F384927

General Info

Members Datasets Scaffolds Average Seq Length
282 176 283 379

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10110201|Ga0157378_101102014
Length 417
Sequence MFTGTGDPPAQVSHRAGQKVRFLLGLLFPMSKITMKQIYLDYAAATPMDPAVIKAMQPYLSDKFYNPSATYLPAQAVAKDLAAARAKVAQILGAKPAEIVFTAGGTEANNLAIHGIMRRYSKAQIITSAIEHESVLQPASLYEHLEAPVKKDGSLDLDKLTKHVTDNTVLISVMYANNEIGTIQPIKAVAQLIVNIRQQRQKKGNKLPIYLHTDACQTANYLDLHVSRLGIDLMTLNGGKIYGPKQSGVLYVRAGVELEPLIYGGGHERGLRSGTENVAADVGFATALELAQTKRAEETRRLQALQQDFFGLIAKHLPTASINGSQKNRLPNNVNLTLPGQDNERLLIKLEEKGVLAAAGSACSASNEEPSHVLSAIGLSDKDAQASLRLTMGQATTAADVTKTVIVLAEIVHNPNH

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
97 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
98 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
161 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
164 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
165 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
166 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
167 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
168 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
169 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
170 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
173 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
174 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.02
Nodule 0
Rhizoplane 0.35
Rhizosphere 79.08
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10001133 3300002067 Bacteria 9527
2 rootH1_10006015 3300003316 Unclassified 2829
3 rootH1_10006015 3300003323 Bacteria 1869
4 rootH2_10000244 3300003320 Bacteria 697651
5 rootH2_10000763 3300003320 Bacteria 99150
6 rootH1_10093195 3300003323 Bacteria 12313
7 Ga0070658_10000015 3300005327 Bacteria 230579
8 Ga0070658_10000061 3300005327 Bacteria 108607
9 Ga0070658_10000724 3300005327 Bacteria 28557
10 Ga0070658_10007313 3300005327 Bacteria 8920
11 Ga0070658_10023531 3300005327 Bacteria 4943
12 Ga0070666_10014639 3300005335 Bacteria 4995
13 Ga0070666_10015295 3300005335 Bacteria 4893
14 Ga0070680_100019996 3300005336 Bacteria 5308
15 Ga0070682_100002230 3300005337 Bacteria 10751
16 Ga0070682_100002702 3300005337 Bacteria 9814
17 Ga0068868_100027976 3300005338 Bacteria 4304
18 Ga0070660_100000121 3300005339 Bacteria 49401
19 Ga0070660_100000265 3300005339 Bacteria 34665
20 Ga0070660_100002047 3300005339 Bacteria 13909
21 Ga0070691_10004201 3300005341 Bacteria 6547
22 Ga0070671_100012439 3300005355 Bacteria 6853
23 Ga0070674_100016591 3300005356 Unclassified 4617
24 Ga0070673_100000373 3300005364 Bacteria 23472
25 Ga0070673_100084753 3300005364 Bacteria 2578
26 Ga0070659_100000287 3300005366 Bacteria 39394
27 Ga0070667_100000001 3300005367 Bacteria 1108638
28 Ga0070667_100002152 3300005367 Bacteria 17352
29 Ga0070714_100006348 3300005435 Bacteria 9118
30 Ga0070678_100001558 3300005456 Bacteria 12268
31 Ga0070681_10051077 3300005458 Bacteria 4124
32 Ga0068867_100004448 3300005459 Bacteria 9856
33 Ga0070685_10000213 3300005466 Bacteria 38632
34 Ga0070685_10003592 3300005466 Bacteria 7873
35 Ga0070679_100009595 3300005530 Bacteria 9154
36 Ga0070679_100021090 3300005530 Bacteria 6358
37 Ga0070679_100032001 3300005530 Bacteria 5202
38 Ga0070679_100175837 3300005530 Unclassified 2113
39 Ga0070684_100061850 3300005535 Bacteria 3278
40 Ga0068853_100060578 3300005539 Bacteria 3271
41 Ga0070672_100090221 3300005543 Unclassified 2471
42 Ga0070665_100009248 3300005548 Bacteria 9982
43 Ga0070665_100269456 3300005548 Unclassified 1704
44 Ga0068855_100000413 3300005563 Bacteria 52993
45 Ga0068855_100016999 3300005563 Bacteria 8749
46 Ga0068855_100324117 3300005563 Unclassified 1702
47 Ga0068857_100000012 3300005577 Bacteria 106243
48 Ga0068857_100101622 3300005577 Bacteria 2580
49 Ga0068856_100000037 3300005614 Bacteria 120033
50 Ga0068856_100004747 3300005614 Bacteria 13490
51 Ga0068856_100048842 3300005614 Bacteria 4171
52 Ga0068852_100058710 3300005616 Bacteria 3334
53 Ga0068863_100007191 3300005841 Bacteria 10920
54 Ga0068863_100166727 3300005841 Bacteria 2112
55 Ga0068858_100025332 3300005842 Bacteria 5521
56 Ga0068860_100064288 3300005843 Bacteria 3485
57 Ga0081455_10000001 3300005937 Bacteria 603871
58 Ga0075365_10000008 3300006038 Bacteria 114620
59 Ga0075365_10000293 3300006038 Bacteria 17345
