F385009

General Info

Members Datasets Scaffolds Average Seq Length
282 178 282 328

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10009101|Ga0207428_100091014
Length 372
Sequence VRRIVSVRFAWQAVHMSEPLAPPSEPDAQASETRGGAASADVLSDVLRSVRLTGAVFFDWAMSSPWVAEAPPASEIAGRVMPGAQRVVEYHLVARGECWGNVVGEPPIRLKAGDLILFPQGDPHVLSSEPGMRAAPDMKLFSRPRTPLPRVGEAGGGGPDRTRLVCCFLGCDERPFNPLLSALPRTIHLSGAGNEATSGWLATLLNIAVRESGSSRAGRDNILARMSELMFVEAVRRYIETLPAAETGWLAGLRDPVVGQGLAALHAEPASPWTVESLARRVGVSRSVLADRFAAMVGQPPIQYLTLWRMQLASRLMLQGESVAAAAGVVGYESEAAFSRAFKKIVGEAPTTWRRAATTAKAYSPRKVHSPL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 2.48
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10004730 3300005293 Bacteria 3619
2 Ga0070658_10026236 3300005327 Bacteria 4674
3 Ga0070670_100003565 3300005331 Bacteria 12942
4 Ga0070670_100088620 3300005331 Bacteria 2660
5 Ga0070670_100154233 3300005331 Bacteria 1989
6 Ga0068869_100045341 3300005334 Bacteria 3165
7 Ga0068868_100367142 3300005338 Bacteria 1236
8 Ga0070692_10027608 3300005345 Bacteria 2815
9 Ga0070668_100001179 3300005347 Bacteria 18500
10 Ga0070668_100048119 3300005347 Bacteria 3279
11 Ga0070668_100179712 3300005347 Bacteria 1728
12 Ga0070669_100047347 3300005353 Bacteria 3136
13 Ga0070667_100001011 3300005367 Bacteria 25767
14 Ga0070714_100078324 3300005435 Bacteria 2872
15 Ga0070714_100279322 3300005435 Unclassified 1551
16 Ga0070714_100580970 3300005435 Unclassified 1075
17 Ga0070700_100000044 3300005441 Bacteria 98346
18 Ga0070700_100269426 3300005441 Bacteria 1230
19 Ga0070694_100050017 3300005444 Bacteria 2816
20 Ga0070678_100006102 3300005456 Bacteria 7034
21 Ga0070678_100229350 3300005456 Unclassified 1547
22 Ga0070681_10013254 3300005458 Bacteria 8191
23 Ga0070706_100000250 3300005467 Bacteria 65288
24 Ga0070706_100003852 3300005467 Bacteria 14657
25 Ga0070699_100001836 3300005518 Bacteria 19270
26 Ga0070697_100263693 3300005536 Bacteria 1475
27 Ga0070696_100049941 3300005546 Unclassified 2907
28 Ga0070693_100020170 3300005547 Unclassified 3511
29 Ga0070665_100019184 3300005548 Bacteria 6860
30 Ga0070665_100069805 3300005548 Bacteria 3521
31 Ga0068855_100043584 3300005563 Bacteria 5314
32 Ga0068856_100129008 3300005614 Bacteria 2533
33 Ga0068856_100288478 3300005614 Bacteria 1658
34 Ga0068859_100004338 3300005617 Bacteria 14463
35 Ga0068859_100011796 3300005617 Bacteria 8780
36 Ga0068859_100027062 3300005617 Bacteria 5752
37 Ga0068864_100206002 3300005618 Bacteria 1809
38 Ga0068861_100022838 3300005719 Bacteria 4510
39 Ga0068861_100023461 3300005719 Bacteria 4450
40 Ga0068861_100380462 3300005719 Bacteria 1247
41 Ga0068870_10023762 3300005840 Bacteria 3026
42 Ga0068858_100294983 3300005842 Bacteria 1546
43 Ga0068860_100000027 3300005843 Bacteria 267207
44 Ga0068860_100003476 3300005843 Bacteria 16214
45 Ga0068862_100006043 3300005844 Bacteria 10080
46 Ga0068862_100014800 3300005844 Bacteria 6480
47 Ga0068862_100063022 3300005844 Bacteria 3190
48 Ga0068862_100079553 3300005844 Bacteria 2841
49 Ga0075369_10047029 3300006186 Bacteria 1860
50 Ga0075366_10070777 3300006195 Bacteria 2078
51 Ga0075428_100003188 3300006844 Bacteria 17938
52 Ga0075428_100017851 3300006844 Bacteria 7840
53 Ga0075430_100002551 3300006846 Bacteria 15188
54 Ga0075431_100065617 3300006847 Bacteria 3748
55 Ga0075431_100139341 3300006847 Bacteria 2501
56 Ga0075433_10175954 3300006852 Bacteria 1904
57 Ga0075429_100089521 3300006880 Bacteria 2683
58 Ga0068865_100193102 3300006881 Bacteria 1576
59 Ga0097620_100004338 3300006931 Bacteria 14463
60 Ga0097620_100011797 3300006931 Bacteria 8780
61 Ga0097620_100027061 3300006931 Bacteria 5752
62 Ga0075435_100101798 3300007076 Bacteria 2381
63 Ga0099795_10025596 3300007788 Bacteria 1980
64 Ga0105240_10078313 3300009093 Bacteria 4071
65 Ga0111539_10279857 3300009094 Bacteria 1941
66 Ga0105247_10067720 3300009101 Bacteria 2225
67 Ga0114129_10014707 3300009147 Bacteria 11147
68 Ga0114129_10020829 3300009147 Bacteria 9314
69 Ga0105241_10280358 3300009174 Bacteria 1423
70 Ga0105248_10020847 3300009177 Bacteria 7262
71 Ga0105237_10120309 3300009545 Bacteria 2620
72 Ga0105237_10195372 3300009545 Bacteria 2023
