F385009
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 178 | 282 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300027907|Ga0207428_10009101|Ga0207428_100091014 |
| Length | 372 |
| Sequence | VRRIVSVRFAWQAVHMSEPLAPPSEPDAQASETRGGAASADVLSDVLRSVRLTGAVFFDWAMSSPWVAEAPPASEIAGRVMPGAQRVVEYHLVARGECWGNVVGEPPIRLKAGDLILFPQGDPHVLSSEPGMRAAPDMKLFSRPRTPLPRVGEAGGGGPDRTRLVCCFLGCDERPFNPLLSALPRTIHLSGAGNEATSGWLATLLNIAVRESGSSRAGRDNILARMSELMFVEAVRRYIETLPAAETGWLAGLRDPVVGQGLAALHAEPASPWTVESLARRVGVSRSVLADRFAAMVGQPPIQYLTLWRMQLASRLMLQGESVAAAAGVVGYESEAAFSRAFKKIVGEAPTTWRRAATTAKAYSPRKVHSPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 26 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 31 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 34 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 35 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 36 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 40 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 87 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 89 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 90 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 91 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 92 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 93 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 94 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 95 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 96 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 99 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 100 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 102 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 103 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 108 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 109 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 134 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 137 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 138 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 160 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 161 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 176 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 0 |
| Rhizoplane | 2.48 |
| Rhizosphere | 96.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10004730 | 3300005293 | Bacteria | 3619 |
| 2 | Ga0070658_10026236 | 3300005327 | Bacteria | 4674 |
| 3 | Ga0070670_100003565 | 3300005331 | Bacteria | 12942 |
| 4 | Ga0070670_100088620 | 3300005331 | Bacteria | 2660 |
| 5 | Ga0070670_100154233 | 3300005331 | Bacteria | 1989 |
| 6 | Ga0068869_100045341 | 3300005334 | Bacteria | 3165 |
| 7 | Ga0068868_100367142 | 3300005338 | Bacteria | 1236 |
| 8 | Ga0070692_10027608 | 3300005345 | Bacteria | 2815 |
| 9 | Ga0070668_100001179 | 3300005347 | Bacteria | 18500 |
| 10 | Ga0070668_100048119 | 3300005347 | Bacteria | 3279 |
| 11 | Ga0070668_100179712 | 3300005347 | Bacteria | 1728 |
| 12 | Ga0070669_100047347 | 3300005353 | Bacteria | 3136 |
| 13 | Ga0070667_100001011 | 3300005367 | Bacteria | 25767 |
| 14 | Ga0070714_100078324 | 3300005435 | Bacteria | 2872 |
| 15 | Ga0070714_100279322 | 3300005435 | Unclassified | 1551 |
| 16 | Ga0070714_100580970 | 3300005435 | Unclassified | 1075 |
| 17 | Ga0070700_100000044 | 3300005441 | Bacteria | 98346 |
| 18 | Ga0070700_100269426 | 3300005441 | Bacteria | 1230 |
| 19 | Ga0070694_100050017 | 3300005444 | Bacteria | 2816 |
| 20 | Ga0070678_100006102 | 3300005456 | Bacteria | 7034 |
| 21 | Ga0070678_100229350 | 3300005456 | Unclassified | 1547 |
| 22 | Ga0070681_10013254 | 3300005458 | Bacteria | 8191 |
| 23 | Ga0070706_100000250 | 3300005467 | Bacteria | 65288 |
| 24 | Ga0070706_100003852 | 3300005467 | Bacteria | 14657 |
| 25 | Ga0070699_100001836 | 3300005518 | Bacteria | 19270 |
| 26 | Ga0070697_100263693 | 3300005536 | Bacteria | 1475 |
| 27 | Ga0070696_100049941 | 3300005546 | Unclassified | 2907 |
| 28 | Ga0070693_100020170 | 3300005547 | Unclassified | 3511 |
| 29 | Ga0070665_100019184 | 3300005548 | Bacteria | 6860 |
| 30 | Ga0070665_100069805 | 3300005548 | Bacteria | 3521 |
| 31 | Ga0068855_100043584 | 3300005563 | Bacteria | 5314 |
| 32 | Ga0068856_100129008 | 3300005614 | Bacteria | 2533 |
| 33 | Ga0068856_100288478 | 3300005614 | Bacteria | 1658 |
| 34 | Ga0068859_100004338 | 3300005617 | Bacteria | 14463 |
| 35 | Ga0068859_100011796 | 3300005617 | Bacteria | 8780 |
| 36 | Ga0068859_100027062 | 3300005617 | Bacteria | 5752 |
| 37 | Ga0068864_100206002 | 3300005618 | Bacteria | 1809 |
| 38 | Ga0068861_100022838 | 3300005719 | Bacteria | 4510 |
| 39 | Ga0068861_100023461 | 3300005719 | Bacteria | 4450 |
| 40 | Ga0068861_100380462 | 3300005719 | Bacteria | 1247 |
| 41 | Ga0068870_10023762 | 3300005840 | Bacteria | 3026 |
| 42 | Ga0068858_100294983 | 3300005842 | Bacteria | 1546 |
| 43 | Ga0068860_100000027 | 3300005843 | Bacteria | 267207 |
| 44 | Ga0068860_100003476 | 3300005843 | Bacteria | 16214 |
| 45 | Ga0068862_100006043 | 3300005844 | Bacteria | 10080 |
| 46 | Ga0068862_100014800 | 3300005844 | Bacteria | 6480 |
| 47 | Ga0068862_100063022 | 3300005844 | Bacteria | 3190 |
| 48 | Ga0068862_100079553 | 3300005844 | Bacteria | 2841 |
| 49 | Ga0075369_10047029 | 3300006186 | Bacteria | 1860 |