60 Ga0075365_10005078 3300006038 Bacteria 7065
61 Ga0075368_10000639 3300006042 Bacteria 10627
62 Ga0075364_10000236 3300006051 Bacteria 26316
63 Ga0075364_10023060 3300006051 Bacteria 3938
64 Ga0075362_10014469 3300006177 Bacteria 3186
65 Ga0075367_10007554 3300006178 Bacteria 5576
66 Ga0075370_10007511 3300006353 Bacteria 5555
67 Ga0075428_100002220 3300006844 Bacteria 21042
68 Ga0105240_10000003 3300009093 Bacteria 1183681
69 Ga0105240_10178990 3300009093 Bacteria 2504
70 Ga0111539_10002081 3300009094 Bacteria 26737
71 Ga0111539_10070592 3300009094 Bacteria 4123
72 Ga0105245_10000001 3300009098 Bacteria 939270
73 Ga0105245_10000034 3300009098 Bacteria 147951
74 Ga0105245_10000564 3300009098 Bacteria 33746
75 Ga0105243_10000001 3300009148 Bacteria 1156578
76 Ga0105243_10221289 3300009148 Bacteria 1673
77 Ga0105242_10000001 3300009176 Bacteria 574039
78 Ga0105242_10003728 3300009176 Bacteria 11846
79 Ga0105249_10003284 3300009553 Bacteria 14019
80 Ga0105032_100001 3300009979 Bacteria 472394
81 Ga0105239_10036677 3300010375 Bacteria 5380
82 Ga0105239_10105692 3300010375 Bacteria 3118
83 Ga0105239_10121768 3300010375 Bacteria 2898
84 Ga0157370_10000168 3300013104 Bacteria 80700
85 Ga0157369_10003043 3300013105 Bacteria 20014
86 Ga0157369_10028032 3300013105 Bacteria 6237
87 Ga0157369_10037275 3300013105 Bacteria 5323
88 Ga0157369_10193394 3300013105 Bacteria 2137
89 Ga0157374_10000269 3300013296 Bacteria 48118
90 Ga0157374_10004883 3300013296 Bacteria 11250
91 Ga0157378_10110201 3300013297 Bacteria 2523
92 Ga0157372_10000057 3300013307 Bacteria 125915
93 Ga0157372_10000160 3300013307 Bacteria 73603
94 Ga0157372_10190943 3300013307 Bacteria 2373
95 Ga0157377_10014002 3300014745 Bacteria 4073
96 Ga0157376_10000001 3300014969 Bacteria 842910
97 Ga0213874_10011370 3300021377 Bacteria 2253
98 Ga0207680_10000290 3300025903 Bacteria 24047
99 Ga0207647_10000039 3300025904 Bacteria 93576
100 Ga0207705_10000011 3300025909 Bacteria 517768
101 Ga0207705_10000202 3300025909 Bacteria 60086
102 Ga0207705_10000264 3300025909 Bacteria 50559
103 Ga0207705_10003246 3300025909 Bacteria 12383
104 Ga0207705_10004415 3300025909 Bacteria 10633
105 Ga0207705_10030031 3300025909 Bacteria 3877
106 Ga0207707_10028031 3300025912 Bacteria 4923
107 Ga0207695_10000005 3300025913 Bacteria 1196715
108 Ga0207660_10004945 3300025917 Bacteria 8686
109 Ga0207657_10000772 3300025919 Bacteria 33957
110 Ga0207657_10001705 3300025919 Bacteria 23697
111 Ga0207652_10008162 3300025921 Bacteria 8407
112 Ga0207652_10047701 3300025921 Bacteria 3659
113 Ga0207687_10000001 3300025927 Bacteria 1130810
114 Ga0207687_10000004 3300025927 Bacteria 841177
115 Ga0207687_10000101 3300025927 Bacteria 62126
116 Ga0207687_10029704 3300025927 Bacteria 3678
117 Ga0207664_10000253 3300025929 Bacteria 40265
118 Ga0207644_10114273 3300025931 Bacteria 2045
119 Ga0207690_10000901 3300025932 Bacteria 18972
120 Ga0207686_10000001 3300025934 Bacteria 1169580
121 Ga0207686_10004571 3300025934 Bacteria 7415
122 Ga0207709_10000002 3300025935 Bacteria 1171536
123 Ga0207691_10017829 3300025940 Bacteria 6728
124 Ga0207661_10000110 3300025944 Bacteria 51908
125 Ga0207667_10000060 3300025949 Bacteria 192320
126 Ga0207667_10015213 3300025949 Bacteria 8749
127 Ga0207667_10051930 3300025949 Bacteria 4320
128 Ga0207667_10119189 3300025949 Bacteria 2720
129 Ga0207667_10209238 3300025949 Unclassified 1999
130 Ga0207651_10033921 3300025960 Bacteria 3298
131 Ga0207712_10002293 3300025961 Bacteria 12418
132 Ga0207658_10000003 3300025986 Bacteria 1151934
133 Ga0207658_10161627 3300025986 Bacteria 1836
134 Ga0207703_10221692 3300026035 Bacteria 1691
135 Ga0207639_10022794 3300026041 Bacteria 4514
136 Ga0207702_10000001 3300026078 Bacteria 895738
137 Ga0207702_10002414 3300026078 Bacteria 17778
138 Ga0207641_10031083 3300026088 Bacteria 4427
139 Ga0207648_10058947 3300026089 Bacteria 3348
140 Ga0207674_10000015 3300026116 Bacteria 183445
141 Ga0207674_10218256 3300026116 Bacteria 1855
142 Ga0207683_10001654 3300026121 Bacteria 19947
143 Ga0207698_10039564 3300026142 Bacteria 3495
144 Ga0207428_10052329 3300027907 Bacteria 3261
145 Ga0268266_10003987 3300028379 Bacteria 14310
146 Ga0268266_10012044 3300028379 Bacteria 7486
147 Ga0268264_10143114 3300028381 Bacteria 2135