73 Ga0105238_10005585 3300009551 Bacteria 12425
74 Ga0105249_10006428 3300009553 Bacteria 10216
75 Ga0105249_10085152 3300009553 Bacteria 2945
76 Ga0105239_10033298 3300010375 Bacteria 5660
77 Ga0105239_10226838 3300010375 Bacteria 2096
78 Ga0105246_10366536 3300011119 Bacteria 1186
79 Ga0157378_10000445 3300013297 Bacteria 39758
80 Ga0163162_10084848 3300013306 Bacteria 3243
81 Ga0163162_10154410 3300013306 Bacteria 2414
82 Ga0163163_10040592 3300014325 Bacteria 4545
83 Ga0163163_10736194 3300014325 Bacteria 1049
84 Ga0157380_10007371 3300014326 Bacteria 7810
85 Ga0157379_10052684 3300014968 Bacteria 3635
86 Ga0163161_10029372 3300017792 Bacteria 3909
87 Ga0207643_10063972 3300025908 Bacteria 2105
88 Ga0207705_10244690 3300025909 Bacteria 1367
89 Ga0207684_10000093 3300025910 Bacteria 166136
90 Ga0207707_10112293 3300025912 Bacteria 2382
91 Ga0207707_10203054 3300025912 Bacteria 1728
92 Ga0207693_10021050 3300025915 Bacteria 5182
93 Ga0207646_10161572 3300025922 Bacteria 2022
94 Ga0207694_10019436 3300025924 Bacteria 5134
95 Ga0207650_10038804 3300025925 Bacteria 3480
96 Ga0207650_10040822 3300025925 Bacteria 3397
97 Ga0207659_10055548 3300025926 Bacteria 2833
98 Ga0207664_10109917 3300025929 Bacteria 2291
99 Ga0207706_10140847 3300025933 Bacteria 2122
100 Ga0207704_10233016 3300025938 Bacteria 1370
101 Ga0207691_10066302 3300025940 Bacteria 3266
102 Ga0207667_10029997 3300025949 Bacteria 5890
103 Ga0207712_10071441 3300025961 Bacteria 2496
104 Ga0207712_10283758 3300025961 Bacteria 1352
105 Ga0207668_10015983 3300025972 Bacteria 4675
106 Ga0207668_10033455 3300025972 Bacteria 3405
107 Ga0207658_10081585 3300025986 Bacteria 2480
108 Ga0207677_10062361 3300026023 Bacteria 2586
109 Ga0207678_10409032 3300026067 Bacteria 1175
110 Ga0207708_10000031 3300026075 Bacteria 155478
111 Ga0207708_10083589 3300026075 Bacteria 2454
112 Ga0207702_10204402 3300026078 Bacteria 1833
113 Ga0207675_100015483 3300026118 Bacteria 7112
114 Ga0207675_100119845 3300026118 Bacteria 2489
115 Ga0207683_10012734 3300026121 Bacteria 7178
116 Ga0207698_10014316 3300026142 Bacteria 5269
117 Ga0207428_10009101 3300027907 Bacteria 8927
118 Ga0268266_10181201 3300028379 Bacteria 1918
119 Ga0268266_10420593 3300028379 Bacteria 1266
120 Ga0268265_10004520 3300028380 Bacteria 9629
121 Ga0268265_10007779 3300028380 Bacteria 7236
122 Ga0268265_10173927 3300028380 Bacteria 1843
123 Ga0268265_10437488 3300028380 Bacteria 1218
124 Ga0268264_10000181 3300028381 Bacteria 134092
125 Ga0268264_10094233 3300028381 Bacteria 2588
126 Ga0307408_100013551 3300031548 Bacteria 5412
127 Ga0307408_100051452 3300031548 Unclassified 2967
128 Ga0307405_10011045 3300031731 Bacteria 4713
129 Ga0307413_10021774 3300031824 Bacteria 3440
130 Ga0307410_10272426 3300031852 Unclassified 1325
131 Ga0307406_10002945 3300031901 Bacteria 9271
132 Ga0307409_100069411 3300031995 Bacteria 2792
133 Ga0307409_100071756 3300031995 Bacteria 2755
134 Ga0307414_10002214 3300032004 Bacteria 10135
135 Ga0307411_10046283 3300032005 Unclassified 2803
136 Ga0307415_100008962 3300032126 Bacteria 5579
137 Ga0373950_0000033 3300034818 Bacteria 145634
138 Ga0373934_0040306 3300035086 Bacteria 1842
139 Ga0373932_0116069 3300035112 Unclassified 888
140 Ga0373953_0022142 3300035117 Bacteria 2393
141 Ga0373953_0066762 3300035117 Unclassified 1479
142 Ga0373954_0014993 3300035118 Bacteria 3461
143 Ga0373956_0033455 3300035119 Bacteria 2260
144 Ga0373956_0113071 3300035119 Unclassified 1265
145 Ga0373957_0029628 3300035120 Bacteria 2000
146 Ga0373955_0004557 3300035172 Bacteria 6140
147 Ga0373933_0044336 3300035724 Bacteria 2634
148 Ga0373933_0045759 3300035724 Bacteria 2596
149 Ga0373937_0008623 3300036401 Bacteria 8855
150 Ga0373937_0042004 3300036401 Bacteria 4172
151 Ga0373937_0153538 3300036401 Bacteria 2157
152 Ga0395900_0267807 3300037418 Bacteria 1704
153 Ga0395901_0208172 3300038443 Bacteria 2048
154 Ga0395901_0358803 3300038443 Bacteria 1503
155 Ga0395901_0408239 3300038443 Unclassified 1395
156 Ga0439458_0003126 3300042157 Bacteria 3933
157 Ga0466967_0110821 3300045976 Bacteria 2521
158 Ga0495592_0040564 3300046454 Bacteria 3493
