F385055

General Info

Members Datasets Scaffolds Average Seq Length
282 215 564 136

Family's Representative Sequence

Representative Sequence 3300035090|Ga0373949_0000301|Ga0373949_0000301_4646_5110
Length 154
Sequence MFRARLARRTSRDQDRGMTVKLHTGGCLCGALRYQADGDPFGAGYCCCADCRRASGSGFIPYMAFSSSAVRFTGQTRQFRSRSFRGTTTVRNACPACSSLVFGGEVGEAEYFTIYAGSLDDPTLFQPRVAIFVRDRPAWLELPPGLEVFETLPA

Samples

Sample ID Description Type Environment
1 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
119 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
120 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
190 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
191 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
192 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
195 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
196 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
200 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
201 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
209 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
210 2643221584 Caulobacter sp. Root656 Isolate Unclassified
211 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
212 2818991435 Caulobacter henricii 536 Isolate Unclassified
213 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
214 2849560528 Caulobacter zeae 410 Isolate Unclassified
215 2849573788 Caulobacter endophyticus 774 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.18
Nodule 0
Rhizoplane 2.48
Rhizosphere 77.3
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373949_0000301 3300035090 Bacteria 17869
2 JGI24741J21665_1002975 3300001915 Bacteria 4221
3 JGI24740J21852_10006117 3300001979 Bacteria 5025
4 JGI24739J22299_10252667 3300001989 Bacteria 516
5 JGI24737J22298_10013969 3300001990 Bacteria 2610
6 JGI24735J21928_10010570 3300002067 Bacteria 2941
7 JGI24744J21845_10024657 3300002077 Bacteria 1176
8 JGI25153J46596_10000002 3300003215 Bacteria 653569
9 Ga0065165_1000345 3300005262 Bacteria 76072
10 Ga0070658_10001260 3300005327 Bacteria 21674
11 Ga0070660_100299848 3300005339 Bacteria 1317
12 Ga0070660_101056347 3300005339 Bacteria 687
13 Ga0070661_100000201 3300005344 Bacteria 49297
14 Ga0070661_100003477 3300005344 Bacteria 10851
15 Ga0070675_100523557 3300005354 Bacteria 1070
16 Ga0070674_100012970 3300005356 Bacteria 5134
17 Ga0070659_100043206 3300005366 Bacteria 3525
18 Ga0070659_100280691 3300005366 Bacteria 1385
19 Ga0070709_10531005 3300005434 Bacteria 898
20 Ga0070714_100050674 3300005435 Bacteria 3538
21 Ga0070714_101325082 3300005435 Bacteria 703
22 Ga0070713_100504708 3300005436 Bacteria 1142
23 Ga0070713_101018879 3300005436 Unclassified 799
24 Ga0070711_100029636 3300005439 Bacteria 3614
25 Ga0070711_100517143 3300005439 Unclassified 986
26 Ga0070700_100706143 3300005441 Bacteria 802
27 Ga0070678_100009830 3300005456 Bacteria 5815
28 Ga0070662_100377408 3300005457 Bacteria 1166
29 Ga0070681_10280237 3300005458 Bacteria 1578
30 Ga0068867_100290959 3300005459 Bacteria 1343
31 Ga0068867_100829092 3300005459 Bacteria 827
32 Ga0070699_100605505 3300005518 Bacteria 999
33 Ga0068853_100098776 3300005539 Bacteria 2578
34 Ga0070665_100000051 3300005548 Bacteria 249317
35 Ga0068855_100026484 3300005563 Bacteria 6936