148 Ga0265337_1000158 3300028556 Bacteria 34604
149 Ga0265337_1006918 3300028556 Bacteria 4306
150 Ga0265337_1021912 3300028556 Bacteria 1986
151 Ga0265326_10000564 3300028558 Bacteria 13844
152 Ga0265326_10022491 3300028558 Unclassified 1805
153 Ga0265334_10000059 3300028573 Bacteria 79953
154 Ga0265334_10004717 3300028573 Bacteria 6001
155 Ga0265334_10008744 3300028573 Bacteria 4301
156 Ga0265322_10026122 3300028654 Unclassified 1669
157 Ga0265336_10000205 3300028666 Bacteria 41378
158 Ga0265336_10004614 3300028666 Bacteria 5172
159 Ga0265336_10005673 3300028666 Bacteria 4577
160 Ga0265338_10000039 3300028800 Bacteria 236135
161 Ga0265338_10000427 3300028800 Bacteria 75518
162 Ga0265338_10000969 3300028800 Bacteria 48318
163 Ga0265338_10001232 3300028800 Bacteria 42281
164 Ga0265338_10002078 3300028800 Bacteria 30915
165 Ga0265338_10043073 3300028800 Unclassified 4192
166 Ga0265338_10064584 3300028800 Bacteria 3182
167 Ga0265324_10004558 3300029957 Bacteria 6205
168 Ga0316179_1078429 3300030734 Bacteria 15213
169 Ga0316180_1077328 3300030736 Bacteria 3034
170 Ga0316182_1214308 3300030745 Bacteria 13254
171 Ga0316182_1278681 3300030745 Unclassified 2480
172 Ga0265320_10027204 3300031240 Archaea 2985
173 Ga0265320_10077362 3300031240 Bacteria 1557
174 Ga0265325_10004474 3300031241 Bacteria 8827
175 Ga0265340_10000377 3300031247 Bacteria 23690
176 Ga0265339_10084950 3300031249 Unclassified 1667
177 Ga0265327_10000025 3300031251 Bacteria 380054
178 Ga0265327_10005620 3300031251 Bacteria 10383
179 Ga0265313_10035010 3300031595 Unclassified 2533
180 Ga0307516_10000091 3300031730 Bacteria 101445
181 Ga0373959_0000395 3300034820 Bacteria 8646
182 Ga0395899_0011842 3300037312 Bacteria 6678
183 Ga0395899_0107490 3300037312 Unclassified 2008
184 Ga0395900_0000305 3300037418 Bacteria 73205
185 Ga0395900_0061254 3300037418 Unclassified 3869
186 Ga0395900_0143340 3300037418 Bacteria 2445
187 Ga0395900_0353231 3300037418 Unclassified 1443
188 Ga0395898_0006423 3300037466 Bacteria 12556
189 Ga0395905_0012827 3300037471 Bacteria 8058
190 Ga0395905_0208610 3300037471 Unclassified 1831
191 Ga0436364_0395628 3300037853 Unclassified 2586
192 Ga0395901_0001031 3300038443 Bacteria 30174
193 Ga0395901_0011862 3300038443 Bacteria 8836
194 Ga0395901_0014123 3300038443 Bacteria 8131
195 Ga0395901_0024829 3300038443 Bacteria 6152
196 Ga0395901_0097046 3300038443 Unclassified 3089
197 Ga0436365_0818622 3300039437 Bacteria 1231
198 Ga0436365_1872566 3300039437 Bacteria 1514
199 Ga0436362_0798939 3300039453 Unclassified 2339
200 Ga0439445_0000860 3300042004 Bacteria 6441
201 Ga0439432_009234 3300042006 Unclassified 3443
202 Ga0466972_0013711 3300044658 Bacteria 4067
203 Ga0466965_0000229 3300044683 Bacteria 17865
204 Ga0466967_0217281 3300045976 Bacteria 1815
205 Ga0495638_0000061 3300046460 Bacteria 188551
206 Ga0495597_0014113 3300046542 Bacteria 3809
207 Ga0495671_0078013 3300046692 Unclassified 1624
208 Ga0495660_0000005 3300046810 Bacteria 574567
209 Ga0495672_0000010 3300047320 Bacteria 545038
210 Ga0495686_0006364 3300047472 Bacteria 9058
211 Ga0496112_0057835 3300048915 Bacteria 3818
212 Ga0496124_0070669 3300048927 Bacteria 2895
213 Ga0501032_0003672 3300049569 Bacteria 11671
214 Ga0501034_0000028 3300049571 Bacteria 255803
215 Ga0501034_0000500 3300049571 Bacteria 63471
216 Ga0501034_0001996 3300049571 Bacteria 25818
217 Ga0501034_0003872 3300049571 Bacteria 16844
218 Ga0501036_0001152 3300049572 Bacteria 20098
219 Ga0501037_0000001 3300049573 Bacteria 753276
220 Ga0501037_0000031 3300049573 Bacteria 133137
221 Ga0501037_0012827 3300049573 Bacteria 6176
222 Ga0501038_0010477 3300049574 Bacteria 8480
223 Ga0501039_0023320 3300049575 Bacteria 4751
224 Ga0501042_0136687 3300049578 Bacteria 1767
225 Ga0501043_0000469 3300049579 Bacteria 36052
226 Ga0501043_0077566 3300049579 Bacteria 2610
227 Ga0501043_0230647 3300049579 Unclassified 1430
228 Ga0501046_0000189 3300049580 Bacteria 63296
229 Ga0501047_0000032 3300049581 Bacteria 208294
230 Ga0501047_0002499 3300049581 Bacteria 17527
231 Ga0501048_0000574 3300049582 Bacteria 26120
232 Ga0501067_0010349 3300049583 Bacteria 5161
233 Ga0501070_0003832 3300049586 Bacteria 12982
234 Ga0501073_0000001 3300049589 Bacteria 677932
235 Ga0501074_0032767 3300049590 Bacteria 3764