| 50 | Ga0075366_10070777 | 3300006195 | Bacteria | 2078 |
| 51 | Ga0075428_100003188 | 3300006844 | Bacteria | 17938 |
| 52 | Ga0075428_100017851 | 3300006844 | Bacteria | 7840 |
| 53 | Ga0075430_100002551 | 3300006846 | Bacteria | 15188 |
| 54 | Ga0075431_100065617 | 3300006847 | Bacteria | 3748 |
| 55 | Ga0075431_100139341 | 3300006847 | Bacteria | 2501 |
| 56 | Ga0075433_10175954 | 3300006852 | Bacteria | 1904 |
| 57 | Ga0075429_100089521 | 3300006880 | Bacteria | 2683 |
| 58 | Ga0068865_100193102 | 3300006881 | Bacteria | 1576 |
| 59 | Ga0097620_100004338 | 3300006931 | Bacteria | 14463 |
| 60 | Ga0097620_100011797 | 3300006931 | Bacteria | 8780 |
| 61 | Ga0097620_100027061 | 3300006931 | Bacteria | 5752 |
| 62 | Ga0075435_100101798 | 3300007076 | Bacteria | 2381 |
| 63 | Ga0099795_10025596 | 3300007788 | Bacteria | 1980 |
| 64 | Ga0105240_10078313 | 3300009093 | Bacteria | 4071 |
| 65 | Ga0111539_10279857 | 3300009094 | Bacteria | 1941 |
| 66 | Ga0105247_10067720 | 3300009101 | Bacteria | 2225 |
| 67 | Ga0114129_10014707 | 3300009147 | Bacteria | 11147 |
| 68 | Ga0114129_10020829 | 3300009147 | Bacteria | 9314 |
| 69 | Ga0105241_10280358 | 3300009174 | Bacteria | 1423 |
| 70 | Ga0105248_10020847 | 3300009177 | Bacteria | 7262 |
| 71 | Ga0105237_10120309 | 3300009545 | Bacteria | 2620 |
| 72 | Ga0105237_10195372 | 3300009545 | Bacteria | 2023 |
| 73 | Ga0105238_10005585 | 3300009551 | Bacteria | 12425 |
| 74 | Ga0105249_10006428 | 3300009553 | Bacteria | 10216 |
| 75 | Ga0105249_10085152 | 3300009553 | Bacteria | 2945 |
| 76 | Ga0105239_10033298 | 3300010375 | Bacteria | 5660 |
| 77 | Ga0105239_10226838 | 3300010375 | Bacteria | 2096 |
| 78 | Ga0105246_10366536 | 3300011119 | Bacteria | 1186 |
| 79 | Ga0157378_10000445 | 3300013297 | Bacteria | 39758 |
| 80 | Ga0163162_10084848 | 3300013306 | Bacteria | 3243 |
| 81 | Ga0163162_10154410 | 3300013306 | Bacteria | 2414 |
| 82 | Ga0163163_10040592 | 3300014325 | Bacteria | 4545 |
| 83 | Ga0163163_10736194 | 3300014325 | Bacteria | 1049 |
| 84 | Ga0157380_10007371 | 3300014326 | Bacteria | 7810 |
| 85 | Ga0157379_10052684 | 3300014968 | Bacteria | 3635 |
| 86 | Ga0163161_10029372 | 3300017792 | Bacteria | 3909 |
| 87 | Ga0207643_10063972 | 3300025908 | Bacteria | 2105 |
| 88 | Ga0207705_10244690 | 3300025909 | Bacteria | 1367 |
| 89 | Ga0207684_10000093 | 3300025910 | Bacteria | 166136 |
| 90 | Ga0207707_10112293 | 3300025912 | Bacteria | 2382 |
| 91 | Ga0207707_10203054 | 3300025912 | Bacteria | 1728 |
| 92 | Ga0207693_10021050 | 3300025915 | Bacteria | 5182 |
| 93 | Ga0207646_10161572 | 3300025922 | Bacteria | 2022 |
| 94 | Ga0207694_10019436 | 3300025924 | Bacteria | 5134 |
| 95 | Ga0207650_10038804 | 3300025925 | Bacteria | 3480 |
| 96 | Ga0207650_10040822 | 3300025925 | Bacteria | 3397 |
| 97 | Ga0207659_10055548 | 3300025926 | Bacteria | 2833 |
| 98 | Ga0207664_10109917 | 3300025929 | Bacteria | 2291 |
| 99 | Ga0207706_10140847 | 3300025933 | Bacteria | 2122 |
| 100 | Ga0207704_10233016 | 3300025938 | Bacteria | 1370 |
| 101 | Ga0207691_10066302 | 3300025940 | Bacteria | 3266 |
| 102 | Ga0207667_10029997 | 3300025949 | Bacteria | 5890 |
| 103 | Ga0207712_10071441 | 3300025961 | Bacteria | 2496 |
| 104 | Ga0207712_10283758 | 3300025961 | Bacteria | 1352 |
| 105 | Ga0207668_10015983 | 3300025972 | Bacteria | 4675 |
| 106 | Ga0207668_10033455 | 3300025972 | Bacteria | 3405 |
| 107 | Ga0207658_10081585 | 3300025986 | Bacteria | 2480 |
| 108 | Ga0207677_10062361 | 3300026023 | Bacteria | 2586 |
| 109 | Ga0207678_10409032 | 3300026067 | Bacteria | 1175 |
| 110 | Ga0207708_10000031 | 3300026075 | Bacteria | 155478 |
| 111 | Ga0207708_10083589 | 3300026075 | Bacteria | 2454 |
| 112 | Ga0207702_10204402 | 3300026078 | Bacteria | 1833 |
| 113 | Ga0207675_100015483 | 3300026118 | Bacteria | 7112 |
| 114 | Ga0207675_100119845 | 3300026118 | Bacteria | 2489 |
| 115 | Ga0207683_10012734 | 3300026121 | Bacteria | 7178 |
| 116 | Ga0207698_10014316 | 3300026142 | Bacteria | 5269 |
| 117 | Ga0207428_10009101 | 3300027907 | Bacteria | 8927 |
| 118 | Ga0268266_10181201 | 3300028379 | Bacteria | 1918 |
| 119 | Ga0268266_10420593 | 3300028379 | Bacteria | 1266 |
| 120 | Ga0268265_10004520 | 3300028380 | Bacteria | 9629 |
| 121 | Ga0268265_10007779 | 3300028380 | Bacteria | 7236 |
| 122 | Ga0268265_10173927 | 3300028380 | Bacteria | 1843 |
| 123 | Ga0268265_10437488 | 3300028380 | Bacteria | 1218 |
| 124 | Ga0268264_10000181 | 3300028381 | Bacteria | 134092 |
| 125 | Ga0268264_10094233 | 3300028381 | Bacteria | 2588 |
| 126 | Ga0307408_100013551 | 3300031548 | Bacteria | 5412 |
| 127 | Ga0307408_100051452 | 3300031548 | Unclassified | 2967 |
| 128 | Ga0307405_10011045 | 3300031731 | Bacteria | 4713 |
| 129 | Ga0307413_10021774 | 3300031824 | Bacteria | 3440 |
| 130 | Ga0307410_10272426 | 3300031852 | Unclassified | 1325 |
| 131 | Ga0307406_10002945 | 3300031901 | Bacteria | 9271 |
| 132 | Ga0307409_100069411 | 3300031995 | Bacteria | 2792 |
| 133 | Ga0307409_100071756 | 3300031995 | Bacteria | 2755 |
| 134 | Ga0307414_10002214 | 3300032004 | Bacteria | 10135 |
| 135 | Ga0307411_10046283 | 3300032005 | Unclassified | 2803 |
| 136 | Ga0307415_100008962 | 3300032126 | Bacteria | 5579 |
