteria 976
68 Ga0070704_100264336 3300005549 Bacteria 1419
69 Ga0068855_100070399 3300005563 Bacteria 4069
70 Ga0068855_100256489 3300005563 Bacteria 1949
71 Ga0068855_100356973 3300005563 Bacteria 1609
72 Ga0068855_100936275 3300005563 Bacteria 913
73 Ga0070664_100817754 3300005564 Bacteria 872
74 Ga0068857_100052847 3300005577 Bacteria 3604
75 Ga0068857_100422254 3300005577 Bacteria 1243
76 Ga0068857_100497469 3300005577 Bacteria 1144
77 Ga0068854_100559605 3300005578 Bacteria 971
78 Ga0068856_100562367 3300005614 Bacteria 1162
79 Ga0068856_100879750 3300005614 Bacteria 915
80 Ga0070702_100301031 3300005615 Bacteria 1109
81 Ga0068852_100001693 3300005616 Bacteria 15031
82 Ga0068852_100002576 3300005616 Bacteria 12505
83 Ga0068852_100014026 3300005616 Bacteria 6150
84 Ga0068852_100056383 3300005616 Bacteria 3395
85 Ga0068859_100034487 3300005617 Bacteria 5079
86 Ga0068859_100877901 3300005617 Bacteria 982
87 Ga0068864_100392849 3300005618 Bacteria 1317
88 Ga0068861_100063881 3300005719 Bacteria 2831
89 Ga0068851_10003769 3300005834 Bacteria 6780
90 Ga0081539_10119098 3300005985 Bacteria 1314
91 Ga0075364_10239931 3300006051 Bacteria 1231
92 Ga0070715_10008322 3300006163 Bacteria 3611
93 Ga0070716_100540376 3300006173 Bacteria 867
94 Ga0070712_100035797 3300006175 Bacteria 3372
95 Ga0070712_100632376 3300006175 Bacteria 908
96 Ga0075366_10001868 3300006195 Bacteria 10618
97 Ga0075366_10263104 3300006195 Bacteria 1053
98 Ga0097621_100065680 3300006237 Bacteria 2987
99 Ga0097621_100177650 3300006237 Bacteria 1838
100 Ga0097621_100492908 3300006237 Bacteria 1109
101 Ga0097621_100625094 3300006237 Bacteria 986
102 Ga0097621_101032883 3300006237 Bacteria 770
103 Ga0075370_10126488 3300006353 Bacteria 1490
104 Ga0068871_100007189 3300006358 Bacteria 7942
105 Ga0068871_100039459 3300006358 Bacteria 3778
106 Ga0068871_100607108 3300006358 Bacteria 995
107 Ga0075434_100071022 3300006871 Bacteria 3473
108 Ga0075429_100153768 3300006880 Bacteria 2014
109 Ga0075436_100066858 3300006914 Bacteria 2484
110 Ga0097620_100034488 3300006931 Bacteria 5079
111 Ga0097620_100878094 3300006931 Bacteria 982
112 Ga0075435_100323197 3300007076 Bacteria 1321
113 Ga0075435_100593199 3300007076 Bacteria 960
114 Ga0075435_100634706 3300007076 Bacteria 927
115 Ga0105240_10011927 3300009093 Bacteria 12051
116 Ga0105240_10087337 3300009093 Bacteria 3819
117 Ga0105240_10417227 3300009093 Bacteria 1509
118 Ga0105240_10821350 3300009093 Bacteria 1006
119 Ga0111539_10023233 3300009094 Bacteria 7617
120 Ga0105245_10013263 3300009098 Bacteria 7181
121 Ga0105245_10180200 3300009098 Bacteria 2018
122 Ga0105245_10230475 3300009098 Unclassified 1791
123 Ga0105245_10240439 3300009098 Bacteria 1755
124 Ga0114129_10082625 3300009147 Bacteria 4463
125 Ga0105241_10024991 3300009174 Bacteria 4438
126 Ga0105248_10028835 3300009177 Bacteria 6186
127 Ga0105248_10088860 3300009177 Bacteria 3478
128 Ga0105238_10011432 3300009551 Bacteria 8941
129 Ga0105238_10165386 3300009551 Bacteria 2188
130 Ga0105238_10291292 3300009551 Bacteria 1615
131 Ga0105249_10541536 3300009553 Bacteria 1214