36 Ga0068855_100431341 3300005563 Bacteria 1441
37 Ga0068855_100442398 3300005563 Bacteria 1419
38 Ga0070664_100058469 3300005564 Bacteria 3279
39 Ga0068857_100000580 3300005577 Bacteria 26732
40 Ga0068857_101098479 3300005577 Bacteria 768
41 Ga0068854_100085485 3300005578 Bacteria 2336
42 Ga0068856_100004073 3300005614 Bacteria 14620
43 Ga0068856_100725454 3300005614 Unclassified 1014
44 Ga0068856_100749072 3300005614 Unclassified 997
45 Ga0068856_100967994 3300005614 Bacteria 869
46 Ga0068852_100003918 3300005616 Bacteria 10456
47 Ga0068852_100361789 3300005616 Bacteria 1419
48 Ga0068851_10023101 3300005834 Bacteria 3036
49 Ga0068858_100000119 3300005842 Bacteria 82628
50 Ga0081540_1053538 3300005983 Bacteria 1978
51 Ga0070717_10021496 3300006028 Bacteria 5085
52 Ga0070717_10089460 3300006028 Bacteria 2597
53 Ga0070715_10230254 3300006163 Unclassified 958
54 Ga0070716_100039997 3300006173 Bacteria 2606
55 Ga0070712_100001273 3300006175 Bacteria 15215
56 Ga0075366_10061979 3300006195 Bacteria 2224
57 Ga0097621_100029358 3300006237 Bacteria 4342
58 Ga0097621_100629177 3300006237 Bacteria 983
59 Ga0097621_101064718 3300006237 Bacteria 758
60 Ga0075370_10005590 3300006353 Bacteria 6269
61 Ga0068871_100065191 3300006358 Bacteria 2983
62 Ga0075436_100037898 3300006914 Bacteria 3328
63 Ga0075435_100034467 3300007076 Bacteria 4012
64 Ga0105240_10361209 3300009093 Bacteria 1645
65 Ga0105240_11374098 3300009093 Bacteria 743
66 Ga0105245_10001243 3300009098 Bacteria 23002
67 Ga0105243_10000116 3300009148 Bacteria 92035
68 Ga0105243_10161346 3300009148 Bacteria 1933
69 Ga0105243_10822911 3300009148 Bacteria 917
70 Ga0105241_10001879 3300009174 Bacteria 15928
71 Ga0105241_10034297 3300009174 Bacteria 3812
72 Ga0105242_10314112 3300009176 Bacteria 1435
73 Ga0105237_10006778 3300009545 Bacteria 12636
74 Ga0105237_10251877 3300009545 Bacteria 1768
75 Ga0105237_10379404 3300009545 Bacteria 1418
76 Ga0105237_10776717 3300009545 Bacteria 965
77 Ga0105238_10004006 3300009551 Bacteria 14612
78 Ga0105239_10036971 3300010375 Bacteria 5357
79 Ga0105239_12231825 3300010375 Bacteria 637
80 Ga0157324_1047160 3300012506 Unclassified 548
81 Ga0157373_10007111 3300013100 Bacteria 8342
82 Ga0157373_10195538 3300013100 Bacteria 1425
83 Ga0157371_10000030 3300013102 Bacteria 241585
84 Ga0157370_10009324 3300013104 Bacteria 10507
85 Ga0157369_10195931 3300013105 Bacteria 2121
86 Ga0157369_10211056 3300013105 Bacteria 2035
87 Ga0157369_11373903 3300013105 Bacteria 719
88 Ga0157378_10053943 3300013297 Bacteria 3580
89 Ga0163162_10058619 3300013306 Bacteria 3880
90 Ga0157372_10126775 3300013307 Bacteria 2935
91 Ga0157372_10250074 3300013307 Bacteria 2058
92 Ga0157377_10235045 3300014745 Bacteria 1180
93 Ga0157379_10968034 3300014968 Unclassified 810
94 Ga0157376_10760046 3300014969 Bacteria 979
95 Ga0209674_105672 3300025226 Bacteria 1807
96 Ga0209677_109046 3300025253 Bacteria 1838
97 Ga0209673_1068009 3300025273 Bacteria 860
98 Ga0209564_1002796 3300025295 Bacteria 13026
99 Ga0209758_1000001 3300025297 Bacteria 1981790
100 Ga0209758_1006652 3300025297 Bacteria 8178
101 Ga0209050_1012430 3300025298 Bacteria 3903
102 Ga0209256_1015170 3300025299 Bacteria 2714
103 Ga0207680_10017926 3300025903 Bacteria 3750
104 Ga0207647_10001882 3300025904 Bacteria 16072