| 137 | Ga0373950_0000033 | 3300034818 | Bacteria | 145634 |
| 138 | Ga0373934_0040306 | 3300035086 | Bacteria | 1842 |
| 139 | Ga0373932_0116069 | 3300035112 | Unclassified | 888 |
| 140 | Ga0373953_0022142 | 3300035117 | Bacteria | 2393 |
| 141 | Ga0373953_0066762 | 3300035117 | Unclassified | 1479 |
| 142 | Ga0373954_0014993 | 3300035118 | Bacteria | 3461 |
| 143 | Ga0373956_0033455 | 3300035119 | Bacteria | 2260 |
| 144 | Ga0373956_0113071 | 3300035119 | Unclassified | 1265 |
| 145 | Ga0373957_0029628 | 3300035120 | Bacteria | 2000 |
| 146 | Ga0373955_0004557 | 3300035172 | Bacteria | 6140 |
| 147 | Ga0373933_0044336 | 3300035724 | Bacteria | 2634 |
| 148 | Ga0373933_0045759 | 3300035724 | Bacteria | 2596 |
| 149 | Ga0373937_0008623 | 3300036401 | Bacteria | 8855 |
| 150 | Ga0373937_0042004 | 3300036401 | Bacteria | 4172 |
| 151 | Ga0373937_0153538 | 3300036401 | Bacteria | 2157 |
| 152 | Ga0395900_0267807 | 3300037418 | Bacteria | 1704 |
| 153 | Ga0395901_0208172 | 3300038443 | Bacteria | 2048 |
| 154 | Ga0395901_0358803 | 3300038443 | Bacteria | 1503 |
| 155 | Ga0395901_0408239 | 3300038443 | Unclassified | 1395 |
| 156 | Ga0439458_0003126 | 3300042157 | Bacteria | 3933 |
| 157 | Ga0466967_0110821 | 3300045976 | Bacteria | 2521 |
| 158 | Ga0495592_0040564 | 3300046454 | Bacteria | 3493 |
| 159 | Ga0495592_0142557 | 3300046454 | Bacteria | 1665 |
| 160 | Ga0495641_0071979 | 3300046461 | Bacteria | 1551 |
| 161 | Ga0495651_0118695 | 3300046462 | Bacteria | 1946 |
| 162 | Ga0495580_0169425 | 3300046472 | Bacteria | 1510 |
| 163 | Ga0495582_0004933 | 3300046473 | Bacteria | 7478 |
| 164 | Ga0495582_0006289 | 3300046473 | Bacteria | 6616 |
| 165 | Ga0495594_0136971 | 3300046499 | Bacteria | 1388 |
| 166 | Ga0495608_0005669 | 3300046511 | Bacteria | 8913 |
| 167 | Ga0495628_0000913 | 3300046516 | Bacteria | 27120 |
| 168 | Ga0495586_0030735 | 3300046535 | Bacteria | 2875 |
| 169 | Ga0495587_0071020 | 3300046536 | Bacteria | 2025 |
| 170 | Ga0495621_0073890 | 3300046539 | Bacteria | 1260 |
| 171 | Ga0495633_0228987 | 3300046558 | Unclassified | 850 |
| 172 | Ga0495667_0036384 | 3300046559 | Bacteria | 3286 |
| 173 | Ga0495634_0145733 | 3300046642 | Bacteria | 1500 |
| 174 | Ga0495634_0226155 | 3300046642 | Bacteria | 1153 |
| 175 | Ga0495635_0000710 | 3300046663 | Bacteria | 21459 |
| 176 | Ga0495661_0226193 | 3300046665 | Unclassified | 967 |
| 177 | Ga0495657_0033222 | 3300046675 | Bacteria | 3593 |
| 178 | Ga0495599_0058057 | 3300046678 | Bacteria | 2421 |
| 179 | Ga0495658_0000018 | 3300046683 | Bacteria | 93319 |
| 180 | Ga0495613_0044348 | 3300046689 | Bacteria | 3290 |
| 181 | Ga0495613_0126866 | 3300046689 | Bacteria | 1829 |
| 182 | Ga0495581_0000323 | 3300047315 | Bacteria | 23616 |
| 183 | Ga0495680_0001669 | 3300047322 | Bacteria | 23602 |
| 184 | Ga0495680_0020114 | 3300047322 | Bacteria | 5624 |
| 185 | Ga0495680_0051296 | 3300047322 | Bacteria | 3222 |
| 186 | Ga0495614_0015718 | 3300048089 | Bacteria | 3297 |
| 187 | Ga0495614_0059753 | 3300048089 | Bacteria | 1638 |
| 188 | Ga0496104_0086926 | 3300048907 | Bacteria | 2985 |
| 189 | Ga0496106_0086824 | 3300048909 | Bacteria | 2410 |
| 190 | Ga0496108_0043406 | 3300048911 | Bacteria | 3756 |
| 191 | Ga0496109_0025784 | 3300048912 | Bacteria | 5240 |
| 192 | Ga0496110_0126274 | 3300048913 | Bacteria | 2308 |
| 193 | Ga0496112_0313365 | 3300048915 | Bacteria | 1514 |
| 194 | Ga0496112_0414805 | 3300048915 | Bacteria | 1286 |
| 195 | Ga0501034_0000047 | 3300049571 | Bacteria | 223793 |
| 196 | Ga0501036_0025513 | 3300049572 | Bacteria | 4987 |
| 197 | Ga0501036_0034301 | 3300049572 | Bacteria | 4293 |
| 198 | Ga0501036_0071391 | 3300049572 | Bacteria | 2936 |
| 199 | Ga0501036_0085146 | 3300049572 | Bacteria | 2672 |
| 200 | Ga0501037_0033187 | 3300049573 | Bacteria | 3813 |
| 201 | Ga0501037_0154565 | 3300049573 | Bacteria | 1638 |
| 202 | Ga0501038_0232303 | 3300049574 | Bacteria | 1467 |
| 203 | Ga0501039_0017352 | 3300049575 | Bacteria | 5521 |
| 204 | Ga0501039_0103173 | 3300049575 | Bacteria | 2226 |
| 205 | Ga0501040_0028607 | 3300049576 | Bacteria | 3758 |
| 206 | Ga0501040_0163026 | 3300049576 | Bacteria | 1576 |
| 207 | Ga0501040_0191736 | 3300049576 | Unclassified | 1450 |
| 208 | Ga0501041_0009936 | 3300049577 | Bacteria | 5606 |
| 209 | Ga0501041_0025356 | 3300049577 | Bacteria | 3563 |
| 210 | Ga0501042_0066299 | 3300049578 | Bacteria | 2581 |
| 211 | Ga0501042_0067643 | 3300049578 | Bacteria | 2554 |
| 212 | Ga0501043_0001462 | 3300049579 | Bacteria | 20652 |
| 213 | Ga0501043_0488697 | 3300049579 | Unclassified | 921 |
| 214 | Ga0501046_0000717 | 3300049580 | Bacteria | 32066 |
| 215 | Ga0501046_0019416 | 3300049580 | Bacteria | 5639 |
| 216 | Ga0501047_0000034 | 3300049581 | Bacteria | 198118 |
| 217 | Ga0501048_0046576 | 3300049582 | Bacteria | 3095 |
| 218 | Ga0501048_0098671 | 3300049582 | Bacteria | 2060 |
| 219 | Ga0501068_0018327 | 3300049584 | Bacteria | 4055 |
| 220 | Ga0501068_0095692 | 3300049584 | Bacteria | 1837 |
| 221 | Ga0501070_0004503 | 3300049586 | Bacteria | 11962 |
| 222 | Ga0501071_0052320 | 3300049587 | Bacteria | 2945 |
| 223 | Ga0501071_0096297 | 3300049587 | Bacteria | 2178 |
| 224 | Ga0501072_0000010 | 3300049588 | Bacteria | 205637 |