159 Ga0495592_0142557 3300046454 Bacteria 1665
160 Ga0495641_0071979 3300046461 Bacteria 1551
161 Ga0495651_0118695 3300046462 Bacteria 1946
162 Ga0495580_0169425 3300046472 Bacteria 1510
163 Ga0495582_0004933 3300046473 Bacteria 7478
164 Ga0495582_0006289 3300046473 Bacteria 6616
165 Ga0495594_0136971 3300046499 Bacteria 1388
166 Ga0495608_0005669 3300046511 Bacteria 8913
167 Ga0495628_0000913 3300046516 Bacteria 27120
168 Ga0495586_0030735 3300046535 Bacteria 2875
169 Ga0495587_0071020 3300046536 Bacteria 2025
170 Ga0495621_0073890 3300046539 Bacteria 1260
171 Ga0495633_0228987 3300046558 Unclassified 850
172 Ga0495667_0036384 3300046559 Bacteria 3286
173 Ga0495634_0145733 3300046642 Bacteria 1500
174 Ga0495634_0226155 3300046642 Bacteria 1153
175 Ga0495635_0000710 3300046663 Bacteria 21459
176 Ga0495661_0226193 3300046665 Unclassified 967
177 Ga0495657_0033222 3300046675 Bacteria 3593
178 Ga0495599_0058057 3300046678 Bacteria 2421
179 Ga0495658_0000018 3300046683 Bacteria 93319
180 Ga0495613_0044348 3300046689 Bacteria 3290
181 Ga0495613_0126866 3300046689 Bacteria 1829
182 Ga0495581_0000323 3300047315 Bacteria 23616
183 Ga0495680_0001669 3300047322 Bacteria 23602
184 Ga0495680_0020114 3300047322 Bacteria 5624
185 Ga0495680_0051296 3300047322 Bacteria 3222
186 Ga0495614_0015718 3300048089 Bacteria 3297
187 Ga0495614_0059753 3300048089 Bacteria 1638
188 Ga0496104_0086926 3300048907 Bacteria 2985
189 Ga0496106_0086824 3300048909 Bacteria 2410
190 Ga0496108_0043406 3300048911 Bacteria 3756
191 Ga0496109_0025784 3300048912 Bacteria 5240
192 Ga0496110_0126274 3300048913 Bacteria 2308
193 Ga0496112_0313365 3300048915 Bacteria 1514
194 Ga0496112_0414805 3300048915 Bacteria 1286
195 Ga0501034_0000047 3300049571 Bacteria 223793
196 Ga0501036_0025513 3300049572 Bacteria 4987
197 Ga0501036_0034301 3300049572 Bacteria 4293
198 Ga0501036_0071391 3300049572 Bacteria 2936
199 Ga0501036_0085146 3300049572 Bacteria 2672
200 Ga0501037_0033187 3300049573 Bacteria 3813
201 Ga0501037_0154565 3300049573 Bacteria 1638
202 Ga0501038_0232303 3300049574 Bacteria 1467
203 Ga0501039_0017352 3300049575 Bacteria 5521
204 Ga0501039_0103173 3300049575 Bacteria 2226
205 Ga0501040_0028607 3300049576 Bacteria 3758
206 Ga0501040_0163026 3300049576 Bacteria 1576
207 Ga0501040_0191736 3300049576 Unclassified 1450
208 Ga0501041_0009936 3300049577 Bacteria 5606
209 Ga0501041_0025356 3300049577 Bacteria 3563
210 Ga0501042_0066299 3300049578 Bacteria 2581
211 Ga0501042_0067643 3300049578 Bacteria 2554
212 Ga0501043_0001462 3300049579 Bacteria 20652
213 Ga0501043_0488697 3300049579 Unclassified 921
214 Ga0501046_0000717 3300049580 Bacteria 32066
215 Ga0501046_0019416 3300049580 Bacteria 5639
216 Ga0501047_0000034 3300049581 Bacteria 198118
217 Ga0501048_0046576 3300049582 Bacteria 3095
218 Ga0501048_0098671 3300049582 Bacteria 2060
219 Ga0501068_0018327 3300049584 Bacteria 4055
220 Ga0501068_0095692 3300049584 Bacteria 1837
221 Ga0501070_0004503 3300049586 Bacteria 11962
222 Ga0501071_0052320 3300049587 Bacteria 2945
223 Ga0501071_0096297 3300049587 Bacteria 2178
224 Ga0501072_0000010 3300049588 Bacteria 205637
225 Ga0501072_0079841 3300049588 Bacteria 2591
226 Ga0501072_0137339 3300049588 Bacteria 1949
227 Ga0501073_0007609 3300049589 Bacteria 8045
228 Ga0501074_0000678 3300049590 Bacteria 21289
229 Ga0501074_0061620 3300049590 Bacteria 2703
230 Ga0501074_0225910 3300049590 Bacteria 1333
231 Ga0501075_0003341 3300049591 Bacteria 10722
232 Ga0501075_0089342 3300049591 Bacteria 2336
233 Ga0501075_0105589 3300049591 Bacteria 2141
234 Ga0501075_0140029 3300049591 Bacteria 1843
235 Ga0501076_0001566 3300049592 Bacteria 15339
236 Ga0501076_0006344 3300049592 Bacteria 8574
237 Ga0501076_0030895 3300049592 Bacteria 4174
238 Ga0501076_0043660 3300049592 Bacteria 3533
239 Ga0501076_0100389 3300049592 Bacteria 2332
240 Ga0501077_0047104 3300049593 Bacteria 2739
241 Ga0501257_001162 3300049686 Bacteria 5378
242 Ga0501225_0000510 3300049705 Bacteria 12115
243 Ga0501079_0008242 3300049741 Bacteria 7897
244 Ga0501079_0015512 3300049741 Bacteria 5815
245 Ga0501079_0063209 3300049741 Bacteria 2856