132 Ga0105239_10042054 3300010375 Bacteria 5007
133 Ga0157371_10356027 3300013102 Bacteria 1066
134 Ga0157370_10002793 3300013104 Bacteria 20861
135 Ga0157370_10153887 3300013104 Bacteria 2140
136 Ga0157369_10003646 3300013105 Bacteria 18271
137 Ga0157369_10648644 3300013105 Bacteria 1089
138 Ga0157374_10250511 3300013296 Bacteria 1743
139 Ga0157378_10278059 3300013297 Bacteria 1613
140 Ga0163162_10367500 3300013306 Bacteria 1572
141 Ga0157372_10012965 3300013307 Bacteria 8890
142 Ga0157372_10997881 3300013307 Bacteria 970
143 Ga0157375_10131270 3300013308 Bacteria 2624
144 Ga0157377_10014705 3300014745 Bacteria 3987
145 Ga0157376_10367258 3300014969 Bacteria 1382
146 Ga0207656_10002453 3300025321 Bacteria 6255
147 Ga0207692_10266983 3300025898 Bacteria 1031
148 Ga0207688_10170250 3300025901 Bacteria 1295
149 Ga0207685_10045476 3300025905 Bacteria 1665
150 Ga0207699_10028894 3300025906 Bacteria 3087
151 Ga0207645_10263673 3300025907 Bacteria 1142
152 Ga0207705_10009680 3300025909 Bacteria 7009
153 Ga0207705_10159542 3300025909 Bacteria 1694
154 Ga0207705_10287952 3300025909 Bacteria 1258
155 Ga0207707_10009641 3300025912 Bacteria 8377
156 Ga0207707_10077057 3300025912 Bacteria 2910
157 Ga0207707_10528373 3300025912 Bacteria 1004
158 Ga0207695_10100440 3300025913 Bacteria 2889
159 Ga0207693_10147678 3300025915 Bacteria 1849
160 Ga0207663_10089258 3300025916 Bacteria 2041
161 Ga0207660_10140793 3300025917 Bacteria 1844
162 Ga0207662_10047661 3300025918 Bacteria 2538
163 Ga0207662_10579309 3300025918 Bacteria 779
164 Ga0207657_10142426 3300025919 Bacteria 1958
165 Ga0207657_10313672 3300025919 Bacteria 1241
166 Ga0207657_10330612 3300025919 Bacteria 1204
167 Ga0207649_10391408 3300025920 Bacteria 1038
168 Ga0207652_10028250 3300025921 Bacteria 4679
169 Ga0207652_10257243 3300025921 Bacteria 1575
170 Ga0207652_10518074 3300025921 Bacteria 1073
171 Ga0207652_10654949 3300025921 Bacteria 939
172 Ga0207681_10225017 3300025923 Bacteria 1453
173 Ga0207694_10032592 3300025924 Bacteria 3989
174 Ga0207694_10151895 3300025924 Bacteria 1866
175 Ga0207650_10415318 3300025925 Bacteria 1116
176 Ga0207659_10011501 3300025926 Bacteria 5592
177 Ga0207659_10187429 3300025926 Bacteria 1644
178 Ga0207687_10325685 3300025927 Bacteria 1245
179 Ga0207644_10122749 3300025931 Bacteria 1980
180 Ga0207644_10127553 3300025931 Bacteria 1944
181 Ga0207690_10161869 3300025932 Bacteria 1669
182 Ga0207690_10209142 3300025932 Bacteria 1486
183 Ga0207706_10226579 3300025933 Bacteria 1636
184 Ga0207670_10009683 3300025936 Bacteria 5511
185 Ga0207670_10011676 3300025936 Bacteria 5110
186 Ga0207669_10532310 3300025937 Bacteria 945
187 Ga0207704_10289102 3300025938 Bacteria 1250
188 Ga0207665_10327721 3300025939 Bacteria 1151
189 Ga0207691_10037429 3300025940 Bacteria 4493
190 Ga0207691_10300445 3300025940 Bacteria 1379
191 Ga0207711_10074257 3300025941 Bacteria 2957
192 Ga0207689_10067441 3300025942 Bacteria 2940
193 Ga0207679_10595012 3300025945 Bacteria 996
194 Ga0207667_10035404 3300025949 Bacteria 5355