| 225 | Ga0501072_0079841 | 3300049588 | Bacteria | 2591 |
| 226 | Ga0501072_0137339 | 3300049588 | Bacteria | 1949 |
| 227 | Ga0501073_0007609 | 3300049589 | Bacteria | 8045 |
| 228 | Ga0501074_0000678 | 3300049590 | Bacteria | 21289 |
| 229 | Ga0501074_0061620 | 3300049590 | Bacteria | 2703 |
| 230 | Ga0501074_0225910 | 3300049590 | Bacteria | 1333 |
| 231 | Ga0501075_0003341 | 3300049591 | Bacteria | 10722 |
| 232 | Ga0501075_0089342 | 3300049591 | Bacteria | 2336 |
| 233 | Ga0501075_0105589 | 3300049591 | Bacteria | 2141 |
| 234 | Ga0501075_0140029 | 3300049591 | Bacteria | 1843 |
| 235 | Ga0501076_0001566 | 3300049592 | Bacteria | 15339 |
| 236 | Ga0501076_0006344 | 3300049592 | Bacteria | 8574 |
| 237 | Ga0501076_0030895 | 3300049592 | Bacteria | 4174 |
| 238 | Ga0501076_0043660 | 3300049592 | Bacteria | 3533 |
| 239 | Ga0501076_0100389 | 3300049592 | Bacteria | 2332 |
| 240 | Ga0501077_0047104 | 3300049593 | Bacteria | 2739 |
| 241 | Ga0501257_001162 | 3300049686 | Bacteria | 5378 |
| 242 | Ga0501225_0000510 | 3300049705 | Bacteria | 12115 |
| 243 | Ga0501079_0008242 | 3300049741 | Bacteria | 7897 |
| 244 | Ga0501079_0015512 | 3300049741 | Bacteria | 5815 |
| 245 | Ga0501079_0063209 | 3300049741 | Bacteria | 2856 |
| 246 | Ga0501079_0199292 | 3300049741 | Bacteria | 1563 |
| 247 | Ga0501080_0008281 | 3300049742 | Bacteria | 9418 |
| 248 | Ga0501080_0059058 | 3300049742 | Bacteria | 3570 |
| 249 | Ga0501080_0367414 | 3300049742 | Bacteria | 1297 |
| 250 | Ga0501081_0002186 | 3300049743 | Bacteria | 12294 |
| 251 | Ga0501081_0007842 | 3300049743 | Bacteria | 6923 |
| 252 | Ga0501081_0022000 | 3300049743 | Unclassified | 4262 |
| 253 | Ga0501081_0140533 | 3300049743 | Unclassified | 1730 |
| 254 | Ga0501081_0370730 | 3300049743 | Unclassified | 1057 |
| 255 | Ga0501083_0049065 | 3300049744 | Bacteria | 2848 |
| 256 | Ga0501083_0135040 | 3300049744 | Bacteria | 1616 |
| 257 | Ga0501035_0073791 | 3300049822 | Bacteria | 3019 |
| 258 | Ga0501035_0387309 | 3300049822 | Bacteria | 1165 |
| 259 | Ga0501045_0023259 | 3300049824 | Unclassified | 4442 |
| 260 | Ga0501045_0041184 | 3300049824 | Bacteria | 3361 |
| 261 | Ga0501045_0072949 | 3300049824 | Bacteria | 2527 |
| 262 | Ga0501226_000530 | 3300049853 | Bacteria | 5293 |
| 263 | nmdc:mga05p37_6962_c1 | 3300050507 | Bacteria | 13324 |
| 264 | nmdc:mga0qj67_1819_c1 | 3300050509 | Bacteria | 15098 |
| 265 | nmdc:mga0n895_104222_c1 | 3300050512 | Bacteria | 2849 |
| 266 | nmdc:mga0rr50_142355_c1 | 3300050513 | Bacteria | 1930 |
| 267 | nmdc:mga0a205_517532_c1 | 3300050515 | Bacteria | 1050 |
| 268 | Ga0495595_0014082 | 3300053084 | Bacteria | 3387 |
| 269 | Ga0495619_0000898 | 3300053085 | Bacteria | 19484 |
| 270 | Ga0500636_0035623 | 3300053177 | Bacteria | 2945 |
| 271 | Ga0501084_0000080 | 3300054114 | Bacteria | 71059 |
| 272 | Ga0501084_0010327 | 3300054114 | Bacteria | 7724 |
| 273 | Ga0501084_0023831 | 3300054114 | Bacteria | 5105 |
| 274 | Ga0501084_0076652 | 3300054114 | Bacteria | 2803 |
| 275 | Ga0501084_0087851 | 3300054114 | Unclassified | 2610 |
| 276 | Ga0501082_0005596 | 3300060353 | Bacteria | 10916 |
| 277 | Ga0501082_0006622 | 3300060353 | Bacteria | 10024 |
| 278 | Ga0501082_0017854 | 3300060353 | Bacteria | 6111 |
| 279 | Ga0501082_0039319 | 3300060353 | Bacteria | 4080 |
| 280 | Ga0501082_0126561 | 3300060353 | Bacteria | 2216 |
| 281 | Ga0530510_0005821 | 3300061734 | Bacteria | 8540 |
| 282 | Ga0530510_0015926 | 3300061734 | Bacteria | 5316 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046558 | Ga0495633_0228987 | Ga0495633_0228987_60_836 | 247 |
| 2 | 3300046665 | Ga0495661_0226193 | Ga0495661_0226193_15_869 | 257 |
| 3 | 3300035112 | Ga0373932_0116069 | Ga0373932_0116069_10_831 | 262 |
| 4 | 3300005435 | Ga0070714_100078324 | Ga0070714_1000783242 | 266 |
| 5 | 3300049579 | Ga0501043_0488697 | Ga0501043_0488697_62_904 | 271 |
| 6 | 3300046535 | Ga0495586_0030735 | Ga0495586_0030735_13_918 | 272 |
| 7 | 3300035119 | Ga0373956_0113071 | Ga0373956_0113071_13_867 | 276 |
| 8 | 3300005338 | Ga0068868_100367142 | Ga0068868_1003671421 | 281 |
| 9 | 3300060353 | Ga0501082_0126561 | Ga0501082_0126561_759_1697 | 281 |
| 10 | 3300025922 | Ga0207646_10161572 | Ga0207646_101615722 | 288 |
| 11 | 3300007788 | Ga0099795_10025596 | Ga0099795_100255961 | 289 |
| 12 | 3300005467 | Ga0070706_100003852 | Ga0070706_1000038525 | 290 |
| 13 | 3300005536 | Ga0070697_100263693 | Ga0070697_1002636932 | 290 |
| 14 | 3300009101 | Ga0105247_10067720 | Ga0105247_100677203 | 291 |
| 15 | 3300006881 | Ga0068865_100193102 | Ga0068865_1001931022 | 292 |
| 16 | 3300017792 | Ga0163161_10029372 | Ga0163161_100293725 | 292 |
| 17 | 3300025938 | Ga0207704_10233016 | Ga0207704_102330161 | 292 |
| 18 | 3300049591 | Ga0501075_0140029 | Ga0501075_0140029_870_1811 | 292 |
| 19 | 3300048915 | Ga0496112_0313365 | Ga0496112_0313365_264_1250 | 294 |
| 20 | 3300025929 | Ga0207664_10109917 | Ga0207664_101099172 | 301 |
| 21 | 3300006844 | Ga0075428_100003188 | Ga0075428_10000318814 | 302 |
| 22 | 3300009147 | Ga0114129_10020829 | Ga0114129_100208295 | 302 |
| 23 | 3300005435 | Ga0070714_100279322 | Ga0070714_1002793222 | 303 |
| 24 | 3300049578 | Ga0501042_0066299 | Ga0501042_0066299_192_1247 | 303 |