246 Ga0501079_0199292 3300049741 Bacteria 1563
247 Ga0501080_0008281 3300049742 Bacteria 9418
248 Ga0501080_0059058 3300049742 Bacteria 3570
249 Ga0501080_0367414 3300049742 Bacteria 1297
250 Ga0501081_0002186 3300049743 Bacteria 12294
251 Ga0501081_0007842 3300049743 Bacteria 6923
252 Ga0501081_0022000 3300049743 Unclassified 4262
253 Ga0501081_0140533 3300049743 Unclassified 1730
254 Ga0501081_0370730 3300049743 Unclassified 1057
255 Ga0501083_0049065 3300049744 Bacteria 2848
256 Ga0501083_0135040 3300049744 Bacteria 1616
257 Ga0501035_0073791 3300049822 Bacteria 3019
258 Ga0501035_0387309 3300049822 Bacteria 1165
259 Ga0501045_0023259 3300049824 Unclassified 4442
260 Ga0501045_0041184 3300049824 Bacteria 3361
261 Ga0501045_0072949 3300049824 Bacteria 2527
262 Ga0501226_000530 3300049853 Bacteria 5293
263 nmdc:mga05p37_6962_c1 3300050507 Bacteria 13324
264 nmdc:mga0qj67_1819_c1 3300050509 Bacteria 15098
265 nmdc:mga0n895_104222_c1 3300050512 Bacteria 2849
266 nmdc:mga0rr50_142355_c1 3300050513 Bacteria 1930
267 nmdc:mga0a205_517532_c1 3300050515 Bacteria 1050
268 Ga0495595_0014082 3300053084 Bacteria 3387
269 Ga0495619_0000898 3300053085 Bacteria 19484
270 Ga0500636_0035623 3300053177 Bacteria 2945
271 Ga0501084_0000080 3300054114 Bacteria 71059
272 Ga0501084_0010327 3300054114 Bacteria 7724
273 Ga0501084_0023831 3300054114 Bacteria 5105
274 Ga0501084_0076652 3300054114 Bacteria 2803
275 Ga0501084_0087851 3300054114 Unclassified 2610
276 Ga0501082_0005596 3300060353 Bacteria 10916
277 Ga0501082_0006622 3300060353 Bacteria 10024
278 Ga0501082_0017854 3300060353 Bacteria 6111
279 Ga0501082_0039319 3300060353 Bacteria 4080
280 Ga0501082_0126561 3300060353 Bacteria 2216
281 Ga0530510_0005821 3300061734 Bacteria 8540
282 Ga0530510_0015926 3300061734 Bacteria 5316

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0228987 Ga0495633_0228987_60_836 247
2 3300046665 Ga0495661_0226193 Ga0495661_0226193_15_869 257
3 3300035112 Ga0373932_0116069 Ga0373932_0116069_10_831 262
4 3300005435 Ga0070714_100078324 Ga0070714_1000783242 266
5 3300049579 Ga0501043_0488697 Ga0501043_0488697_62_904 271
6 3300046535 Ga0495586_0030735 Ga0495586_0030735_13_918 272
7 3300035119 Ga0373956_0113071 Ga0373956_0113071_13_867 276
8 3300005338 Ga0068868_100367142 Ga0068868_1003671421 281
9 3300060353 Ga0501082_0126561 Ga0501082_0126561_759_1697 281
10 3300025922 Ga0207646_10161572 Ga0207646_101615722 288
11 3300007788 Ga0099795_10025596 Ga0099795_100255961 289
12 3300005467 Ga0070706_100003852 Ga0070706_1000038525 290
13 3300005536 Ga0070697_100263693 Ga0070697_1002636932 290
14 3300009101 Ga0105247_10067720 Ga0105247_100677203 291
15 3300006881 Ga0068865_100193102 Ga0068865_1001931022 292
16 3300017792 Ga0163161_10029372 Ga0163161_100293725 292
17 3300025938 Ga0207704_10233016 Ga0207704_102330161 292
18 3300049591 Ga0501075_0140029 Ga0501075_0140029_870_1811 292
19 3300048915 Ga0496112_0313365 Ga0496112_0313365_264_1250 294
20 3300025929 Ga0207664_10109917 Ga0207664_101099172 301
21 3300006844 Ga0075428_100003188 Ga0075428_10000318814 302
22 3300009147 Ga0114129_10020829 Ga0114129_100208295 302
23 3300005435 Ga0070714_100279322 Ga0070714_1002793222 303
24 3300049578 Ga0501042_0066299 Ga0501042_0066299_192_1247 303
25 3300049591 Ga0501075_0105589 Ga0501075_0105589_965_1963 303
26 3300009147 Ga0114129_10014707 Ga0114129_100147077 306
27 3300050507 nmdc:mga05p37_6962_c1 nmdc:mga05p37_6962_c1_11985_12941 306
28 3300031548 Ga0307408_100051452 Ga0307408_1000514521 307
29 3300031995 Ga0307409_100071756 Ga0307409_1000717562 307
30 3300049743 Ga0501081_0370730 Ga0501081_0370730_75_1037 307
31 3300005347 Ga0070668_100179712 Ga0070668_1001797123 308
32 3300005435 Ga0070714_100580970 Ga0070714_1005809701 308
33 3300005456 Ga0070678_100229350 Ga0070678_1002293501 308
34 3300005563 Ga0068855_100043584 Ga0068855_1000435844 308
35 3300005614 Ga0068856_100129008 Ga0068856_1001290083 308
36 3300005614 Ga0068856_100288478 Ga0068856_1002884782 308
37 3300005719 Ga0068861_100023461 Ga0068861_1000234614 308
38 3300009093 Ga0105240_10078313 Ga0105240_100783131 308
39 3300009545 Ga0105237_10195372 Ga0105237_101953721 308
40 3300009553 Ga0105249_10085152 Ga0105249_100851522 308
41 3300010375 Ga0105239_10033298 Ga0105239_100332984 308
42 3300011119 Ga0105246_10366536 Ga0105246_103665361 308
43 3300013306 Ga0163162_10084848 Ga0163162_100848481 308
44 3300014325 Ga0163163_10040592 Ga0163163_100405923 308
45 3300014968 Ga0157379_10052684 Ga0157379_100526841 308
46 3300025912 Ga0207707_10112293 Ga0207707_101122932 308
47 3300025933 Ga0207706_10140847 Ga0207706_101408472 308
48 3300025961 Ga0207712_10283758 Ga0207712_102837581 308
49 3300026067 Ga0207678_10409032 Ga0207678_104090321 308
50 3300026078 Ga0207702_10204402 Ga0207702_102044022 308
51 3300035724 Ga0373933_0045759 Ga0373933_0045759_311_1261 308
52 3300036401 Ga0373937_0008623 Ga0373937_0008623_2121_3071 308
53 3300045976 Ga0466967_0110821 Ga0466967_0110821_1480_2484 308
54 3300046642 Ga0495634_0226155 Ga0495634_0226155_10_984 308
55 3300048907 Ga0496104_0086926 Ga0496104_0086926_104_1066 308
56 3300048909 Ga0496106_0086824 Ga0496106_0086824_792_1754 308
57 3300048911 Ga0496108_0043406 Ga0496108_0043406_2601_3563 308
58 3300048912 Ga0496109_0025784 Ga0496109_0025784_3666_4628 308
59 3300048913 Ga0496110_0126274 Ga0496110_0126274_458_1420 308
60 3300048915 Ga0496112_0414805 Ga0496112_0414805_151_1113 308
61 3300049590 Ga0501074_0225910 Ga0501074_0225910_266_1291 308
62 3300053177 Ga0500636_0035623 Ga0500636_0035623_1055_2032 308
63 3300006844 Ga0075428_100017851 Ga0075428_1000178515 309
64 3300006846 Ga0075430_100002551 Ga0075430_1000025518 309
65 3300006847 Ga0075431_100065617 Ga0075431_1000656172 309
66 3300006847 Ga0075431_100139341 Ga0075431_1001393412 309
67 3300007076 Ga0075435_100101798 Ga0075435_1001017982 309
68 3300050509 nmdc:mga0qj67_1819_c1 nmdc:mga0qj67_1819_c1_8744_9778 309
69 3300050513 nmdc:mga0rr50_142355_c1 nmdc:mga0rr50_142355_c1_347_1351 309
70 3300006880 Ga0075429_100089521 Ga0075429_1000895211 310
71 3300009094 Ga0111539_10279857 Ga0111539_102798572 310
72 3300014326 Ga0157380_10007371 Ga0157380_100073714 310
73 3300026118 Ga0207675_100015483 Ga0207675_1000154836 310
74 3300027907 Ga0207428_10009101 Ga0207428_100091014 310
75 3300032005 Ga0307411_10046283 Ga0307411_100462833 310
76 3300046499 Ga0495594_0136971 Ga0495594_0136971_169_1122 310
77 3300049572 Ga0501036_0025513 Ga0501036_0025513_2373_3413 310
78 3300049572 Ga0501036_0071391 Ga0501036_0071391_737_1732 310
79 3300049573 Ga0501037_0033187 Ga0501037_0033187_1065_2060 310
80 3300049574 Ga0501038_0232303 Ga0501038_0232303_109_1104 310
81 3300049575 Ga0501039_0017352 Ga0501039_0017352_2818_3813 310
82 3300049576 Ga0501040_0163026 Ga0501040_0163026_478_1473 310
83 3300049576 Ga0501040_0191736 Ga0501040_0191736_343_1386 310
84 3300049577 Ga0501041_0009936 Ga0501041_0009936_3738_4733 310
85 3300049578 Ga0501042_0067643 Ga0501042_0067643_25_1020 310
86 3300049587 Ga0501071_0096297 Ga0501071_0096297_964_1959 310
87 3300049588 Ga0501072_0079841 Ga0501072_0079841_1347_2420 310
88 3300049588 Ga0501072_0137339 Ga0501072_0137339_528_1523 310
89 3300049591 Ga0501075_0089342 Ga0501075_0089342_317_1357 310
90 3300049592 Ga0501076_0006344 Ga0501076_0006344_1163_2203 310
91 3300049592 Ga0501076_0030895 Ga0501076_0030895_1111_2073 310
92 3300049592 Ga0501076_0043660 Ga0501076_0043660_1496_2491 310
93 3300049592 Ga0501076_0100389 Ga0501076_0100389_1132_2181 310
94 3300049741 Ga0501079_0063209 Ga0501079_0063209_1608_2570 310
95 3300049741 Ga0501079_0199292 Ga0501079_0199292_96_1130 310
96 3300049742 Ga0501080_0059058 Ga0501080_0059058_1065_2060 310
97 3300049743 Ga0501081_0007842 Ga0501081_0007842_103_1098 310
98 3300049743 Ga0501081_0022000 Ga0501081_0022000_2589_3629 310
99 3300049743 Ga0501081_0140533 Ga0501081_0140533_451_1524 310
100 3300049822 Ga0501035_0073791 Ga0501035_0073791_21_1016 310
101 3300049824 Ga0501045_0023259 Ga0501045_0023259_605_1645 310
102 3300049824 Ga0501045_0072949 Ga0501045_0072949_75_1037 310
103 3300054114 Ga0501084_0010327 Ga0501084_0010327_4447_5409 310
104 3300054114 Ga0501084_0076652 Ga0501084_0076652_804_1799 310
105 3300054114 Ga0501084_0087851 Ga0501084_0087851_835_1896 310
106 3300060353 Ga0501082_0006622 Ga0501082_0006622_2219_3214 310