105 Ga0207699_10025384 3300025906 Bacteria 3252
106 Ga0207699_10170201 3300025906 Bacteria 1457
107 Ga0207699_10178557 3300025906 Bacteria 1425
108 Ga0207705_10834069 3300025909 Bacteria 715
109 Ga0207707_11324602 3300025912 Bacteria 578
110 Ga0207695_10011131 3300025913 Bacteria 10919
111 Ga0207695_10372377 3300025913 Unclassified 1314
112 Ga0207671_10021252 3300025914 Bacteria 4927
113 Ga0207671_10364287 3300025914 Bacteria 1147
114 Ga0207693_10003391 3300025915 Bacteria 13612
115 Ga0207693_10045322 3300025915 Bacteria 3455
116 Ga0207663_10164121 3300025916 Bacteria 1571
117 Ga0207657_10822040 3300025919 Bacteria 718
118 Ga0207649_11629369 3300025920 Unclassified 511
119 Ga0207694_10115284 3300025924 Bacteria 2140
120 Ga0207687_10040896 3300025927 Bacteria 3180
121 Ga0207700_10265212 3300025928 Bacteria 1472
122 Ga0207700_10458287 3300025928 Unclassified 1124
123 Ga0207700_11302726 3300025928 Bacteria 647
124 Ga0207664_10065856 3300025929 Bacteria 2902
125 Ga0207664_11193932 3300025929 Bacteria 679
126 Ga0207690_10607134 3300025932 Bacteria 893
127 Ga0207690_10613190 3300025932 Bacteria 889
128 Ga0207706_10066032 3300025933 Bacteria 3184
129 Ga0207706_11103913 3300025933 Bacteria 663
130 Ga0207709_10000018 3300025935 Bacteria 431545
131 Ga0207709_10262500 3300025935 Bacteria 1267
132 Ga0207669_10001105 3300025937 Bacteria 11530
133 Ga0207669_10169537 3300025937 Bacteria 1552
134 Ga0207711_10627772 3300025941 Unclassified 1002
135 Ga0207667_10010974 3300025949 Bacteria 10559
136 Ga0207667_10439094 3300025949 Bacteria 1327
137 Ga0207703_10000161 3300026035 Bacteria 77310
138 Ga0207639_10009240 3300026041 Bacteria 6795
139 Ga0207702_10004488 3300026078 Bacteria 12386
140 Ga0207702_10106048 3300026078 Bacteria 2489
141 Ga0207648_10050274 3300026089 Bacteria 3645
142 Ga0207648_10695355 3300026089 Bacteria 942
143 Ga0207674_10000904 3300026116 Bacteria 38685
144 Ga0207683_10009803 3300026121 Bacteria 8170
145 Ga0207698_10006647 3300026142 Bacteria 7228
146 Ga0268266_10000002 3300028379 Bacteria 3059047
147 Ga0268266_10778657 3300028379 Bacteria 924
148 Ga0307517_10469730 3300028786 Bacteria 647
149 Ga0307515_10004497 3300028794 Bacteria 28840
150 Ga0265338_10045528 3300028800 Bacteria 4032
151 Ga0265338_10669181 3300028800 Unclassified 718
152 Ga0307513_10094939 3300031456 Bacteria 3025
153 Ga0307509_10102417 3300031507 Bacteria 2895
154 Ga0307509_10336682 3300031507 Bacteria 1238
155 Ga0307508_10000886 3300031616 Bacteria 34890
156 Ga0307508_10022755 3300031616 Bacteria 5697
157 Ga0373934_0015191 3300035086 Bacteria 2919
158 Ga0373953_0009289 3300035117 Bacteria 3376
159 Ga0373956_0244344 3300035119 Unclassified 853
160 Ga0373946_0031991 3300035171 Unclassified 2110
161 Ga0373955_0066357 3300035172 Bacteria 2006
162 Ga0373955_0080751 3300035172 Bacteria 1837
163 Ga0373924_0043513 3300035410 Bacteria 1844
164 Ga0373935_0252313 3300035692 Bacteria 1235
165 Ga0373937_0001576 3300036401 Bacteria 19167
166 Ga0373937_0027825 3300036401 Bacteria 5114
167 Ga0373925_0089554 3300037068 Bacteria 2351
168 Ga0373925_0786727 3300037068 Bacteria 784
169 Ga0395905_0258284 3300037471 Bacteria 1627
170 Ga0451795_1041931 3300041456 Bacteria 1588
171 Ga0451833_0939109 3300041491 Unclassified 595
172 Ga0439437_059302 3300042000 Bacteria 518