236 Ga0501077_0062202 3300049593 Bacteria 2368
237 Ga0501080_0000086 3300049742 Bacteria 62532
238 Ga0501083_0005193 3300049744 Bacteria 9213
239 Ga0501035_0001029 3300049822 Bacteria 29304
240 Ga0501044_0008578 3300049823 Bacteria 11195
241 nmdc:mga03683_1163_c1 3300050489 Bacteria 7736
242 nmdc:mga00v17_160_c1 3300050491 Bacteria 16634
243 nmdc:mga00v17_211_c1 3300050491 Bacteria 35324
244 nmdc:mga0yw44_18082_c1 3300050492 Bacteria 3853
245 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
246 nmdc:mga0yw44_24216_c1 3300050492 Unclassified 3432
247 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
248 nmdc:mga07m45_187476_c1 3300050496 Unclassified 1203
249 nmdc:mga08y16_6599_c1 3300050511 Bacteria 12172
250 nmdc:mga0sz30_159684_c1 3300050516 Bacteria 998
251 Ga0500643_000264 3300053087 Bacteria 46383
252 Ga0500643_001279 3300053087 Bacteria 14856
253 Ga0500644_0006580 3300053088 Bacteria 2986
254 Ga0500646_0000075 3300053090 Bacteria 28149
255 Ga0500646_0001041 3300053090 Bacteria 7583
256 Ga0500646_0001732 3300053090 Bacteria 5735
257 Ga0500583_0004315 3300053092 Bacteria 4619
258 Ga0500651_0000001 3300053093 Bacteria 529808
259 Ga0500651_0000017 3300053093 Bacteria 156318
260 Ga0500651_0011851 3300053093 Bacteria 5269
261 Ga0500641_0000001 3300053096 Bacteria 1115973
262 Ga0500650_0000001 3300053098 Bacteria 818797
263 Ga0500555_000009 3300053103 Bacteria 263998
264 Ga0500556_0000475 3300053104 Bacteria 28131
265 Ga0500569_000014 3300053109 Bacteria 50618
266 Ga0500593_000001 3300053117 Bacteria 784404
267 Ga0500593_056194 3300053117 Unclassified 1738
268 Ga0500594_0000001 3300053118 Bacteria 1178472
269 Ga0500594_0000074 3300053118 Bacteria 31465
270 Ga0500594_0000379 3300053118 Bacteria 9938
271 Ga0500614_000265 3300053123 Bacteria 13520
272 Ga0500628_000008 3300053129 Bacteria 151664
273 Ga0500628_000118 3300053129 Bacteria 16729
274 Ga0500652_000001 3300053131 Bacteria 946868
275 Ga0500655_000233 3300053133 Bacteria 13340
276 Ga0500561_0000001 3300053137 Bacteria 957685
277 Ga0500577_0001159 3300053142 Bacteria 6742
278 Ga0500579_000849 3300053143 Bacteria 17560
279 Ga0500588_0000029 3300053146 Bacteria 32025
280 Ga0500570_000030 3300053724 Bacteria 35041
281 Ga0501082_0001231 3300060353 Bacteria 22509
282 Ga0501082_0016048 3300060353 Bacteria 6443
283 Ga0530510_0001662 3300061734 Bacteria 15055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_159684_c1 nmdc:mga0sz30_159684_c1_37_954 301
2 3300009094 Ga0111539_10070592 Ga0111539_100705924 344
3 3300037418 Ga0395900_0353231 Ga0395900_0353231_272_1405 350
4 3300038443 Ga0395901_0024829 Ga0395901_0024829_1058_2191 350
5 3300050496 nmdc:mga07m45_187476_c1 nmdc:mga07m45_187476_c1_74_1159 352
6 3300053090 Ga0500646_0001732 Ga0500646_0001732_2368_3453 352
7 3300049583 Ga0501067_0010349 Ga0501067_0010349_4030_5124 353
8 3300006844 Ga0075428_100002220 Ga0075428_1000022205 355
9 3300061734 Ga0530510_0001662 Ga0530510_0001662_130_1308 355
10 3300049569 Ga0501032_0003672 Ga0501032_0003672_943_2094 357
11 3300049571 Ga0501034_0001996 Ga0501034_0001996_6006_7157 357
12 3300049572 Ga0501036_0001152 Ga0501036_0001152_14404_15555 357
13 3300049573 Ga0501037_0000031 Ga0501037_0000031_50223_51374 357
14 3300049574 Ga0501038_0010477 Ga0501038_0010477_1446_2597 357
15 3300049578 Ga0501042_0136687 Ga0501042_0136687_242_1393 357
16 3300049579 Ga0501043_0000469 Ga0501043_0000469_9723_10874 357
17 3300049580 Ga0501046_0000189 Ga0501046_0000189_32384_33535 357
18 3300049581 Ga0501047_0000032 Ga0501047_0000032_99049_100200 357
19 3300049582 Ga0501048_0000574 Ga0501048_0000574_10007_11158 357
20 3300049586 Ga0501070_0003832 Ga0501070_0003832_3286_4437 357
21 3300049822 Ga0501035_0001029 Ga0501035_0001029_11462_12613 357
22 3300049823 Ga0501044_0008578 Ga0501044_0008578_7036_8187 357
23 3300053129 Ga0500628_000118 Ga0500628_000118_626_1735 357
24 3300060353 Ga0501082_0016048 Ga0501082_0016048_2288_3439 357
25 3300013307 Ga0157372_10000057 Ga0157372_1000005793 359
26 3300005616 Ga0068852_100058710 Ga0068852_1000587103 360
27 3300026142 Ga0207698_10039564 Ga0207698_100395643 360
28 3300028573 Ga0265334_10000059 Ga0265334_1000005955 360
29 3300028800 Ga0265338_10001232 Ga0265338_1000123217 360
30 3300031240 Ga0265320_10077362 Ga0265320_100773622 360