107 3300060353 Ga0501082_0017854 Ga0501082_0017854_4076_5038 310
108 3300061734 Ga0530510_0015926 Ga0530510_0015926_1764_2759 310
109 3300005327 Ga0070658_10026236 Ga0070658_100262362 311
110 3300005331 Ga0070670_100154233 Ga0070670_1001542333 311
111 3300005353 Ga0070669_100047347 Ga0070669_1000473474 311
112 3300005456 Ga0070678_100006102 Ga0070678_1000061024 311
113 3300005548 Ga0070665_100019184 Ga0070665_1000191845 311
114 3300013297 Ga0157378_10000445 Ga0157378_100004456 311
115 3300025909 Ga0207705_10244690 Ga0207705_102446902 311
116 3300025925 Ga0207650_10038804 Ga0207650_100388044 311
117 3300025926 Ga0207659_10055548 Ga0207659_100555483 311
118 3300025940 Ga0207691_10066302 Ga0207691_100663024 311
119 3300026023 Ga0207677_10062361 Ga0207677_100623612 311
120 3300026121 Ga0207683_10012734 Ga0207683_100127344 311
121 3300028379 Ga0268266_10181201 Ga0268266_101812012 311
122 3300046539 Ga0495621_0073890 Ga0495621_0073890_110_1075 311
123 3300005548 Ga0070665_100069805 Ga0070665_1000698053 312
124 3300005843 Ga0068860_100000027 Ga0068860_10000002778 312
125 3300005844 Ga0068862_100063022 Ga0068862_1000630224 312
126 3300006186 Ga0075369_10047029 Ga0075369_100470292 312
127 3300006195 Ga0075366_10070777 Ga0075366_100707772 312
128 3300013306 Ga0163162_10154410 Ga0163162_101544102 312
129 3300028379 Ga0268266_10420593 Ga0268266_104205931 312
130 3300028380 Ga0268265_10004520 Ga0268265_100045204 312
131 3300028381 Ga0268264_10000181 Ga0268264_1000018147 312
132 3300031852 Ga0307410_10272426 Ga0307410_102724261 312
133 3300049686 Ga0501257_001162 Ga0501257_001162_3756_4715 312
134 3300005331 Ga0070670_100003565 Ga0070670_1000035659 313
135 3300005347 Ga0070668_100001179 Ga0070668_10000117915 313
136 3300005347 Ga0070668_100048119 Ga0070668_1000481193 313
137 3300005367 Ga0070667_100001011 Ga0070667_10000101116 313
138 3300005617 Ga0068859_100004338 Ga0068859_10000433810 313
139 3300005618 Ga0068864_100206002 Ga0068864_1002060022 313
140 3300005719 Ga0068861_100022838 Ga0068861_1000228383 313
141 3300005843 Ga0068860_100003476 Ga0068860_10000347617 313
142 3300005844 Ga0068862_100006043 Ga0068862_10000604310 313
143 3300005844 Ga0068862_100014800 Ga0068862_1000148003 313
144 3300006931 Ga0097620_100004338 Ga0097620_10000433810 313
145 3300009553 Ga0105249_10006428 Ga0105249_100064289 313
146 3300025915 Ga0207693_10021050 Ga0207693_100210504 313
147 3300025925 Ga0207650_10040822 Ga0207650_100408222 313
148 3300025949 Ga0207667_10029997 Ga0207667_100299973 313
149 3300025961 Ga0207712_10071441 Ga0207712_100714412 313
150 3300025972 Ga0207668_10015983 Ga0207668_100159831 313
151 3300025972 Ga0207668_10033455 Ga0207668_100334554 313
152 3300025986 Ga0207658_10081585 Ga0207658_100815852 313
153 3300026118 Ga0207675_100119845 Ga0207675_1001198453 313
154 3300026142 Ga0207698_10014316 Ga0207698_100143162 313
155 3300028380 Ga0268265_10007779 Ga0268265_100077793 313
156 3300028380 Ga0268265_10173927 Ga0268265_101739272 313
157 3300028381 Ga0268264_10094233 Ga0268264_100942332 313
158 3300005331 Ga0070670_100088620 Ga0070670_1000886203 314
159 3300005334 Ga0068869_100045341 Ga0068869_1000453414 314
160 3300005345 Ga0070692_10027608 Ga0070692_100276083 314
161 3300005441 Ga0070700_100269426 Ga0070700_1002694261 314
162 3300005617 Ga0068859_100027062 Ga0068859_1000270624 314
163 3300005840 Ga0068870_10023762 Ga0068870_100237622 314
164 3300005844 Ga0068862_100079553 Ga0068862_1000795533 314
165 3300006931 Ga0097620_100027061 Ga0097620_1000270613 314
166 3300009174 Ga0105241_10280358 Ga0105241_102803581 314
167 3300025908 Ga0207643_10063972 Ga0207643_100639722 314
168 3300025912 Ga0207707_10203054 Ga0207707_102030541 314
169 3300026075 Ga0207708_10083589 Ga0207708_100835892 314
170 3300028380 Ga0268265_10437488 Ga0268265_104374882 314
171 3300005467 Ga0070706_100000250 Ga0070706_10000025030 315
172 3300025910 Ga0207684_10000093 Ga0207684_1000009330 315
173 3300038443 Ga0395901_0408239 Ga0395901_0408239_140_1099 315
174 3300005719 Ga0068861_100380462 Ga0068861_1003804622 316
175 3300005842 Ga0068858_100294983 Ga0068858_1002949831 316
176 3300009551 Ga0105238_10005585 Ga0105238_100055856 316
177 3300025924 Ga0207694_10019436 Ga0207694_100194362 316
178 3300035117 Ga0373953_0066762 Ga0373953_0066762_162_1253 316
179 3300049572 Ga0501036_0034301 Ga0501036_0034301_1066_2052 316
180 3300049573 Ga0501037_0154565 Ga0501037_0154565_72_1058 316
181 3300049575 Ga0501039_0103173 Ga0501039_0103173_459_1445 316
182 3300049576 Ga0501040_0028607 Ga0501040_0028607_904_1890 316
183 3300049577 Ga0501041_0025356 Ga0501041_0025356_2200_3186 316
184 3300049580 Ga0501046_0019416 Ga0501046_0019416_1877_2863 316
185 3300049582 Ga0501048_0046576 Ga0501048_0046576_520_1506 316
186 3300049584 Ga0501068_0095692 Ga0501068_0095692_311_1297 316
187 3300049587 Ga0501071_0052320 Ga0501071_0052320_151_1137 316
188 3300049590 Ga0501074_0061620 Ga0501074_0061620_94_1080 316
189 3300049591 Ga0501075_0003341 Ga0501075_0003341_647_1633 316
190 3300049592 Ga0501076_0001566 Ga0501076_0001566_12983_13969 316
191 3300049593 Ga0501077_0047104 Ga0501077_0047104_1590_2576 316
192 3300049741 Ga0501079_0015512 Ga0501079_0015512_2215_3201 316
193 3300049742 Ga0501080_0367414 Ga0501080_0367414_79_1065 316
194 3300049743 Ga0501081_0002186 Ga0501081_0002186_7781_8767 316
195 3300049744 Ga0501083_0049065 Ga0501083_0049065_1252_2238 316
196 3300049822 Ga0501035_0387309 Ga0501035_0387309_129_1115 316
197 3300049824 Ga0501045_0041184 Ga0501045_0041184_339_1325 316
198 3300050512 nmdc:mga0n895_104222_c1 nmdc:mga0n895_104222_c1_1467_2432 316
199 3300050515 nmdc:mga0a205_517532_c1 nmdc:mga0a205_517532_c1_58_1023 316
200 3300054114 Ga0501084_0023831 Ga0501084_0023831_1333_2319 316
201 3300060353 Ga0501082_0005596 Ga0501082_0005596_2260_3246 316
202 3300061734 Ga0530510_0005821 Ga0530510_0005821_475_1461 316
203 3300037418 Ga0395900_0267807 Ga0395900_0267807_128_1084 318
204 3300038443 Ga0395901_0358803 Ga0395901_0358803_52_1008 318
205 3300005293 Ga0065715_10004730 Ga0065715_100047303 319
206 3300005441 Ga0070700_100000044 Ga0070700_1000000446 319
207 3300005444 Ga0070694_100050017 Ga0070694_1000500172 319
208 3300005458 Ga0070681_10013254 Ga0070681_100132546 319
209 3300005518 Ga0070699_100001836 Ga0070699_10000183610 319
210 3300005546 Ga0070696_100049941 Ga0070696_1000499412 319
211 3300005547 Ga0070693_100020170 Ga0070693_1000201702 319
212 3300005617 Ga0068859_100011796 Ga0068859_1000117966 319
213 3300006852 Ga0075433_10175954 Ga0075433_101759542 319
214 3300006931 Ga0097620_100011797 Ga0097620_1000117975 319
215 3300009177 Ga0105248_10020847 Ga0105248_100208473 319
216 3300009545 Ga0105237_10120309 Ga0105237_101203093 319
217 3300010375 Ga0105239_10226838 Ga0105239_102268381 319
218 3300014325 Ga0163163_10736194 Ga0163163_107361941 319
219 3300026075 Ga0207708_10000031 Ga0207708_1000003177 319
220 3300031548 Ga0307408_100013551 Ga0307408_1000135513 319
221 3300031731 Ga0307405_10011045 Ga0307405_100110453 319
222 3300031824 Ga0307413_10021774 Ga0307413_100217742 319
223 3300031901 Ga0307406_10002945 Ga0307406_100029453 319
224 3300031995 Ga0307409_100069411 Ga0307409_1000694113 319
225 3300032004 Ga0307414_10002214 Ga0307414_100022143 319
226 3300032126 Ga0307415_100008962 Ga0307415_1000089623 319
227 3300034818 Ga0373950_0000033 Ga0373950_0000033_29769_30809 319
228 3300035086 Ga0373934_0040306 Ga0373934_0040306_500_1534 319
229 3300035117 Ga0373953_0022142 Ga0373953_0022142_1087_2121 319
230 3300035118 Ga0373954_0014993 Ga0373954_0014993_1186_2220 319
231 3300035119 Ga0373956_0033455 Ga0373956_0033455_1185_2219 319
232 3300035120 Ga0373957_0029628 Ga0373957_0029628_148_1182 319
233 3300035172 Ga0373955_0004557 Ga0373955_0004557_3773_4807 319
234 3300035724 Ga0373933_0044336 Ga0373933_0044336_142_1176 319
235 3300036401 Ga0373937_0042004 Ga0373937_0042004_2533_3567 319
236 3300036401 Ga0373937_0153538 Ga0373937_0153538_278_1312 319
237 3300038443 Ga0395901_0208172 Ga0395901_0208172_210_1175 319
238 3300042157 Ga0439458_0003126 Ga0439458_0003126_448_1407 319
239 3300046454 Ga0495592_0040564 Ga0495592_0040564_912_1946 319
240 3300046454 Ga0495592_0142557 Ga0495592_0142557_41_1075 319
241 3300046461 Ga0495641_0071979 Ga0495641_0071979_186_1232 319