173 Ga0439448_0000882 3300042005 Bacteria 7359
174 Ga0439448_0042771 3300042005 Bacteria 1469
175 Ga0439455_0036258 3300042012 Bacteria 1247
176 Ga0439458_0000049 3300042157 Bacteria 19846
177 Ga0439435_0005200 3300042436 Bacteria 2852
178 Ga0466972_0392604 3300044658 Bacteria 650
179 Ga0466957_0075307 3300044842 Bacteria 2094
180 Ga0466958_0022642 3300045836 Bacteria 3683
181 Ga0466967_0042424 3300045976 Bacteria 3931
182 Ga0495638_0015755 3300046460 Bacteria 5065
183 Ga0495651_0279598 3300046462 Bacteria 1128
184 Ga0495653_0365211 3300046463 Bacteria 925
185 Ga0495650_0000262 3300046471 Bacteria 101769
186 Ga0495664_0000587 3300046477 Bacteria 18372
187 Ga0495664_0513373 3300046477 Bacteria 715
188 Ga0495585_0028284 3300046492 Bacteria 3198
189 Ga0495596_0239466 3300046500 Bacteria 704
190 Ga0495607_0028978 3300046501 Bacteria 3410
191 Ga0495606_0012524 3300046507 Bacteria 6792
192 Ga0495606_0038254 3300046507 Bacteria 3248
193 Ga0495608_0008128 3300046511 Bacteria 7369
194 Ga0495616_0113907 3300046513 Bacteria 1254
195 Ga0495632_0001248 3300046519 Bacteria 21576
196 Ga0495643_0002150 3300046522 Bacteria 16201
197 Ga0495643_0122346 3300046522 Bacteria 1313
198 Ga0495643_0249294 3300046522 Bacteria 829
199 Ga0495644_0036381 3300046523 Bacteria 1857
200 Ga0495640_0267335 3300046533 Bacteria 1067
201 Ga0495587_0013534 3300046536 Bacteria 5125
202 Ga0495587_0229688 3300046536 Bacteria 1046
203 Ga0495609_0162957 3300046538 Bacteria 944
204 Ga0495645_0000058 3300046543 Bacteria 80237
205 Ga0495667_0011118 3300046559 Bacteria 6089
206 Ga0495668_0594964 3300046616 Bacteria 611
207 Ga0495625_0201674 3300046660 Bacteria 1312
208 Ga0495599_0075992 3300046678 Bacteria 2098
209 Ga0495623_0060615 3300046679 Bacteria 2374
210 Ga0495646_0057604 3300046680 Bacteria 2325
211 Ga0495671_0062185 3300046692 Bacteria 1840
212 Ga0495649_0000089 3300046694 Bacteria 79134
213 Ga0495600_0067522 3300046809 Unclassified 2337
214 Ga0495660_0225318 3300046810 Bacteria 881
215 Ga0495604_0008201 3300047317 Bacteria 8266
216 Ga0495674_0033994 3300047319 Bacteria 4613
217 Ga0495680_0021678 3300047322 Bacteria 5374
218 Ga0495683_0090348 3300047323 Bacteria 1484
219 Ga0495687_008409 3300047443 Bacteria 5910
220 Ga0495675_0018917 3300047444 Bacteria 4376
221 Ga0495675_0089160 3300047444 Bacteria 1937
222 Ga0495681_0062437 3300047470 Bacteria 1713
223 Ga0495684_0059585 3300047471 Bacteria 2907
224 Ga0495686_0040696 3300047472 Bacteria 2962
225 Ga0495686_0255951 3300047472 Bacteria 982
226 Ga0495602_0000573 3300048088 Bacteria 34229
227 Ga0495602_0138685 3300048088 Unclassified 1928
228 Ga0496100_0221509 3300048903 Unclassified 1389
229 Ga0496101_0122427 3300048904 Bacteria 1967
230 Ga0496105_0012097 3300048908 Bacteria 6834
231 Ga0496109_0791817 3300048912 Bacteria 886
232 Ga0496114_0141202 3300048917 Bacteria 2085
233 Ga0496115_0027034 3300048918 Bacteria 4484
234 Ga0496123_0512984 3300048926 Bacteria 521
235 Ga0496125_0061529 3300048928 Bacteria 3010
236 Ga0496126_0332369 3300048929 Bacteria 1247
237 Ga0501043_0471445 3300049579 Unclassified 941
238 Ga0501046_0151183 3300049580 Bacteria 1751
239 Ga0501238_011096 3300049671 Bacteria 1208
240 nmdc:mga0k408_176462_c1 3300050493 Bacteria 1274
241 nmdc:mga0k408_281875_c1 3300050493 Bacteria 992