31 3300031247 Ga0265340_10000377 Ga0265340_1000037718 360
32 3300013105 Ga0157369_10193394 Ga0157369_101933943 361
33 3300048927 Ga0496124_0070669 Ga0496124_0070669_1404_2549 361
34 3300005327 Ga0070658_10007313 Ga0070658_100073136 362
35 3300025909 Ga0207705_10030031 Ga0207705_100300314 362
36 3300028573 Ga0265334_10008744 Ga0265334_100087444 362
37 3300031251 Ga0265327_10005620 Ga0265327_100056208 362
38 3300010375 Ga0105239_10121768 Ga0105239_101217681 364
39 3300005435 Ga0070714_100006348 Ga0070714_1000063485 365
40 3300005458 Ga0070681_10051077 Ga0070681_100510771 365
41 3300025912 Ga0207707_10028031 Ga0207707_100280315 365
42 3300025929 Ga0207664_10000253 Ga0207664_1000025317 365
43 3300009148 Ga0105243_10221289 Ga0105243_102212892 366
44 3300028556 Ga0265337_1021912 Ga0265337_10219122 366
45 3300028558 Ga0265326_10000564 Ga0265326_100005643 366
46 3300028666 Ga0265336_10000205 Ga0265336_1000020535 366
47 3300028800 Ga0265338_10000039 Ga0265338_1000003979 366
48 3300031241 Ga0265325_10004474 Ga0265325_100044748 366
49 3300021377 Ga0213874_10011370 Ga0213874_100113702 367
50 3300037853 Ga0436364_0395628 Ga0436364_0395628_561_1730 367
51 3300039437 Ga0436365_0818622 Ga0436365_0818622_29_1198 367
52 3300039437 Ga0436365_1872566 Ga0436365_1872566_133_1299 367
53 3300039453 Ga0436362_0798939 Ga0436362_0798939_494_1660 367
54 3300005563 Ga0068855_100016999 Ga0068855_1000169996 368
55 3300025949 Ga0207667_10015213 Ga0207667_100152136 368
56 3300028800 Ga0265338_10064584 Ga0265338_100645844 369
57 3300030736 Ga0316180_1077328 Ga0316180_10773284 370
58 3300030745 Ga0316182_1214308 Ga0316182_121430811 370
59 3300030745 Ga0316182_1278681 Ga0316182_12786813 370
60 3300047472 Ga0495686_0006364 Ga0495686_0006364_2537_3682 371
61 3300009098 Ga0105245_10000001 Ga0105245_10000001585 373
62 3300013307 Ga0157372_10190943 Ga0157372_101909434 373
63 3300025927 Ga0207687_10000001 Ga0207687_10000001147 373
64 3300025927 Ga0207687_10000004 Ga0207687_10000004686 373
65 3300025949 Ga0207667_10051930 Ga0207667_100519305 373
66 3300003320 rootH2_10000763 rootH2_1000076355 374
67 3300003323 rootH1_10093195 rootH1_100931956 374
68 3300005339 Ga0070660_100002047 Ga0070660_1000020475 374
69 3300005937 Ga0081455_10000001 Ga0081455_10000001407 374
70 3300006038 Ga0075365_10000008 Ga0075365_1000000842 374
71 3300006038 Ga0075365_10005078 Ga0075365_100050785 374
72 3300006042 Ga0075368_10000639 Ga0075368_100006395 374
73 3300006051 Ga0075364_10023060 Ga0075364_100230603 374
74 3300006178 Ga0075367_10007554 Ga0075367_100075546 374
75 3300006353 Ga0075370_10007511 Ga0075370_100075114 374
76 3300009979 Ga0105032_100001 Ga0105032_100001438 374
77 3300013104 Ga0157370_10000168 Ga0157370_1000016863 374
78 3300013105 Ga0157369_10003043 Ga0157369_1000304312 374
79 3300013105 Ga0157369_10028032 Ga0157369_100280323 374
80 3300013307 Ga0157372_10000160 Ga0157372_100001609 374
81 3300030734 Ga0316179_1078429 Ga0316179_10784296 374
82 3300031251 Ga0265327_10000025 Ga0265327_10000025342 374
83 3300037312 Ga0395899_0011842 Ga0395899_0011842_333_1484 374
84 3300042004 Ga0439445_0000860 Ga0439445_0000860_349_1506 374
85 3300042006 Ga0439432_009234 Ga0439432_009234_371_1528 374
86 3300044658 Ga0466972_0013711 Ga0466972_0013711_171_1322 374
87 3300044683 Ga0466965_0000229 Ga0466965_0000229_10589_11740 374
88 3300046460 Ga0495638_0000061 Ga0495638_0000061_173150_174304 374
89 3300046542 Ga0495597_0014113 Ga0495597_0014113_1873_3027 374
90 3300046692 Ga0495671_0078013 Ga0495671_0078013_68_1222 374
91 3300046810 Ga0495660_0000005 Ga0495660_0000005_237965_239119 374
92 3300049571 Ga0501034_0000028 Ga0501034_0000028_93787_94941 374
93 3300049573 Ga0501037_0000001 Ga0501037_0000001_102747_103901 374
94 3300049579 Ga0501043_0230647 Ga0501043_0230647_128_1282 374
95 3300050491 nmdc:mga00v17_211_c1 nmdc:mga00v17_211_c1_6706_7863 374
96 3300050492 nmdc:mga0yw44_18082_c1 nmdc:mga0yw44_18082_c1_2090_3250 374
97 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_75011_76165 374
98 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_216062_217219 374
99 3300053087 Ga0500643_001279 Ga0500643_001279_8330_9484 374
100 3300053090 Ga0500646_0000075 Ga0500646_0000075_20169_21323 374
101 3300053092 Ga0500583_0004315 Ga0500583_0004315_3283_4437 374
102 3300053093 Ga0500651_0000001 Ga0500651_0000001_441611_442765 374
103 3300053096 Ga0500641_0000001 Ga0500641_0000001_1086584_1087738 374
104 3300053103 Ga0500555_000009 Ga0500555_000009_154038_155198 374
105 3300053109 Ga0500569_000014 Ga0500569_000014_14248_15402 374
106 3300053117 Ga0500593_056194 Ga0500593_056194_410_1570 374
107 3300053118 Ga0500594_0000074 Ga0500594_0000074_23909_25063 374
108 3300053131 Ga0500652_000001 Ga0500652_000001_390663_391817 374
109 3300053146 Ga0500588_0000029 Ga0500588_0000029_948_2102 374
110 3300053724 Ga0500570_000030 Ga0500570_000030_15755_16909 374
111 3300005336 Ga0070680_100019996 Ga0070680_1000199962 375
112 3300005530 Ga0070679_100175837 Ga0070679_1001758372 375
113 3300005563 Ga0068855_100324117 Ga0068855_1003241172 375
114 3300005577 Ga0068857_100101622 Ga0068857_1001016223 375
115 3300005614 Ga0068856_100000037 Ga0068856_10000003746 375
116 3300005614 Ga0068856_100004747 Ga0068856_10000474710 375
117 3300006177 Ga0075362_10014469 Ga0075362_100144694 375
118 3300025917 Ga0207660_10004945 Ga0207660_100049456 375
119 3300025949 Ga0207667_10209238 Ga0207667_102092382 375
120 3300026078 Ga0207702_10000001 Ga0207702_10000001471 375
121 3300026116 Ga0207674_10218256 Ga0207674_102182562 375
122 3300049571 Ga0501034_0000500 Ga0501034_0000500_53768_54952 375
123 3300049573 Ga0501037_0012827 Ga0501037_0012827_567_1751 375
124 3300049575 Ga0501039_0023320 Ga0501039_0023320_2401_3585 375
125 3300049579 Ga0501043_0077566 Ga0501043_0077566_649_1833 375
126 3300049581 Ga0501047_0002499 Ga0501047_0002499_11882_13066 375
127 3300049589 Ga0501073_0000001 Ga0501073_0000001_509915_511099 375
128 3300049590 Ga0501074_0032767 Ga0501074_0032767_2213_3397 375
129 3300049593 Ga0501077_0062202 Ga0501077_0062202_927_2111 375
130 3300049742 Ga0501080_0000086 Ga0501080_0000086_45054_46238 375
131 3300050489 nmdc:mga03683_1163_c1 nmdc:mga03683_1163_c1_5296_6435 375
132 3300060353 Ga0501082_0001231 Ga0501082_0001231_16890_18074 375
133 3300005327 Ga0070658_10000061 Ga0070658_1000006115 376
134 3300005355 Ga0070671_100012439 Ga0070671_1000124396 376
135 3300005356 Ga0070674_100016591 Ga0070674_1000165913 376
136 3300005364 Ga0070673_100000373 Ga0070673_1000003739 376
137 3300005456 Ga0070678_100001558 Ga0070678_1000015585 376
138 3300005459 Ga0068867_100004448 Ga0068867_10000444813 376
139 3300005466 Ga0070685_10000213 Ga0070685_1000021323 376
140 3300005466 Ga0070685_10003592 Ga0070685_100035924 376
141 3300005543 Ga0070672_100090221 Ga0070672_1000902212 376
142 3300005548 Ga0070665_100009248 Ga0070665_1000092485 376
143 3300005548 Ga0070665_100269456 Ga0070665_1002694562 376
144 3300005614 Ga0068856_100048842 Ga0068856_1000488426 376
145 3300005841 Ga0068863_100007191 Ga0068863_10000719113 376
146 3300009093 Ga0105240_10000003 Ga0105240_10000003397 376
147 3300009098 Ga0105245_10000034 Ga0105245_1000003468 376
148 3300009098 Ga0105245_10000564 Ga0105245_100005644 376
149 3300009148 Ga0105243_10000001 Ga0105243_10000001853 376
150 3300009176 Ga0105242_10000001 Ga0105242_10000001406 376
151 3300009176 Ga0105242_10003728 Ga0105242_100037286 376
152 3300010375 Ga0105239_10036677 Ga0105239_100366774 376
153 3300010375 Ga0105239_10105692 Ga0105239_101056923 376
154 3300013105 Ga0157369_10037275 Ga0157369_100372752 376
155 3300013296 Ga0157374_10000269 Ga0157374_1000026917 376
156 3300013296 Ga0157374_10004883 Ga0157374_100048838 376
157 3300014745 Ga0157377_10014002 Ga0157377_100140025 376
158 3300014969 Ga0157376_10000001 Ga0157376_10000001503 376
159 3300025909 Ga0207705_10000264 Ga0207705_1000026415 376
160 3300025913 Ga0207695_10000005 Ga0207695_10000005405 376
161 3300025927 Ga0207687_10000101 Ga0207687_1000010145 376
162 3300025931 Ga0207644_10114273 Ga0207644_101142732 376
163 3300025934 Ga0207686_10000001 Ga0207686_10000001288 376
164 3300025934 Ga0207686_10004571 Ga0207686_100045715 376
165 3300025935 Ga0207709_10000002 Ga0207709_10000002405 376
166 3300025940 Ga0207691_10017829 Ga0207691_100178298 376
167 3300025949 Ga0207667_10119189 Ga0207667_101191894 376
168 3300025960 Ga0207651_10033921 Ga0207651_100339212 376
169 3300026078 Ga0207702_10002414 Ga0207702_100024146 376
170 3300026088 Ga0207641_10031083 Ga0207641_100310836 376