| 25 | 3300049591 | Ga0501075_0105589 | Ga0501075_0105589_965_1963 | 303 |
| 26 | 3300009147 | Ga0114129_10014707 | Ga0114129_100147077 | 306 |
| 27 | 3300050507 | nmdc:mga05p37_6962_c1 | nmdc:mga05p37_6962_c1_11985_12941 | 306 |
| 28 | 3300031548 | Ga0307408_100051452 | Ga0307408_1000514521 | 307 |
| 29 | 3300031995 | Ga0307409_100071756 | Ga0307409_1000717562 | 307 |
| 30 | 3300049743 | Ga0501081_0370730 | Ga0501081_0370730_75_1037 | 307 |
| 31 | 3300005347 | Ga0070668_100179712 | Ga0070668_1001797123 | 308 |
| 32 | 3300005435 | Ga0070714_100580970 | Ga0070714_1005809701 | 308 |
| 33 | 3300005456 | Ga0070678_100229350 | Ga0070678_1002293501 | 308 |
| 34 | 3300005563 | Ga0068855_100043584 | Ga0068855_1000435844 | 308 |
| 35 | 3300005614 | Ga0068856_100129008 | Ga0068856_1001290083 | 308 |
| 36 | 3300005614 | Ga0068856_100288478 | Ga0068856_1002884782 | 308 |
| 37 | 3300005719 | Ga0068861_100023461 | Ga0068861_1000234614 | 308 |
| 38 | 3300009093 | Ga0105240_10078313 | Ga0105240_100783131 | 308 |
| 39 | 3300009545 | Ga0105237_10195372 | Ga0105237_101953721 | 308 |
| 40 | 3300009553 | Ga0105249_10085152 | Ga0105249_100851522 | 308 |
| 41 | 3300010375 | Ga0105239_10033298 | Ga0105239_100332984 | 308 |
| 42 | 3300011119 | Ga0105246_10366536 | Ga0105246_103665361 | 308 |
| 43 | 3300013306 | Ga0163162_10084848 | Ga0163162_100848481 | 308 |
| 44 | 3300014325 | Ga0163163_10040592 | Ga0163163_100405923 | 308 |
| 45 | 3300014968 | Ga0157379_10052684 | Ga0157379_100526841 | 308 |
| 46 | 3300025912 | Ga0207707_10112293 | Ga0207707_101122932 | 308 |
| 47 | 3300025933 | Ga0207706_10140847 | Ga0207706_101408472 | 308 |
| 48 | 3300025961 | Ga0207712_10283758 | Ga0207712_102837581 | 308 |
| 49 | 3300026067 | Ga0207678_10409032 | Ga0207678_104090321 | 308 |
| 50 | 3300026078 | Ga0207702_10204402 | Ga0207702_102044022 | 308 |
| 51 | 3300035724 | Ga0373933_0045759 | Ga0373933_0045759_311_1261 | 308 |
| 52 | 3300036401 | Ga0373937_0008623 | Ga0373937_0008623_2121_3071 | 308 |
| 53 | 3300045976 | Ga0466967_0110821 | Ga0466967_0110821_1480_2484 | 308 |
| 54 | 3300046642 | Ga0495634_0226155 | Ga0495634_0226155_10_984 | 308 |
| 55 | 3300048907 | Ga0496104_0086926 | Ga0496104_0086926_104_1066 | 308 |
| 56 | 3300048909 | Ga0496106_0086824 | Ga0496106_0086824_792_1754 | 308 |
| 57 | 3300048911 | Ga0496108_0043406 | Ga0496108_0043406_2601_3563 | 308 |
| 58 | 3300048912 | Ga0496109_0025784 | Ga0496109_0025784_3666_4628 | 308 |
| 59 | 3300048913 | Ga0496110_0126274 | Ga0496110_0126274_458_1420 | 308 |
| 60 | 3300048915 | Ga0496112_0414805 | Ga0496112_0414805_151_1113 | 308 |
| 61 | 3300049590 | Ga0501074_0225910 | Ga0501074_0225910_266_1291 | 308 |
| 62 | 3300053177 | Ga0500636_0035623 | Ga0500636_0035623_1055_2032 | 308 |
| 63 | 3300006844 | Ga0075428_100017851 | Ga0075428_1000178515 | 309 |
| 64 | 3300006846 | Ga0075430_100002551 | Ga0075430_1000025518 | 309 |
| 65 | 3300006847 | Ga0075431_100065617 | Ga0075431_1000656172 | 309 |
| 66 | 3300006847 | Ga0075431_100139341 | Ga0075431_1001393412 | 309 |
| 67 | 3300007076 | Ga0075435_100101798 | Ga0075435_1001017982 | 309 |
| 68 | 3300050509 | nmdc:mga0qj67_1819_c1 | nmdc:mga0qj67_1819_c1_8744_9778 | 309 |
| 69 | 3300050513 | nmdc:mga0rr50_142355_c1 | nmdc:mga0rr50_142355_c1_347_1351 | 309 |
| 70 | 3300006880 | Ga0075429_100089521 | Ga0075429_1000895211 | 310 |
| 71 | 3300009094 | Ga0111539_10279857 | Ga0111539_102798572 | 310 |
| 72 | 3300014326 | Ga0157380_10007371 | Ga0157380_100073714 | 310 |
| 73 | 3300026118 | Ga0207675_100015483 | Ga0207675_1000154836 | 310 |
| 74 | 3300027907 | Ga0207428_10009101 | Ga0207428_100091014 | 310 |
| 75 | 3300032005 | Ga0307411_10046283 | Ga0307411_100462833 | 310 |
| 76 | 3300046499 | Ga0495594_0136971 | Ga0495594_0136971_169_1122 | 310 |
| 77 | 3300049572 | Ga0501036_0025513 | Ga0501036_0025513_2373_3413 | 310 |
| 78 | 3300049572 | Ga0501036_0071391 | Ga0501036_0071391_737_1732 | 310 |
| 79 | 3300049573 | Ga0501037_0033187 | Ga0501037_0033187_1065_2060 | 310 |
| 80 | 3300049574 | Ga0501038_0232303 | Ga0501038_0232303_109_1104 | 310 |
| 81 | 3300049575 | Ga0501039_0017352 | Ga0501039_0017352_2818_3813 | 310 |
| 82 | 3300049576 | Ga0501040_0163026 | Ga0501040_0163026_478_1473 | 310 |
| 83 | 3300049576 | Ga0501040_0191736 | Ga0501040_0191736_343_1386 | 310 |
| 84 | 3300049577 | Ga0501041_0009936 | Ga0501041_0009936_3738_4733 | 310 |
| 85 | 3300049578 | Ga0501042_0067643 | Ga0501042_0067643_25_1020 | 310 |
| 86 | 3300049587 | Ga0501071_0096297 | Ga0501071_0096297_964_1959 | 310 |
| 87 | 3300049588 | Ga0501072_0079841 | Ga0501072_0079841_1347_2420 | 310 |
| 88 | 3300049588 | Ga0501072_0137339 | Ga0501072_0137339_528_1523 | 310 |
| 89 | 3300049591 | Ga0501075_0089342 | Ga0501075_0089342_317_1357 | 310 |
| 90 | 3300049592 | Ga0501076_0006344 | Ga0501076_0006344_1163_2203 | 310 |
| 91 | 3300049592 | Ga0501076_0030895 | Ga0501076_0030895_1111_2073 | 310 |
| 92 | 3300049592 | Ga0501076_0043660 | Ga0501076_0043660_1496_2491 | 310 |
| 93 | 3300049592 | Ga0501076_0100389 | Ga0501076_0100389_1132_2181 | 310 |
| 94 | 3300049741 | Ga0501079_0063209 | Ga0501079_0063209_1608_2570 | 310 |
| 95 | 3300049741 | Ga0501079_0199292 | Ga0501079_0199292_96_1130 | 310 |