242 nmdc:mga07m45_129958_c1 3300050496 Bacteria 1457
243 nmdc:mga07m45_42783_c1 3300050496 Bacteria 2540
244 nmdc:mga07m45_901287_c1 3300050496 Bacteria 506
245 nmdc:mga0rr50_490556_c1 3300050513 Bacteria 1044
246 nmdc:mga08x19_7487_c1 3300050514 Bacteria 6484
247 Ga0495601_0000666 3300053077 Bacteria 18311
248 Ga0495612_0001289 3300053078 Bacteria 10340
249 Ga0495595_0167127 3300053084 Bacteria 1087
250 Ga0495619_0336641 3300053085 Bacteria 1044
251 Ga0500644_0083327 3300053088 Bacteria 1181
252 Ga0500651_0121293 3300053093 Bacteria 1587
253 Ga0500650_0298637 3300053098 Bacteria 713
254 Ga0500654_100317 3300053099 Bacteria 1239
255 Ga0500554_170639 3300053102 Bacteria 733
256 Ga0500555_038210 3300053103 Bacteria 1343
257 Ga0500595_085080 3300053119 Bacteria 922
258 Ga0500597_078340 3300053120 Bacteria 1432
259 Ga0500614_003006 3300053123 Bacteria 3669
260 Ga0500614_012750 3300053123 Bacteria 1839
261 Ga0500652_089654 3300053131 Bacteria 1284
262 Ga0500559_0140521 3300053136 Bacteria 1131
263 Ga0500568_0043041 3300053139 Bacteria 1806
264 Ga0500573_0029580 3300053140 Bacteria 3157
265 Ga0500579_163555 3300053143 Bacteria 930
266 Ga0500603_009029 3300053150 Bacteria 2227
267 Ga0500616_0017154 3300053153 Bacteria 4112
268 Ga0500616_0034778 3300053153 Bacteria 2743
269 Ga0500622_0002912 3300053156 Bacteria 11921
270 Ga0500622_0129154 3300053156 Bacteria 1216
271 Ga0500636_0184018 3300053177 Bacteria 1119
272 Ga0500637_0033154 3300053178 Bacteria 2884
273 Ga0500645_003114 3300053730 Bacteria 6920
274 Ga0466962_0001337 3300061719 Bacteria 11395
275 2585197193 2582581293 Bacteria 5907401
276 2643748116 2643221545 Bacteria 5083237
277 2643930474 2643221584 Bacteria 5511711
278 2644506876 2643221691 Bacteria 5093099
279 2819540225 2818991435 Bacteria 5433759
280 2819649213 2818991454 Bacteria 5563326
281 2849562375 2849560528 Bacteria 5393480
282 2849577478 2849573788 Bacteria 5421256
283 Ga0373949_0000301
284 JGI24741J21665_1002975
285 JGI24740J21852_10006117
286 JGI24739J22299_10252667
287 JGI24737J22298_10013969
288 JGI24735J21928_10010570
289 JGI24744J21845_10024657
290 JGI25153J46596_10000002
291 Ga0065165_1000345
292 Ga0070658_10001260
293 Ga0070660_100299848
294 Ga0070660_101056347
295 Ga0070661_100000201
296 Ga0070661_100003477
297 Ga0070675_100523557
298 Ga0070674_100012970
299 Ga0070659_100043206
300 Ga0070659_100280691
301 Ga0070709_10531005
302 Ga0070714_100050674
303 Ga0070714_101325082
304 Ga0070713_100504708
305 Ga0070713_101018879
306 Ga0070711_100029636
307 Ga0070711_100517143
308 Ga0070700_100706143
309 Ga0070678_100009830
310 Ga0070662_100377408
311 Ga0070681_10280237
312 Ga0068867_100290959
313 Ga0068867_100829092
314 Ga0070699_100605505
315 Ga0068853_100098776
316 Ga0070665_100000051
317 Ga0068855_100026484
318 Ga0068855_100431341
319 Ga0068855_100442398
320 Ga0070664_100058469
321 Ga0068857_100000580
322 Ga0068857_101098479
323 Ga0068854_100085485
324 Ga0068856_100004073
325 Ga0068856_100725454
326 Ga0068856_100749072
327 Ga0068856_100967994
328 Ga0068852_100003918
329 Ga0068852_100361789
330 Ga0068851_10023101
331 Ga0068858_100000119
332 Ga0081540_1053538
333 Ga0070717_10021496
334 Ga0070717_10089460
335 Ga0070715_10230254
336 Ga0070716_100039997
337 Ga0070712_100001273
338 Ga0075366_10061979
339 Ga0097621_100029358
340 Ga0097621_100629177
341 Ga0097621_101064718
342 Ga0075370_10005590
343 Ga0068871_100065191
344 Ga0075436_100037898
345 Ga0075435_100034467
346 Ga0105240_10361209
347 Ga0105240_11374098
348 Ga0105245_10001243
349 Ga0105243_10000116
350 Ga0105243_10161346
351 Ga0105243_10822911
352 Ga0105241_10001879
353 Ga0105241_10034297
354 Ga0105242_10314112
355 Ga0105237_10006778
356 Ga0105237_10251877
357 Ga0105237_10379404
358 Ga0105237_10776717
359 Ga0105238_10004006
360 Ga0105239_10036971
361 Ga0105239_12231825
362 Ga0157324_1047160
363 Ga0157373_10007111
364 Ga0157373_10195538
365 Ga0157371_10000030
366 Ga0157370_10009324
367 Ga0157369_10195931
368 Ga0157369_10211056
369 Ga0157369_11373903
370 Ga0157378_10053943
371 Ga0163162_10058619
372 Ga0157372_10126775
373 Ga0157372_10250074
374 Ga0157377_10235045
375 Ga0157379_10968034
376 Ga0157376_10760046
377 Ga0209674_105672
378 Ga0209677_109046
379 Ga0209673_1068009
380 Ga0209564_1002796
381 Ga0209758_1000001
382 Ga0209758_1006652
383 Ga0209050_1012430
384 Ga0209256_1015170
385 Ga0207680_10017926
386 Ga0207647_10001882
387 Ga0207699_10025384
388 Ga0207699_10170201
389 Ga0207699_10178557
390 Ga0207705_10834069
391 Ga0207707_11324602
392 Ga0207695_10011131
393 Ga0207695_10372377
394 Ga0207671_10021252
395 Ga0207671_10364287
396 Ga0207693_10003391
397 Ga0207693_10045322
398 Ga0207663_10164121
399 Ga0207657_10822040
400 Ga0207649_11629369
401 Ga0207694_10115284
402 Ga0207687_10040896
403 Ga0207700_10265212
404 Ga0207700_10458287
405 Ga0207700_11302726
406 Ga0207664_10065856
407 Ga0207664_11193932
408 Ga0207690_10607134
409 Ga0207690_10613190
410 Ga0207706_10066032
411 Ga0207706_11103913
412 Ga0207709_10000018
413 Ga0207709_10262500
414 Ga0207669_10001105
415 Ga0207669_10169537
416 Ga0207711_10627772
417 Ga0207667_10010974
418 Ga0207667_10439094
419 Ga0207703_10000161
420 Ga0207639_10009240
421 Ga0207702_10004488
422 Ga0207702_10106048
423 Ga0207648_10050274
424 Ga0207648_10695355
425 Ga0207674_10000904
426 Ga0207683_10009803
427 Ga0207698_10006647
428 Ga0268266_10000002
429 Ga0268266_10778657
430 Ga0307517_10469730
431 Ga0307515_10004497
432 Ga0265338_10045528
433 Ga0265338_10669181
434 Ga0307513_10094939
435 Ga0307509_10102417
436 Ga0307509_10336682
437 Ga0307508_10000886
438 Ga0307508_10022755
439 Ga0373934_0015191
440 Ga0373953_0009289
441 Ga0373956_0244344
442 Ga0373946_0031991
443 Ga0373955_0066357
444 Ga0373955_0080751
445 Ga0373924_0043513
446 Ga0373935_0252313
447 Ga0373937_0001576
448 Ga0373937_0027825
449 Ga0373925_0089554
450 Ga0373925_0786727
451 Ga0395905_0258284
452 Ga0451795_1041931
453 Ga0451833_0939109
454 Ga0439437_059302
455 Ga0439448_0000882
456 Ga0439448_0042771
457 Ga0439455_0036258
458 Ga0439458_0000049
459 Ga0439435_0005200
460 Ga0466972_0392604
461 Ga0466957_0075307
462 Ga0466958_0022642
463 Ga0466967_0042424
464 Ga0495638_0015755
465 Ga0495651_0279598
466 Ga0495653_0365211
467 Ga0495650_0000262
468 Ga0495664_0000587
469 Ga0495664_0513373
470 Ga0495585_0028284
471 Ga0495596_0239466
472 Ga0495607_0028978
473 Ga0495606_0012524
474 Ga0495606_0038254
475 Ga0495608_0008128
476 Ga0495616_0113907
477 Ga0495632_0001248
478 Ga0495643_0002150
479 Ga0495643_0122346
480 Ga0495643_0249294
481 Ga0495644_0036381
482 Ga0495640_0267335
483 Ga0495587_0013534
484 Ga0495587_0229688
485 Ga0495609_0162957
486 Ga0495645_0000058
487 Ga0495667_0011118
488 Ga0495668_0594964
489 Ga0495625_0201674
490 Ga0495599_0075992
491 Ga0495623_0060615
492 Ga0495646_0057604
493 Ga0495671_0062185
494 Ga0495649_0000089
495 Ga0495600_0067522
496 Ga0495660_0225318
497 Ga0495604_0008201
498 Ga0495674_0033994
499 Ga0495680_0021678
500 Ga0495683_0090348
501 Ga0495687_008409
502 Ga0495675_0018917
503 Ga0495675_0089160
504 Ga0495681_0062437
505 Ga0495684_0059585
506 Ga0495686_0040696
507 Ga0495686_0255951
508 Ga0495602_0000573
509 Ga0495602_0138685
510 Ga0496100_0221509
511 Ga0496101_0122427
512 Ga0496105_0012097
513 Ga0496109_0791817
514 Ga0496114_0141202
515 Ga0496115_0027034
516 Ga0496123_0512984
517 Ga0496125_0061529
518 Ga0496126_0332369
519 Ga0501043_0471445
520 Ga0501046_0151183
521 Ga0501238_011096
522 nmdc:mga0k408_176462_c1
523 nmdc:mga0k408_281875_c1
524 nmdc:mga07m45_129958_c1
525 nmdc:mga07m45_42783_c1
526 nmdc:mga07m45_901287_c1
527 nmdc:mga0rr50_490556_c1
528 nmdc:mga08x19_7487_c1
529 Ga0495601_0000666
530 Ga0495612_0001289
531 Ga0495595_0167127
532 Ga0495619_0336641
533 Ga0500644_0083327
534 Ga0500651_0121293
535 Ga0500650_0298637
536 Ga0500654_100317
537 Ga0500554_170639
538 Ga0500555_038210
539 Ga0500595_085080
540 Ga0500597_078340
541 Ga0500614_003006
542 Ga0500614_012750
543 Ga0500652_089654
544 Ga0500559_0140521
545 Ga0500568_0043041
546 Ga0500573_0029580
547 Ga0500579_163555
548 Ga0500603_009029
549 Ga0500616_0017154
550 Ga0500616_0034778
551 Ga0500622_0002912
552 Ga0500622_0129154
553 Ga0500636_0184018
554 Ga0500637_0033154
555 Ga0500645_003114
556 Ga0466962_0001337
557 2585197193
558 2643748116
559 2643930474
560 2644506876
561 2819540225
562 2819649213
563 2849562375
564 2849577478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

44

135

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.904 1 135
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.84 1 135
3n1d-assembly1.cif.gz_A crystal structure of the complex of type i ribosome inactivating protein with ribose at 1.7a resolution 0.7961 56 84
3mry-assembly1.cif.gz_A crystal structure of type i ribosome inactivating protein from momordica balsamina with 6-aminopurine at 2.0a resolution 0.7953 56 84
1mrg-assembly1.cif.gz_A studies on crystal structures active center geometry and depurine mechanism of two ribosome-inactivating proteins 0.7881 56 84
ID Description Score Start End Superfamily
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7943 56 84 3.40.420.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7829 2 130 3.90.1590.10
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7532 57 86 3.40.420.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7414 2 130 3.90.1590.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7343 5 102 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A4Y9EKL9-F1-model_v4 GFA family protein 0.9636 2 135 GO:0016846
GO:0046872
AF-A0A4Y9EKL9-F1-model_v4 GFA family protein 0.9498 2 135 GO:0016846
GO:0046872
AF-A0A526S5J8-F1-model_v4 Aldehyde-activating protein 0.9492 1 85 GO:0016846
GO:0046872
AF-A0A3A3G545-F1-model_v4 GFA family protein 0.9473 4 134 GO:0016846
GO:0046872
AF-A0A7W1WHH2-F1-model_v4 GFA family protein 0.9444 2 135 GO:0016846
GO:0046872

Map