242 3300046462 Ga0495651_0118695 Ga0495651_0118695_858_1892 319
243 3300046472 Ga0495580_0169425 Ga0495580_0169425_74_1129 319
244 3300046473 Ga0495582_0004933 Ga0495582_0004933_4549_5595 319
245 3300046473 Ga0495582_0006289 Ga0495582_0006289_3481_4536 319
246 3300046511 Ga0495608_0005669 Ga0495608_0005669_6133_7167 319
247 3300046516 Ga0495628_0000913 Ga0495628_0000913_23706_24740 319
248 3300046536 Ga0495587_0071020 Ga0495587_0071020_351_1385 319
249 3300046559 Ga0495667_0036384 Ga0495667_0036384_1001_2035 319
250 3300046642 Ga0495634_0145733 Ga0495634_0145733_426_1472 319
251 3300046663 Ga0495635_0000710 Ga0495635_0000710_12598_13644 319
252 3300046675 Ga0495657_0033222 Ga0495657_0033222_2223_3257 319
253 3300046678 Ga0495599_0058057 Ga0495599_0058057_748_1782 319
254 3300046683 Ga0495658_0000018 Ga0495658_0000018_1799_2845 319
255 3300046689 Ga0495613_0044348 Ga0495613_0044348_1245_2291 319
256 3300046689 Ga0495613_0126866 Ga0495613_0126866_90_1145 319
257 3300047315 Ga0495581_0000323 Ga0495581_0000323_7837_8883 319
258 3300047322 Ga0495680_0001669 Ga0495680_0001669_7811_8857 319
259 3300047322 Ga0495680_0020114 Ga0495680_0020114_2708_3742 319
260 3300047322 Ga0495680_0051296 Ga0495680_0051296_405_1439 319
261 3300048089 Ga0495614_0015718 Ga0495614_0015718_1858_2904 319
262 3300048089 Ga0495614_0059753 Ga0495614_0059753_100_1155 319
263 3300049571 Ga0501034_0000047 Ga0501034_0000047_84686_85720 319
264 3300049572 Ga0501036_0085146 Ga0501036_0085146_1244_2311 319
265 3300049579 Ga0501043_0001462 Ga0501043_0001462_6181_7215 319
266 3300049580 Ga0501046_0000717 Ga0501046_0000717_397_1431 319
267 3300049581 Ga0501047_0000034 Ga0501047_0000034_112275_113309 319
268 3300049582 Ga0501048_0098671 Ga0501048_0098671_989_2023 319
269 3300049584 Ga0501068_0018327 Ga0501068_0018327_967_2001 319
270 3300049586 Ga0501070_0004503 Ga0501070_0004503_5096_6130 319
271 3300049588 Ga0501072_0000010 Ga0501072_0000010_108984_110018 319
272 3300049589 Ga0501073_0007609 Ga0501073_0007609_5099_6133 319
273 3300049590 Ga0501074_0000678 Ga0501074_0000678_4493_5527 319
274 3300049705 Ga0501225_0000510 Ga0501225_0000510_2700_3674 319
275 3300049741 Ga0501079_0008242 Ga0501079_0008242_4765_5799 319
276 3300049742 Ga0501080_0008281 Ga0501080_0008281_8092_9126 319
277 3300049744 Ga0501083_0135040 Ga0501083_0135040_165_1199 319
278 3300049853 Ga0501226_000530 Ga0501226_000530_2530_3504 319
279 3300053084 Ga0495595_0014082 Ga0495595_0014082_626_1660 319
280 3300053085 Ga0495619_0000898 Ga0495619_0000898_4668_5714 319
281 3300054114 Ga0501084_0000080 Ga0501084_0000080_19486_20520 319
282 3300060353 Ga0501082_0039319 Ga0501082_0039319_269_1303 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

278

356

0.98

PF12852

Cupin_6

Cupin

41

240

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9656 212 315
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9639 218 314
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9405 212 306
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9377 212 312
1u8b-assembly1.cif.gz_A crystal structure of the methylated n-ada/dna complex 0.9337 213 266
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9884 270 312 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9877 266 313 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9732 266 319 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9665 270 312 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9639 218 314 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A5Q4T4C4-F1-model_v4 AraC family transcriptional regulator 0.9815 218 314 GO:0003700
GO:0043565
AF-A0A172TL64-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9802 212 313 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A7J9ZUH7-F1-model_v4 Helix-turn-helix domain-containing protein 0.977 211 313 GO:0003700
GO:0043565
AF-A0A763GNR6-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9749 224 312 GO:0003700
GO:0043565
AF-F1TEY5-F1-model_v4 Transcriptional regulator, AraC family 0.9719 218 314 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
89.64 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map