171 3300026089 Ga0207648_10058947 Ga0207648_100589472 376
172 3300026121 Ga0207683_10001654 Ga0207683_1000165419 376
173 3300028379 Ga0268266_10003987 Ga0268266_100039874 376
174 3300028379 Ga0268266_10012044 Ga0268266_100120445 376
175 3300028800 Ga0265338_10000427 Ga0265338_1000042714 376
176 3300031730 Ga0307516_10000091 Ga0307516_1000009180 376
177 3300037471 Ga0395905_0012827 Ga0395905_0012827_2503_3648 376
178 3300038443 Ga0395901_0001031 Ga0395901_0001031_6438_7571 376
179 3300048915 Ga0496112_0057835 Ga0496112_0057835_415_1548 376
180 3300053088 Ga0500644_0006580 Ga0500644_0006580_634_1764 376
181 3300053090 Ga0500646_0001041 Ga0500646_0001041_5142_6272 376
182 3300053093 Ga0500651_0000017 Ga0500651_0000017_12804_13940 376
183 3300053093 Ga0500651_0011851 Ga0500651_0011851_2037_3173 376
184 3300053098 Ga0500650_0000001 Ga0500650_0000001_125424_126554 376
185 3300053118 Ga0500594_0000001 Ga0500594_0000001_790222_791352 376
186 3300053123 Ga0500614_000265 Ga0500614_000265_11306_12442 376
187 3300053133 Ga0500655_000233 Ga0500655_000233_2317_3447 376
188 3300053142 Ga0500577_0001159 Ga0500577_0001159_1457_2587 376
189 3300053143 Ga0500579_000849 Ga0500579_000849_3970_5100 376
190 3300005327 Ga0070658_10000724 Ga0070658_1000072429 377
191 3300005339 Ga0070660_100000265 Ga0070660_10000026520 377
192 3300005341 Ga0070691_10004201 Ga0070691_100042014 377
193 3300005366 Ga0070659_100000287 Ga0070659_1000002874 377
194 3300005530 Ga0070679_100021090 Ga0070679_1000210907 377
195 3300005530 Ga0070679_100032001 Ga0070679_1000320013 377
196 3300005539 Ga0068853_100060578 Ga0068853_1000605782 377
197 3300005563 Ga0068855_100000413 Ga0068855_10000041321 377
198 3300005577 Ga0068857_100000012 Ga0068857_1000000127 377
199 3300025909 Ga0207705_10004415 Ga0207705_100044152 377
200 3300025919 Ga0207657_10001705 Ga0207657_100017059 377
201 3300025921 Ga0207652_10047701 Ga0207652_100477012 377
202 3300025932 Ga0207690_10000901 Ga0207690_100009014 377
203 3300025949 Ga0207667_10000060 Ga0207667_1000006037 377
204 3300026041 Ga0207639_10022794 Ga0207639_100227945 377
205 3300026116 Ga0207674_10000015 Ga0207674_1000001530 377
206 3300003316 rootH1_10006015 rootH1_100060154 378
207 3300005339 Ga0070660_100000121 Ga0070660_10000012118 378
208 3300005367 Ga0070667_100002152 Ga0070667_10000215221 378
209 3300005535 Ga0070684_100061850 Ga0070684_1000618504 378
210 3300009094 Ga0111539_10002081 Ga0111539_100020814 378
211 3300025919 Ga0207657_10000772 Ga0207657_100007724 378
212 3300027907 Ga0207428_10052329 Ga0207428_100523295 378
213 3300028800 Ga0265338_10043073 Ga0265338_100430733 378
214 3300031240 Ga0265320_10027204 Ga0265320_100272042 378
215 3300034820 Ga0373959_0000395 Ga0373959_0000395_2684_3826 378
216 3300037418 Ga0395900_0061254 Ga0395900_0061254_909_2051 378
217 3300037418 Ga0395900_0143340 Ga0395900_0143340_292_1434 378
218 3300037466 Ga0395898_0006423 Ga0395898_0006423_6042_7184 378
219 3300037471 Ga0395905_0208610 Ga0395905_0208610_452_1594 378
220 3300038443 Ga0395901_0014123 Ga0395901_0014123_242_1384 378
221 3300045976 Ga0466967_0217281 Ga0466967_0217281_438_1577 378
222 3300050511 nmdc:mga08y16_6599_c1 nmdc:mga08y16_6599_c1_2016_3164 378
223 3300053087 Ga0500643_000264 Ga0500643_000264_14382_15605 378
224 3300053117 Ga0500593_000001 Ga0500593_000001_739625_740764 378
225 3300053118 Ga0500594_0000379 Ga0500594_0000379_6384_7523 378
226 3300053129 Ga0500628_000008 Ga0500628_000008_6600_7739 378
227 3300002067 JGI24735J21928_10001133 JGI24735J21928_1000113310 379
228 3300003320 rootH2_10000244 rootH2_10000244636 379
229 3300005327 Ga0070658_10000015 Ga0070658_10000015259 379
230 3300005327 Ga0070658_10023531 Ga0070658_100235312 379
231 3300005335 Ga0070666_10014639 Ga0070666_100146394 379
232 3300005335 Ga0070666_10015295 Ga0070666_100152952 379
233 3300005337 Ga0070682_100002230 Ga0070682_10000223011 379
234 3300005337 Ga0070682_100002702 Ga0070682_1000027023 379
235 3300005338 Ga0068868_100027976 Ga0068868_1000279764 379
236 3300005364 Ga0070673_100084753 Ga0070673_1000847532 379
237 3300005367 Ga0070667_100000001 Ga0070667_100000001536 379
238 3300005530 Ga0070679_100009595 Ga0070679_1000095955 379
239 3300005841 Ga0068863_100166727 Ga0068863_1001667272 379
240 3300005842 Ga0068858_100025332 Ga0068858_1000253324 379
241 3300005843 Ga0068860_100064288 Ga0068860_1000642883 379
242 3300006038 Ga0075365_10000293 Ga0075365_1000029318 379
243 3300006051 Ga0075364_10000236 Ga0075364_1000023628 379
244 3300009093 Ga0105240_10178990 Ga0105240_101789902 379
245 3300009553 Ga0105249_10003284 Ga0105249_100032846 379
246 3300013297 Ga0157378_10110201 Ga0157378_101102014 379
247 3300025903 Ga0207680_10000290 Ga0207680_1000029019 379
248 3300025904 Ga0207647_10000039 Ga0207647_10000039101 379
249 3300025909 Ga0207705_10000011 Ga0207705_1000001186 379
250 3300025909 Ga0207705_10000202 Ga0207705_1000020244 379
251 3300025909 Ga0207705_10003246 Ga0207705_100032469 379
252 3300025921 Ga0207652_10008162 Ga0207652_100081625 379
253 3300025927 Ga0207687_10029704 Ga0207687_100297042 379
254 3300025944 Ga0207661_10000110 Ga0207661_1000011051 379
255 3300025961 Ga0207712_10002293 Ga0207712_100022938 379
256 3300025986 Ga0207658_10000003 Ga0207658_10000003844 379
257 3300025986 Ga0207658_10161627 Ga0207658_101616271 379
258 3300026035 Ga0207703_10221692 Ga0207703_102216922 379
259 3300028381 Ga0268264_10143114 Ga0268264_101431143 379
260 3300028556 Ga0265337_1000158 Ga0265337_100015843 379
261 3300028556 Ga0265337_1006918 Ga0265337_10069182 379
262 3300028558 Ga0265326_10022491 Ga0265326_100224912 379
263 3300028573 Ga0265334_10004717 Ga0265334_100047176 379
264 3300028654 Ga0265322_10026122 Ga0265322_100261222 379
265 3300028666 Ga0265336_10004614 Ga0265336_100046146 379
266 3300028666 Ga0265336_10005673 Ga0265336_100056735 379
267 3300028800 Ga0265338_10000969 Ga0265338_1000096928 379
268 3300028800 Ga0265338_10002078 Ga0265338_1000207825 379
269 3300029957 Ga0265324_10004558 Ga0265324_100045584 379
270 3300031249 Ga0265339_10084950 Ga0265339_100849502 379
271 3300031595 Ga0265313_10035010 Ga0265313_100350103 379
272 3300037312 Ga0395899_0107490 Ga0395899_0107490_828_1976 379
273 3300037418 Ga0395900_0000305 Ga0395900_0000305_46301_47449 379
274 3300038443 Ga0395901_0011862 Ga0395901_0011862_7606_8754 379
275 3300038443 Ga0395901_0097046 Ga0395901_0097046_352_1506 379
276 3300047320 Ga0495672_0000010 Ga0495672_0000010_452116_453288 379
277 3300049571 Ga0501034_0003872 Ga0501034_0003872_11535_12698 379
278 3300049744 Ga0501083_0005193 Ga0501083_0005193_1742_2923 379
279 3300050491 nmdc:mga00v17_160_c1 nmdc:mga00v17_160_c1_10916_12076 379
280 3300050492 nmdc:mga0yw44_24216_c1 nmdc:mga0yw44_24216_c1_1649_2809 379
281 3300053104 Ga0500556_0000475 Ga0500556_0000475_14888_16036 379
282 3300053137 Ga0500561_0000001 Ga0500561_0000001_820794_821933 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

38

404

0.91

PF01212

Beta_elim_lyase

Beta-eliminating lyase

73

235

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ecx-assembly1.cif.gz_B nifs-like protein 0.9521 3 378
1ecx-assembly1.cif.gz_A nifs-like protein 0.9506 3 378
3a9y-assembly1.cif.gz_A crystal structure of rat selenocysteine lyase in complex with l-cysteine 0.9494 4 375
3a9z-assembly1.cif.gz_B crystal structure of ras selenocysteine lyase in complex with selenopropionate 0.9473 4 377
7rtk-assembly1.cif.gz_A structure of the (niau)2 complex with n-terminal mutation of iscu2 y35d at 2.5 a resolution 0.9426 1 377
ID Description Score Start End Superfamily
4ixoB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9665 263 377 3.90.1150.10
4isyD01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9543 264 377 3.90.1150.10
af_Q9JLI6_18_428_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9467 4 377 3.40.640.10
4r5fA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9461 264 377 3.90.1150.10
af_Q2FXV4_2_370_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9406 5 375 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2G6C3G4-F1-model_v4 Aminotransferase class V domain-containing protein 0.9898 2 169 GO:0016226
AF-A0A660M2D8-F1-model_v4 Cysteine desulfurase 0.9877 5 377 GO:0016226
GO:0031071
GO:0046872
GO:0051536
AF-A0A2T2QX27-F1-model_v4 Aminotransferase 0.9849 5 377 GO:0008483
GO:0016226
GO:0046872
GO:0051536
AF-A0A7T9K791-F1-model_v4 deleted 0.9818 3 378
AF-A0A4Q5ZLN6-F1-model_v4 Cysteine desulfurase 0.9812 64 378 GO:0016226
GO:0031071
GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
94.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map