195 Ga0207667_10045073 3300025949 Bacteria 4671
196 Ga0207667_10415044 3300025949 Bacteria 1370
197 Ga0207667_10583444 3300025949 Bacteria 1128
198 Ga0207651_10124756 3300025960 Bacteria 1960
199 Ga0207651_10205648 3300025960 Bacteria 1581
200 Ga0207712_10515971 3300025961 Bacteria 1023
201 Ga0207677_10043888 3300026023 Bacteria 2975
202 Ga0207639_10029738 3300026041 Bacteria 4003
203 Ga0207639_10773924 3300026041 Bacteria 893
204 Ga0207708_10401039 3300026075 Bacteria 1134
205 Ga0207702_10225130 3300026078 Bacteria 1750
206 Ga0207702_10571483 3300026078 Bacteria 1107
207 Ga0207648_10344354 3300026089 Bacteria 1343
208 Ga0207648_10712556 3300026089 Bacteria 930
209 Ga0207674_10029635 3300026116 Bacteria 5761
210 Ga0207674_10265547 3300026116 Bacteria 1664
211 Ga0207674_10299651 3300026116 Bacteria 1557
212 Ga0207675_100172693 3300026118 Bacteria 2067
213 Ga0207683_10073658 3300026121 Bacteria 3021
214 Ga0207683_10100379 3300026121 Bacteria 2584
215 Ga0207698_10008342 3300026142 Bacteria 6544
216 Ga0207698_10100008 3300026142 Bacteria 2400
217 Ga0207698_10231557 3300026142 Bacteria 1677
218 Ga0207698_10402103 3300026142 Bacteria 1309
219 Ga0209966_1114004 3300027695 Bacteria 617
220 Ga0268266_10819330 3300028379 Bacteria 899
221 Ga0265316_10446466 3300031344 Bacteria 928
222 Ga0265314_10194320 3300031711 Bacteria 1205
223 Ga0373944_0150824 3300035089 Bacteria 819
224 Ga0373960_0017898 3300035121 Bacteria 1841
225 Ga0373931_0189899 3300035691 Bacteria 1222
226 Ga0373947_0217778 3300035725 Bacteria 1254
227 Ga0395901_0054804 3300038443 Bacteria 4145
228 Ga0436360_0151715 3300039438 Bacteria 1551
229 Ga0466969_0263016 3300044656 Bacteria 782
230 Ga0466966_0101275 3300044684 Bacteria 1781
231 Ga0466961_0281344 3300044693 Unclassified 1018
232 Ga0466957_0005100 3300044842 Bacteria 7343
233 Ga0466959_0026374 3300045049 Bacteria 4307
234 Ga0466959_0132540 3300045049 Bacteria 1766
235 Ga0451576_0013434 3300045051 Bacteria 9162
236 Ga0451576_0021720 3300045051 Bacteria 6970
237 Ga0451576_0022948 3300045051 Bacteria 6762
238 Ga0451576_1118841 3300045051 Bacteria 824
239 Ga0466958_0026681 3300045836 Bacteria 3414
240 Ga0466967_0777815 3300045976 Bacteria 950
241 Ga0495621_0004888 3300046539 Bacteria 3805
242 Ga0495669_0016911 3300046684 Bacteria 3128
243 Ga0496104_0045509 3300048907 Bacteria 4128
244 Ga0496105_0109299 3300048908 Bacteria 2283
245 Ga0496110_0008129 3300048913 Bacteria 8428
246 Ga0496111_0079059 3300048914 Bacteria 2399
247 Ga0501291_059662 3300049514 Bacteria 715
248 Ga0501036_0232456 3300049572 Bacteria 1547
249 Ga0501038_0240989 3300049574 Bacteria 1436
250 Ga0501046_0078700 3300049580 Bacteria 2550
251 Ga0501047_0003646 3300049581 Bacteria 14511
252 Ga0501048_0069094 3300049582 Bacteria 2495
253 Ga0501067_0017552 3300049583 Bacteria 3961
254 Ga0501068_0041193 3300049584 Bacteria 2775
255 Ga0501069_0001042 3300049585 Bacteria 13254
256 Ga0501070_0000609 3300049586 Bacteria 32789
257 Ga0501072_0171697 3300049588 Bacteria 1730
258 Ga0501073_0002393 3300049589 Bacteria 14036
259 Ga0501074_0000574 3300049590 Bacteria 22747