| 96 | 3300049742 | Ga0501080_0059058 | Ga0501080_0059058_1065_2060 | 310 |
| 97 | 3300049743 | Ga0501081_0007842 | Ga0501081_0007842_103_1098 | 310 |
| 98 | 3300049743 | Ga0501081_0022000 | Ga0501081_0022000_2589_3629 | 310 |
| 99 | 3300049743 | Ga0501081_0140533 | Ga0501081_0140533_451_1524 | 310 |
| 100 | 3300049822 | Ga0501035_0073791 | Ga0501035_0073791_21_1016 | 310 |
| 101 | 3300049824 | Ga0501045_0023259 | Ga0501045_0023259_605_1645 | 310 |
| 102 | 3300049824 | Ga0501045_0072949 | Ga0501045_0072949_75_1037 | 310 |
| 103 | 3300054114 | Ga0501084_0010327 | Ga0501084_0010327_4447_5409 | 310 |
| 104 | 3300054114 | Ga0501084_0076652 | Ga0501084_0076652_804_1799 | 310 |
| 105 | 3300054114 | Ga0501084_0087851 | Ga0501084_0087851_835_1896 | 310 |
| 106 | 3300060353 | Ga0501082_0006622 | Ga0501082_0006622_2219_3214 | 310 |
| 107 | 3300060353 | Ga0501082_0017854 | Ga0501082_0017854_4076_5038 | 310 |
| 108 | 3300061734 | Ga0530510_0015926 | Ga0530510_0015926_1764_2759 | 310 |
| 109 | 3300005327 | Ga0070658_10026236 | Ga0070658_100262362 | 311 |
| 110 | 3300005331 | Ga0070670_100154233 | Ga0070670_1001542333 | 311 |
| 111 | 3300005353 | Ga0070669_100047347 | Ga0070669_1000473474 | 311 |
| 112 | 3300005456 | Ga0070678_100006102 | Ga0070678_1000061024 | 311 |
| 113 | 3300005548 | Ga0070665_100019184 | Ga0070665_1000191845 | 311 |
| 114 | 3300013297 | Ga0157378_10000445 | Ga0157378_100004456 | 311 |
| 115 | 3300025909 | Ga0207705_10244690 | Ga0207705_102446902 | 311 |
| 116 | 3300025925 | Ga0207650_10038804 | Ga0207650_100388044 | 311 |
| 117 | 3300025926 | Ga0207659_10055548 | Ga0207659_100555483 | 311 |
| 118 | 3300025940 | Ga0207691_10066302 | Ga0207691_100663024 | 311 |
| 119 | 3300026023 | Ga0207677_10062361 | Ga0207677_100623612 | 311 |
| 120 | 3300026121 | Ga0207683_10012734 | Ga0207683_100127344 | 311 |
| 121 | 3300028379 | Ga0268266_10181201 | Ga0268266_101812012 | 311 |
| 122 | 3300046539 | Ga0495621_0073890 | Ga0495621_0073890_110_1075 | 311 |
| 123 | 3300005548 | Ga0070665_100069805 | Ga0070665_1000698053 | 312 |
| 124 | 3300005843 | Ga0068860_100000027 | Ga0068860_10000002778 | 312 |
| 125 | 3300005844 | Ga0068862_100063022 | Ga0068862_1000630224 | 312 |
| 126 | 3300006186 | Ga0075369_10047029 | Ga0075369_100470292 | 312 |
| 127 | 3300006195 | Ga0075366_10070777 | Ga0075366_100707772 | 312 |
| 128 | 3300013306 | Ga0163162_10154410 | Ga0163162_101544102 | 312 |
| 129 | 3300028379 | Ga0268266_10420593 | Ga0268266_104205931 | 312 |
| 130 | 3300028380 | Ga0268265_10004520 | Ga0268265_100045204 | 312 |
| 131 | 3300028381 | Ga0268264_10000181 | Ga0268264_1000018147 | 312 |
| 132 | 3300031852 | Ga0307410_10272426 | Ga0307410_102724261 | 312 |
| 133 | 3300049686 | Ga0501257_001162 | Ga0501257_001162_3756_4715 | 312 |
| 134 | 3300005331 | Ga0070670_100003565 | Ga0070670_1000035659 | 313 |
| 135 | 3300005347 | Ga0070668_100001179 | Ga0070668_10000117915 | 313 |
| 136 | 3300005347 | Ga0070668_100048119 | Ga0070668_1000481193 | 313 |
| 137 | 3300005367 | Ga0070667_100001011 | Ga0070667_10000101116 | 313 |
| 138 | 3300005617 | Ga0068859_100004338 | Ga0068859_10000433810 | 313 |
| 139 | 3300005618 | Ga0068864_100206002 | Ga0068864_1002060022 | 313 |
| 140 | 3300005719 | Ga0068861_100022838 | Ga0068861_1000228383 | 313 |
| 141 | 3300005843 | Ga0068860_100003476 | Ga0068860_10000347617 | 313 |
| 142 | 3300005844 | Ga0068862_100006043 | Ga0068862_10000604310 | 313 |
| 143 | 3300005844 | Ga0068862_100014800 | Ga0068862_1000148003 | 313 |
| 144 | 3300006931 | Ga0097620_100004338 | Ga0097620_10000433810 | 313 |
| 145 | 3300009553 | Ga0105249_10006428 | Ga0105249_100064289 | 313 |
| 146 | 3300025915 | Ga0207693_10021050 | Ga0207693_100210504 | 313 |
| 147 | 3300025925 | Ga0207650_10040822 | Ga0207650_100408222 | 313 |
| 148 | 3300025949 | Ga0207667_10029997 | Ga0207667_100299973 | 313 |
| 149 | 3300025961 | Ga0207712_10071441 | Ga0207712_100714412 | 313 |
| 150 | 3300025972 | Ga0207668_10015983 | Ga0207668_100159831 | 313 |
| 151 | 3300025972 | Ga0207668_10033455 | Ga0207668_100334554 | 313 |
| 152 | 3300025986 | Ga0207658_10081585 | Ga0207658_100815852 | 313 |
| 153 | 3300026118 | Ga0207675_100119845 | Ga0207675_1001198453 | 313 |
| 154 | 3300026142 | Ga0207698_10014316 | Ga0207698_100143162 | 313 |
| 155 | 3300028380 | Ga0268265_10007779 | Ga0268265_100077793 | 313 |
| 156 | 3300028380 | Ga0268265_10173927 | Ga0268265_101739272 | 313 |
| 157 | 3300028381 | Ga0268264_10094233 | Ga0268264_100942332 | 313 |
| 158 | 3300005331 | Ga0070670_100088620 | Ga0070670_1000886203 | 314 |
| 159 | 3300005334 | Ga0068869_100045341 | Ga0068869_1000453414 | 314 |
| 160 | 3300005345 | Ga0070692_10027608 | Ga0070692_100276083 | 314 |
| 161 | 3300005441 | Ga0070700_100269426 | Ga0070700_1002694261 | 314 |
| 162 | 3300005617 | Ga0068859_100027062 | Ga0068859_1000270624 | 314 |
| 163 | 3300005840 | Ga0068870_10023762 | Ga0068870_100237622 | 314 |
| 164 | 3300005844 | Ga0068862_100079553 | Ga0068862_1000795533 | 314 |
| 165 | 3300006931 | Ga0097620_100027061 | Ga0097620_1000270613 | 314 |
| 166 | 3300009174 | Ga0105241_10280358 | Ga0105241_102803581 | 314 |
| 167 | 3300025908 | Ga0207643_10063972 | Ga0207643_100639722 | 314 |
| 168 | 3300025912 | Ga0207707_10203054 | Ga0207707_102030541 | 314 |
| 169 | 3300026075 | Ga0207708_10083589 | Ga0207708_100835892 | 314 |
| 170 | 3300028380 | Ga0268265_10437488 | Ga0268265_104374882 | 314 |
| 171 | 3300005467 | Ga0070706_100000250 | Ga0070706_10000025030 | 315 |
| 172 | 3300025910 | Ga0207684_10000093 | Ga0207684_1000009330 | 315 |
| 173 | 3300038443 | Ga0395901_0408239 | Ga0395901_0408239_140_1099 | 315 |
| 174 | 3300005719 | Ga0068861_100380462 | Ga0068861_1003804622 | 316 |
| 175 | 3300005842 | Ga0068858_100294983 | Ga0068858_1002949831 | 316 |
| 176 | 3300009551 | Ga0105238_10005585 | Ga0105238_100055856 | 316 |
| 177 | 3300025924 | Ga0207694_10019436 | Ga0207694_100194362 | 316 |
| 178 | 3300035117 | Ga0373953_0066762 | Ga0373953_0066762_162_1253 | 316 |
| 179 | 3300049572 | Ga0501036_0034301 | Ga0501036_0034301_1066_2052 | 316 |
| 180 | 3300049573 | Ga0501037_0154565 | Ga0501037_0154565_72_1058 | 316 |
| 181 | 3300049575 | Ga0501039_0103173 | Ga0501039_0103173_459_1445 | 316 |
| 182 | 3300049576 | Ga0501040_0028607 | Ga0501040_0028607_904_1890 | 316 |
| 183 | 3300049577 | Ga0501041_0025356 | Ga0501041_0025356_2200_3186 | 316 |
| 184 | 3300049580 | Ga0501046_0019416 | Ga0501046_0019416_1877_2863 | 316 |
| 185 | 3300049582 | Ga0501048_0046576 | Ga0501048_0046576_520_1506 | 316 |
| 186 | 3300049584 | Ga0501068_0095692 | Ga0501068_0095692_311_1297 | 316 |
| 187 | 3300049587 | Ga0501071_0052320 | Ga0501071_0052320_151_1137 | 316 |
| 188 | 3300049590 | Ga0501074_0061620 | Ga0501074_0061620_94_1080 | 316 |
| 189 | 3300049591 | Ga0501075_0003341 | Ga0501075_0003341_647_1633 | 316 |
| 190 | 3300049592 | Ga0501076_0001566 | Ga0501076_0001566_12983_13969 | 316 |
| 191 | 3300049593 | Ga0501077_0047104 | Ga0501077_0047104_1590_2576 | 316 |
| 192 | 3300049741 | Ga0501079_0015512 | Ga0501079_0015512_2215_3201 | 316 |
| 193 | 3300049742 | Ga0501080_0367414 | Ga0501080_0367414_79_1065 | 316 |
| 194 | 3300049743 | Ga0501081_0002186 | Ga0501081_0002186_7781_8767 | 316 |
| 195 | 3300049744 | Ga0501083_0049065 | Ga0501083_0049065_1252_2238 | 316 |
| 196 | 3300049822 | Ga0501035_0387309 | Ga0501035_0387309_129_1115 | 316 |
| 197 | 3300049824 | Ga0501045_0041184 | Ga0501045_0041184_339_1325 | 316 |
| 198 | 3300050512 | nmdc:mga0n895_104222_c1 | nmdc:mga0n895_104222_c1_1467_2432 | 316 |
| 199 | 3300050515 | nmdc:mga0a205_517532_c1 | nmdc:mga0a205_517532_c1_58_1023 | 316 |
| 200 | 3300054114 | Ga0501084_0023831 | Ga0501084_0023831_1333_2319 | 316 |
| 201 | 3300060353 | Ga0501082_0005596 | Ga0501082_0005596_2260_3246 | 316 |
| 202 | 3300061734 | Ga0530510_0005821 | Ga0530510_0005821_475_1461 | 316 |
| 203 | 3300037418 | Ga0395900_0267807 | Ga0395900_0267807_128_1084 | 318 |
| 204 | 3300038443 | Ga0395901_0358803 | Ga0395901_0358803_52_1008 | 318 |
| 205 | 3300005293 | Ga0065715_10004730 | Ga0065715_100047303 | 319 |
| 206 | 3300005441 | Ga0070700_100000044 | Ga0070700_1000000446 | 319 |
| 207 | 3300005444 | Ga0070694_100050017 | Ga0070694_1000500172 | 319 |
| 208 | 3300005458 | Ga0070681_10013254 | Ga0070681_100132546 | 319 |
| 209 | 3300005518 | Ga0070699_100001836 | Ga0070699_10000183610 | 319 |
| 210 | 3300005546 | Ga0070696_100049941 | Ga0070696_1000499412 | 319 |
| 211 | 3300005547 | Ga0070693_100020170 | Ga0070693_1000201702 | 319 |
| 212 | 3300005617 | Ga0068859_100011796 | Ga0068859_1000117966 | 319 |
| 213 | 3300006852 | Ga0075433_10175954 | Ga0075433_101759542 | 319 |
| 214 | 3300006931 | Ga0097620_100011797 | Ga0097620_1000117975 | 319 |
| 215 | 3300009177 | Ga0105248_10020847 | Ga0105248_100208473 | 319 |
| 216 | 3300009545 | Ga0105237_10120309 | Ga0105237_101203093 | 319 |
| 217 | 3300010375 | Ga0105239_10226838 | Ga0105239_102268381 | 319 |
| 218 | 3300014325 | Ga0163163_10736194 | Ga0163163_107361941 | 319 |
| 219 | 3300026075 | Ga0207708_10000031 | Ga0207708_1000003177 | 319 |
| 220 | 3300031548 | Ga0307408_100013551 | Ga0307408_1000135513 | 319 |
| 221 | 3300031731 | Ga0307405_10011045 | Ga0307405_100110453 | 319 |
| 222 | 3300031824 | Ga0307413_10021774 | Ga0307413_100217742 | 319 |
| 223 | 3300031901 | Ga0307406_10002945 | Ga0307406_100029453 | 319 |
| 224 | 3300031995 | Ga0307409_100069411 | Ga0307409_1000694113 | 319 |
| 225 | 3300032004 | Ga0307414_10002214 | Ga0307414_100022143 | 319 |
| 226 | 3300032126 | Ga0307415_100008962 | Ga0307415_1000089623 | 319 |
| 227 | 3300034818 | Ga0373950_0000033 | Ga0373950_0000033_29769_30809 | 319 |
| 228 | 3300035086 | Ga0373934_0040306 | Ga0373934_0040306_500_1534 | 319 |
| 229 | 3300035117 | Ga0373953_0022142 | Ga0373953_0022142_1087_2121 | 319 |
| 230 | 3300035118 | Ga0373954_0014993 | Ga0373954_0014993_1186_2220 | 319 |
| 231 | 3300035119 | Ga0373956_0033455 | Ga0373956_0033455_1185_2219 | 319 |
| 232 | 3300035120 | Ga0373957_0029628 | Ga0373957_0029628_148_1182 | 319 |
| 233 | 3300035172 | Ga0373955_0004557 | Ga0373955_0004557_3773_4807 | 319 |
| 234 | 3300035724 | Ga0373933_0044336 | Ga0373933_0044336_142_1176 | 319 |
| 235 | 3300036401 | Ga0373937_0042004 | Ga0373937_0042004_2533_3567 | 319 |
| 236 | 3300036401 | Ga0373937_0153538 | Ga0373937_0153538_278_1312 | 319 |
| 237 | 3300038443 | Ga0395901_0208172 | Ga0395901_0208172_210_1175 | 319 |