260 Ga0501075_0025869 3300049591 Bacteria 4314
261 Ga0501079_0001634 3300049741 Bacteria 15962
262 Ga0501080_0007919 3300049742 Bacteria 9625
263 Ga0501080_0207764 3300049742 Bacteria 1795
264 Ga0501083_0004566 3300049744 Bacteria 9778
265 Ga0501035_0077089 3300049822 Bacteria 2946
266 Ga0501035_0340122 3300049822 Bacteria 1258
267 Ga0501044_0156156 3300049823 Bacteria 2261
268 nmdc:mga0k408_9697_c1 3300050493 Bacteria 5199
269 nmdc:mga05p37_499757_c1 3300050507 Bacteria 1396
270 nmdc:mga09592_540125_c1 3300050508 Bacteria 1002
271 nmdc:mga06r32_376974_c1 3300050510 Bacteria 1402
272 nmdc:mga08y16_294124_c1 3300050511 Bacteria 1674
273 nmdc:mga0rr50_193044_c1 3300050513 Bacteria 1670
274 nmdc:mga0rr50_439399_c1 3300050513 Bacteria 1105
275 nmdc:mga0rr50_698362_c1 3300050513 Bacteria 866
276 nmdc:mga08x19_957_c1 3300050514 Bacteria 18098
277 nmdc:mga0a205_51187_c1 3300050515 Bacteria 3986
278 nmdc:mga0a205_547430_c1 3300050515 Bacteria 1012
279 Ga0501084_0310019 3300054114 Bacteria 1333
280 Ga0501084_0452931 3300054114 Bacteria 1085
281 Ga0501082_0013061 3300060353 Bacteria 7138
282 Ga0530510_0010359 3300061734 Bacteria 6535
283 Ga0395900_0007513
284 Ga0070658_10009395
285 Ga0070658_10058779
286 Ga0070658_10217927
287 Ga0070658_10287366
288 Ga0070676_10061286
289 Ga0070690_100415634
290 Ga0070670_100770660
291 Ga0068869_100235622
292 Ga0070680_100038838
293 Ga0068868_100066356
294 Ga0068868_100160753
295 Ga0070660_100127537
296 Ga0070660_100679333
297 Ga0070660_100791837
298 Ga0070689_100009947
299 Ga0070689_100138030
300 Ga0070661_100448731
301 Ga0070692_10030016
302 Ga0070669_100105902
303 Ga0070675_100015082
304 Ga0070675_100188274
305 Ga0070671_100337558
306 Ga0070671_101174680
307 Ga0070674_100445438
308 Ga0070673_100107840
309 Ga0070688_100053730
310 Ga0070659_100082244
311 Ga0070659_100261848
312 Ga0070659_100500864
313 Ga0070667_100535198
314 Ga0070709_10055030
315 Ga0070714_100958277
316 Ga0070713_100024615
317 Ga0070710_10179663
318 Ga0070710_10223443
319 Ga0070711_100078128
320 Ga0070700_100733933
321 Ga0070708_100716735
322 Ga0070678_100054072
323 Ga0070678_100472746
324 Ga0070681_10000270
325 Ga0070681_10007545
326 Ga0070681_10007777
327 Ga0070681_10043451
328 Ga0068867_100525439
329 Ga0070685_10033385
330 Ga0070698_100510710
331 Ga0070698_100561466
332 Ga0070679_100021353
333 Ga0070679_100111524
334 Ga0070679_100502162
335 Ga0070679_100595005
336 Ga0068853_100034390
337 Ga0068853_100099621
338 Ga0068853_100551465
339 Ga0068853_101114327
340 Ga0070672_100027632
341 Ga0070686_100204359
342 Ga0070686_100254698
343 Ga0070695_100344753
344 Ga0070695_100536172
345 Ga0070693_100002462
346 Ga0070693_100053776
347 Ga0070693_100128026
348 Ga0070693_100323348
349 Ga0070693_100378352
350 Ga0070704_100264336
351 Ga0068855_100070399
352 Ga0068855_100256489
353 Ga0068855_100356973
354 Ga0068855_100936275
355 Ga0070664_100817754
356 Ga0068857_100052847
357 Ga0068857_100422254
358 Ga0068857_100497469
359 Ga0068854_100559605
360 Ga0068856_100562367
361 Ga0068856_100879750
362 Ga0070702_100301031
363 Ga0068852_100001693
364 Ga0068852_100002576
365 Ga0068852_100014026
366 Ga0068852_100056383
367 Ga0068859_100034487
368 Ga0068859_100877901
369 Ga0068864_100392849
370 Ga0068861_100063881
371 Ga0068851_10003769
372 Ga0081539_10119098
373 Ga0075364_10239931
374 Ga0070715_10008322
375 Ga0070716_100540376
376 Ga0070712_100035797
377 Ga0070712_100632376
378 Ga0075366_10001868
379 Ga0075366_10263104
380 Ga0097621_100065680
381 Ga0097621_100177650
382 Ga0097621_100492908
383 Ga0097621_100625094
384 Ga0097621_101032883
385 Ga0075370_10126488
386 Ga0068871_100007189
387 Ga0068871_100039459
388 Ga0068871_100607108
389 Ga0075434_100071022
390 Ga0075429_100153768
391 Ga0075436_100066858
392 Ga0097620_100034488
393 Ga0097620_100878094
394 Ga0075435_100323197
395 Ga0075435_100593199
396 Ga0075435_100634706
397 Ga0105240_10011927
398 Ga0105240_10087337
399 Ga0105240_10417227
400 Ga0105240_10821350
401 Ga0111539_10023233
402 Ga0105245_10013263
403 Ga0105245_10180200
404 Ga0105245_10230475
405 Ga0105245_10240439
406 Ga0114129_10082625
407 Ga0105241_10024991
408 Ga0105248_10028835
409 Ga0105248_10088860
410 Ga0105238_10011432
411 Ga0105238_10165386
412 Ga0105238_10291292
413 Ga0105249_10541536
414 Ga0105239_10042054
415 Ga0157371_10356027
416 Ga0157370_10002793
417 Ga0157370_10153887
418 Ga0157369_10003646
419 Ga0157369_10648644
420 Ga0157374_10250511
421 Ga0157378_10278059
422 Ga0163162_10367500
423 Ga0157372_10012965
424 Ga0157372_10997881
425 Ga0157375_10131270
426 Ga0157377_10014705
427 Ga0157376_10367258
428 Ga0207656_10002453
429 Ga0207692_10266983
430 Ga0207688_10170250
431 Ga0207685_10045476
432 Ga0207699_10028894
433 Ga0207645_10263673
434 Ga0207705_10009680
435 Ga0207705_10159542
436 Ga0207705_10287952
437 Ga0207707_10009641
438 Ga0207707_10077057
439 Ga0207707_10528373
440 Ga0207695_10100440
441 Ga0207693_10147678
442 Ga0207663_10089258
443 Ga0207660_10140793
444 Ga0207662_10047661
445 Ga0207662_10579309
446 Ga0207657_10142426
447 Ga0207657_10313672
448 Ga0207657_10330612
449 Ga0207649_10391408
450 Ga0207652_10028250
451 Ga0207652_10257243
452 Ga0207652_10518074
453 Ga0207652_10654949
454 Ga0207681_10225017
455 Ga0207694_10032592
456 Ga0207694_10151895
457 Ga0207650_10415318
458 Ga0207659_10011501
459 Ga0207659_10187429
460 Ga0207687_10325685
461 Ga0207644_10122749
462 Ga0207644_10127553
463 Ga0207690_10161869
464 Ga0207690_10209142
465 Ga0207706_10226579
466 Ga0207670_10009683
467 Ga0207670_10011676
468 Ga0207669_10532310
469 Ga0207704_10289102
470 Ga0207665_10327721
471 Ga0207691_10037429
472 Ga0207691_10300445
473 Ga0207711_10074257
474 Ga0207689_10067441
475 Ga0207679_10595012
476 Ga0207667_10035404
477 Ga0207667_10045073
478 Ga0207667_10415044
479 Ga0207667_10583444
480 Ga0207651_10124756
481 Ga0207651_10205648
482 Ga0207712_10515971
483 Ga0207677_10043888
484 Ga0207639_10029738
485 Ga0207639_10773924
486 Ga0207708_10401039
487 Ga0207702_10225130
488 Ga0207702_10571483
489 Ga0207648_10344354
490 Ga0207648_10712556
491 Ga0207674_10029635
492 Ga0207674_10265547
493 Ga0207674_10299651
494 Ga0207675_100172693
495 Ga0207683_10073658
496 Ga0207683_10100379
497 Ga0207698_10008342
498 Ga0207698_10100008
499 Ga0207698_10231557
500 Ga0207698_10402103
501 Ga0209966_1114004
502 Ga0268266_10819330
503 Ga0265316_10446466
504 Ga0265314_10194320
505 Ga0373944_0150824
506 Ga0373960_0017898
507 Ga0373931_0189899
508 Ga0373947_0217778
509 Ga0395901_0054804
510 Ga0436360_0151715
511 Ga0466969_0263016
512 Ga0466966_0101275
513 Ga0466961_0281344
514 Ga0466957_0005100
515 Ga0466959_0026374
516 Ga0466959_0132540
517 Ga0451576_0013434
518 Ga0451576_0021720
519 Ga0451576_0022948
520 Ga0451576_1118841
521 Ga0466958_0026681
522 Ga0466967_0777815
523 Ga0495621_0004888
524 Ga0495669_0016911
525 Ga0496104_0045509
526 Ga0496105_0109299
527 Ga0496110_0008129
528 Ga0496111_0079059
529 Ga0501291_059662
530 Ga0501036_0232456
531 Ga0501038_0240989
532 Ga0501046_0078700
533 Ga0501047_0003646
534 Ga0501048_0069094
535 Ga0501067_0017552
536 Ga0501068_0041193
537 Ga0501069_0001042
538 Ga0501070_0000609
539 Ga0501072_0171697
540 Ga0501073_0002393
541 Ga0501074_0000574
542 Ga0501075_0025869
543 Ga0501079_0001634
544 Ga0501080_0007919
545 Ga0501080_0207764
546 Ga0501083_0004566
547 Ga0501035_0077089
548 Ga0501035_0340122
549 Ga0501044_0156156
550 nmdc:mga0k408_9697_c1
551 nmdc:mga05p37_499757_c1
552 nmdc:mga09592_540125_c1
553 nmdc:mga06r32_376974_c1
554 nmdc:mga08y16_294124_c1
555 nmdc:mga0rr50_193044_c1
556 nmdc:mga0rr50_439399_c1
557 nmdc:mga0rr50_698362_c1
558 nmdc:mga08x19_957_c1
559 nmdc:mga0a205_51187_c1
560 nmdc:mga0a205_547430_c1
561 Ga0501084_0310019
562 Ga0501084_0452931
563 Ga0501082_0013061
564 Ga0530510_0010359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

23

198

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.9095 1 194
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.9039 3 193
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8789 1 194
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.8657 3 193
8cws-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.3746 36 173
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9085 10 183 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.894 10 183 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8934 10 183 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8491 10 183 1.10.1760.20
af_Q58524_918_1130_1.10.3380.30 Mainly Alpha;Orthogonal Bundle;Sec63 N-terminal domain-like fold; 0.4265 42 91 1.10.3380.30
ID Description Score Start End GO Terms
AF-A0A350ZXQ4-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9752 48 193 GO:0005886
GO:0008654
GO:0043772
AF-A0A0F3GZB4-F1-model_v4 Membrane protein containing DUF205 0.9704 49 193 GO:0005886
GO:0008654
GO:0043772
AF-A0A660NJR0-F1-model_v4 Glycerol-3-phosphate 1-O-acyltransferase (EC 2.3.1.15) 0.969 48 193 GO:0004366
GO:0005886
GO:0008654
GO:0043772
AF-A0A1J5S379-F1-model_v4 Putative glycerol-3-phosphate acyltransferase (EC 2.3.1.-, EC 2.3.1.15) 0.9674 1 193 GO:0004366
GO:0005886
GO:0008654
GO:0043772
AF-A0A349A0J2-F1-model_v4 Acyl-phosphate glycerol 3-phosphate acyltransferase 0.9659 60 192 GO:0005886
GO:0008654
GO:0043772

Map