| 238 | 3300042157 | Ga0439458_0003126 | Ga0439458_0003126_448_1407 | 319 |
| 239 | 3300046454 | Ga0495592_0040564 | Ga0495592_0040564_912_1946 | 319 |
| 240 | 3300046454 | Ga0495592_0142557 | Ga0495592_0142557_41_1075 | 319 |
| 241 | 3300046461 | Ga0495641_0071979 | Ga0495641_0071979_186_1232 | 319 |
| 242 | 3300046462 | Ga0495651_0118695 | Ga0495651_0118695_858_1892 | 319 |
| 243 | 3300046472 | Ga0495580_0169425 | Ga0495580_0169425_74_1129 | 319 |
| 244 | 3300046473 | Ga0495582_0004933 | Ga0495582_0004933_4549_5595 | 319 |
| 245 | 3300046473 | Ga0495582_0006289 | Ga0495582_0006289_3481_4536 | 319 |
| 246 | 3300046511 | Ga0495608_0005669 | Ga0495608_0005669_6133_7167 | 319 |
| 247 | 3300046516 | Ga0495628_0000913 | Ga0495628_0000913_23706_24740 | 319 |
| 248 | 3300046536 | Ga0495587_0071020 | Ga0495587_0071020_351_1385 | 319 |
| 249 | 3300046559 | Ga0495667_0036384 | Ga0495667_0036384_1001_2035 | 319 |
| 250 | 3300046642 | Ga0495634_0145733 | Ga0495634_0145733_426_1472 | 319 |
| 251 | 3300046663 | Ga0495635_0000710 | Ga0495635_0000710_12598_13644 | 319 |
| 252 | 3300046675 | Ga0495657_0033222 | Ga0495657_0033222_2223_3257 | 319 |
| 253 | 3300046678 | Ga0495599_0058057 | Ga0495599_0058057_748_1782 | 319 |
| 254 | 3300046683 | Ga0495658_0000018 | Ga0495658_0000018_1799_2845 | 319 |
| 255 | 3300046689 | Ga0495613_0044348 | Ga0495613_0044348_1245_2291 | 319 |
| 256 | 3300046689 | Ga0495613_0126866 | Ga0495613_0126866_90_1145 | 319 |
| 257 | 3300047315 | Ga0495581_0000323 | Ga0495581_0000323_7837_8883 | 319 |
| 258 | 3300047322 | Ga0495680_0001669 | Ga0495680_0001669_7811_8857 | 319 |
| 259 | 3300047322 | Ga0495680_0020114 | Ga0495680_0020114_2708_3742 | 319 |
| 260 | 3300047322 | Ga0495680_0051296 | Ga0495680_0051296_405_1439 | 319 |
| 261 | 3300048089 | Ga0495614_0015718 | Ga0495614_0015718_1858_2904 | 319 |
| 262 | 3300048089 | Ga0495614_0059753 | Ga0495614_0059753_100_1155 | 319 |
| 263 | 3300049571 | Ga0501034_0000047 | Ga0501034_0000047_84686_85720 | 319 |
| 264 | 3300049572 | Ga0501036_0085146 | Ga0501036_0085146_1244_2311 | 319 |
| 265 | 3300049579 | Ga0501043_0001462 | Ga0501043_0001462_6181_7215 | 319 |
| 266 | 3300049580 | Ga0501046_0000717 | Ga0501046_0000717_397_1431 | 319 |
| 267 | 3300049581 | Ga0501047_0000034 | Ga0501047_0000034_112275_113309 | 319 |
| 268 | 3300049582 | Ga0501048_0098671 | Ga0501048_0098671_989_2023 | 319 |
| 269 | 3300049584 | Ga0501068_0018327 | Ga0501068_0018327_967_2001 | 319 |
| 270 | 3300049586 | Ga0501070_0004503 | Ga0501070_0004503_5096_6130 | 319 |
| 271 | 3300049588 | Ga0501072_0000010 | Ga0501072_0000010_108984_110018 | 319 |
| 272 | 3300049589 | Ga0501073_0007609 | Ga0501073_0007609_5099_6133 | 319 |
| 273 | 3300049590 | Ga0501074_0000678 | Ga0501074_0000678_4493_5527 | 319 |
| 274 | 3300049705 | Ga0501225_0000510 | Ga0501225_0000510_2700_3674 | 319 |
| 275 | 3300049741 | Ga0501079_0008242 | Ga0501079_0008242_4765_5799 | 319 |
| 276 | 3300049742 | Ga0501080_0008281 | Ga0501080_0008281_8092_9126 | 319 |
| 277 | 3300049744 | Ga0501083_0135040 | Ga0501083_0135040_165_1199 | 319 |
| 278 | 3300049853 | Ga0501226_000530 | Ga0501226_000530_2530_3504 | 319 |
| 279 | 3300053084 | Ga0495595_0014082 | Ga0495595_0014082_626_1660 | 319 |
| 280 | 3300053085 | Ga0495619_0000898 | Ga0495619_0000898_4668_5714 | 319 |
| 281 | 3300054114 | Ga0501084_0000080 | Ga0501084_0000080_19486_20520 | 319 |
| 282 | 3300060353 | Ga0501082_0039319 | Ga0501082_0039319_269_1303 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6swi-assembly1.cif.gz_A | the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus | 0.9656 | 212 | 315 |
| 3w6v-assembly1.cif.gz_A | crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna | 0.9639 | 218 | 314 |
| 3lsg-assembly3.cif.gz_E | the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 | 0.9405 | 212 | 306 |
| 3lsg-assembly1.cif.gz_A | the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 | 0.9377 | 212 | 312 |
| 1u8b-assembly1.cif.gz_A | crystal structure of the methylated n-ada/dna complex | 0.9337 | 213 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lsgA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9884 | 270 | 312 | 1.10.10.60 |
| 1d5yD02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9877 | 266 | 313 | 1.10.10.60 |
| af_P32677_219_275_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9732 | 266 | 319 | 1.10.10.60 |
| 1bl0A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9665 | 270 | 312 | 1.10.10.60 |
| 3w6vA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9639 | 218 | 314 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5Q4T4C4-F1-model_v4 | AraC family transcriptional regulator | 0.9815 | 218 | 314 |
GO:0003700
GO:0043565 |
| AF-A0A172TL64-F1-model_v4 | HTH araC/xylS-type domain-containing protein | 0.9802 | 212 | 313 |
GO:0003700
GO:0006281 GO:0008168 GO:0008270 GO:0032259 GO:0043565 |
| AF-A0A7J9ZUH7-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.977 | 211 | 313 |
GO:0003700
GO:0043565 |
| AF-A0A763GNR6-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9749 | 224 | 312 |
GO:0003700
GO:0043565 |
| AF-F1TEY5-F1-model_v4 | Transcriptional regulator, AraC family | 0.9719 | 218 | 314 |
GO:0003700
GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar