F384920
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 178 | 282 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10003156|Ga0157371_1000315612 |
| Length | 280 |
| Sequence | MKRGAGHGRPLIGVTTSEVREPKRIQQTPESEPKVREMVLGLTYLRALEAAGALPMVVPPLPEEAIGTLLDRLDGICLSGGPDLDPETYGADPHPELGPIEPDLDRFELAVARCADKREIPILAICRGTQALNVARGGTLIQHLPEASPGFAHRQSAPGNETSHTIDIEAGSRLAAALGEDEVEVRDELDVNSFHHQAIERLGDGLKITARAPDGTPEAIEDPSRPFLIGVQWHAETLVHRAYEAALFRHFVETSLRPPDRRISASSLARVQSTPRSLRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 119 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 120 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 121 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 125 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 128 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 141 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 142 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 143 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 144 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 145 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 146 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 153 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 154 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 155 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 156 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 166 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 176 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 178 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.71 |
| Nodule | 0 |
| Rhizoplane | 11.35 |
| Rhizosphere | 85.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100001645 | 3300005329 | Bacteria | 17312 |
| 2 | Ga0070683_100017862 | 3300005329 | Bacteria | 6270 |
| 3 | Ga0070683_100029458 | 3300005329 | Bacteria | 4971 |
| 4 | Ga0070670_100043115 | 3300005331 | Bacteria | 3879 |
| 5 | Ga0068869_100004396 | 3300005334 | Bacteria | 8755 |
| 6 | Ga0070666_10048715 | 3300005335 | Bacteria | 2848 |
| 7 | Ga0070666_10146107 | 3300005335 | Bacteria | 1648 |
| 8 | Ga0070680_100333095 | 3300005336 | Bacteria | 1289 |
| 9 | Ga0070682_100006554 | 3300005337 | Bacteria | 6531 |
| 10 | Ga0070682_100087065 | 3300005337 | Bacteria | 2036 |
| 11 | Ga0068868_100015787 | 3300005338 | Bacteria | 5594 |
| 12 | Ga0070660_100104964 | 3300005339 | Bacteria | 2242 |
| 13 | Ga0070660_100598592 | 3300005339 | Bacteria | 922 |
| 14 | Ga0070691_10023211 | 3300005341 | Bacteria | 2880 |
| 15 | Ga0070661_100003829 | 3300005344 | Bacteria | 10359 |
| 16 | Ga0070661_100148329 | 3300005344 | Bacteria | 1772 |
| 17 | Ga0070692_10088212 | 3300005345 | Bacteria | 1682 |
| 18 | Ga0070668_100027772 | 3300005347 | Bacteria | 4296 |
| 19 | Ga0070675_100000058 | 3300005354 | Bacteria | 66874 |
| 20 | Ga0070675_100102242 | 3300005354 | Bacteria | 2414 |
| 21 | Ga0070671_100077488 | 3300005355 | Bacteria | 2778 |
| 22 | Ga0070671_100306932 | 3300005355 | Bacteria | 1351 |
| 23 | Ga0070673_100009422 | 3300005364 | Bacteria | 6554 |
| 24 | Ga0070688_100002866 | 3300005365 | Bacteria | 8796 |
| 25 | Ga0070688_100012800 | 3300005365 | Bacteria | 4711 |
| 26 | Ga0070688_100355792 | 3300005365 | Bacteria | 1073 |
| 27 | Ga0070659_100012767 | 3300005366 | Bacteria | 6237 |
| 28 | Ga0070659_100127987 | 3300005366 | Unclassified | 2061 |
| 29 | Ga0070659_100267059 | 3300005366 | Bacteria | 1421 |
| 30 | Ga0070667_100087297 | 3300005367 | Bacteria | 2677 |
| 31 | Ga0070667_100151569 | 3300005367 | Bacteria | 2037 |
| 32 | Ga0070667_100681450 | 3300005367 | Bacteria | 950 |
| 33 | Ga0070713_100001783 | 3300005436 | Bacteria | 13874 |
| 34 | Ga0070700_100001171 | 3300005441 | Bacteria | 12973 |
| 35 | Ga0070700_100504496 | 3300005441 | Bacteria | 931 |
| 36 | Ga0070663_100017465 | 3300005455 | Bacteria | 4683 |
| 37 | Ga0070678_100031489 | 3300005456 | Bacteria | 3660 |
| 38 | Ga0070662_100014011 | 3300005457 | Bacteria | 5344 |
| 39 | Ga0070662_100323112 | 3300005457 | Bacteria | 1259 |
| 40 | Ga0070681_10032794 | 3300005458 | Bacteria | 5214 |
| 41 | Ga0070685_10000018 | 3300005466 | Bacteria | 110132 |
| 42 | Ga0070685_10022662 | 3300005466 | Bacteria | 3427 |
| 43 | Ga0070685_10035559 | 3300005466 | Bacteria | 2811 |
| 44 | Ga0070685_10109695 | 3300005466 | Bacteria | 1698 |
| 45 | Ga0070679_100021403 | 3300005530 | Bacteria | 6312 |
| 46 | Ga0070684_100005809 | 3300005535 | Bacteria | 9491 |
| 47 | Ga0070684_100045350 | 3300005535 | Bacteria | 3807 |
| 48 | Ga0070684_100532238 | 3300005535 | Bacteria | 1090 |
| 49 | Ga0070686_100290132 | 3300005544 | Bacteria | 1210 |
| 50 | Ga0070665_100007985 | 3300005548 | Bacteria | 10722 |
| 51 | Ga0070704_100288820 | 3300005549 | Bacteria | 1362 |
| 52 | Ga0070664_100104854 | 3300005564 | Bacteria | 2462 |
| 53 | Ga0070664_100232253 | 3300005564 | Bacteria | 1653 |
| 54 | Ga0070664_100326828 | 3300005564 | Bacteria | 1391 |
| 55 | Ga0068854_100001335 | 3300005578 | Bacteria | 14874 |
| 56 | Ga0068854_100006441 | 3300005578 | Bacteria | 7467 |
| 57 | Ga0068854_100059201 | 3300005578 | Bacteria | 2768 |
| 58 | Ga0068856_100019982 | 3300005614 | Bacteria | 6501 |
| 59 | Ga0068856_100054298 | 3300005614 | Bacteria | 3951 |
| 60 | Ga0068852_100000012 | 3300005616 | Bacteria | 140734 |
| 61 | Ga0068852_100021460 | 3300005616 | Bacteria | 5157 |
| 62 | Ga0068852_100042843 | 3300005616 | Bacteria | 3834 |
| 63 | Ga0068852_100083147 | 3300005616 | Bacteria | 2846 |
| 64 | Ga0068852_100214523 | 3300005616 | Bacteria | 1828 |
| 65 | Ga0068859_100133410 | 3300005617 | Bacteria | 2555 |
| 66 | Ga0068864_100002162 | 3300005618 | Bacteria | 16232 |
| 67 | Ga0068851_10001094 | 3300005834 | Bacteria | 11760 |
| 68 | Ga0068851_10020316 | 3300005834 | Bacteria | 3215 |
| 69 | Ga0068851_10042679 | 3300005834 | Bacteria | 2284 |
| 70 | Ga0068870_10112959 | 3300005840 | Bacteria | 1554 |
| 71 | Ga0068863_100041255 | 3300005841 | Bacteria | 4388 |
| 72 | Ga0068863_100078422 | 3300005841 | Bacteria | 3128 |
| 73 | Ga0068858_100652798 | 3300005842 | Bacteria | 1022 |
| 74 | Ga0081455_10033852 | 3300005937 | Bacteria | 4585 |
| 75 | Ga0081455_10079247 | 3300005937 | Bacteria | 2697 |
| 76 | Ga0070716_100338098 | 3300006173 | Bacteria | 1061 |
| 77 | Ga0070712_100010641 | 3300006175 | Bacteria | 5811 |
| 78 | Ga0070712_100040117 | 3300006175 | Bacteria | 3208 |
| 79 | Ga0097621_100054683 | 3300006237 | Bacteria | 3257 |
| 80 | Ga0075430_100020602 | 3300006846 | Bacteria | 5609 |
| 81 | Ga0075431_100135035 | 3300006847 | Unclassified | 2543 |
| 82 | Ga0075433_10014568 | 3300006852 | Bacteria | 6428 |
| 83 | Ga0075434_100065097 | 3300006871 | Bacteria | 3630 |
| 84 | Ga0075434_100131650 | 3300006871 | Bacteria | 2520 |
| 85 | Ga0068865_100000101 | 3300006881 | Bacteria | 44302 |
| 86 | Ga0068865_100470214 | 3300006881 | Bacteria | 1043 |
| 87 | Ga0075436_100336621 | 3300006914 | Bacteria | 1086 |
| 88 | Ga0097620_100133411 | 3300006931 | Bacteria | 2555 |
| 89 | Ga0111539_10210259 | 3300009094 | Bacteria | 2267 |
| 90 | Ga0105245_10002830 | 3300009098 | Bacteria | 15591 |
| 91 | Ga0105245_10006628 | 3300009098 | Bacteria | 10169 |
| 92 | Ga0105245_10015419 | 3300009098 | Bacteria | 6661 |
| 93 | Ga0105245_10696769 | 3300009098 | Bacteria | 1049 |
| 94 | Ga0105247_10003405 | 3300009101 | Bacteria | 10392 |
| 95 | Ga0105243_10079502 | 3300009148 | Bacteria | 2673 |
| 96 | Ga0105243_10089751 | 3300009148 | Bacteria | 2528 |
| 97 | Ga0105241_10154412 | 3300009174 | Bacteria | 1881 |
| 98 | Ga0105242_10000357 | 3300009176 | Bacteria | 36537 |
| 99 | Ga0105242_10000530 | 3300009176 | Bacteria | 30053 |
| 100 | Ga0105242_10356428 | 3300009176 | Bacteria | 1353 |
| 101 | Ga0105248_10000032 | 3300009177 | Bacteria | 201114 |
| 102 | Ga0105249_10785659 | 3300009553 | Bacteria | 1015 |
| 103 | Ga0105239_10027567 | 3300010375 | Bacteria | 6252 |
| 104 | Ga0105239_10081851 | 3300010375 | Bacteria | 3554 |
| 105 | Ga0105239_10425866 | 3300010375 | Bacteria | 1504 |
| 106 | Ga0105246_10496087 | 3300011119 | Bacteria | 1036 |
| 107 | Ga0157371_10003156 | 3300013102 | Bacteria | 15182 |
| 108 | Ga0157369_10000099 | 3300013105 | Bacteria | 120032 |
| 109 | Ga0157378_10005494 | 3300013297 | Bacteria | 11110 |
| 110 | Ga0157378_10060107 | 3300013297 | Bacteria | 3391 |
| 111 | Ga0163162_10705703 | 3300013306 | Unclassified | 1130 |
| 112 | Ga0157372_10866144 | 3300013307 | Bacteria | 1049 |
| 113 | Ga0157375_10005846 | 3300013308 | Bacteria | 10706 |
| 114 | Ga0157375_10185467 | 3300013308 | Bacteria | 2233 |
| 115 | Ga0163163_10048448 | 3300014325 | Bacteria | 4178 |
| 116 | Ga0157380_10001287 | 3300014326 | Bacteria | 16323 |
| 117 | Ga0157377_10003442 | 3300014745 | Bacteria | 7169 |
| 118 | Ga0157379_10289234 | 3300014968 | Bacteria | 1492 |
| 119 | Ga0163161_10605429 | 3300017792 | Bacteria | 904 |
| 120 | Ga0207656_10000325 | 3300025321 | Bacteria | 16400 |
| 121 | Ga0207656_10005393 | 3300025321 | Bacteria | 4516 |
| 122 | Ga0207710_10000369 | 3300025900 | Bacteria | 31539 |
| 123 | Ga0207688_10002755 | 3300025901 | Bacteria | 9524 |
| 124 | Ga0207680_10017856 | 3300025903 | Bacteria | 3756 |
| 125 | Ga0207680_10059291 | 3300025903 | Bacteria | 2324 |
| 126 | Ga0207654_10099017 | 3300025911 | Bacteria | 1792 |
| 127 | Ga0207693_10009297 | 3300025915 | Bacteria | 8020 |
| 128 | Ga0207693_10056096 | 3300025915 | Bacteria | 3089 |
| 129 | Ga0207660_10283298 | 3300025917 | Bacteria | 1316 |
| 130 | Ga0207649_10000640 | 3300025920 | Bacteria | 23374 |
| 131 | Ga0207652_10014685 | 3300025921 | Bacteria | 6347 |
| 132 | Ga0207694_10156107 | 3300025924 | Bacteria | 1841 |
| 133 | Ga0207650_10167660 | 3300025925 | Bacteria | 1743 |
| 134 | Ga0207650_10192547 | 3300025925 | Bacteria | 1630 |
| 135 | Ga0207659_10000020 | 3300025926 | Bacteria | 151552 |
| 136 | Ga0207659_10061774 | 3300025926 | Bacteria | 2702 |
| 137 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 138 | Ga0207687_10003179 | 3300025927 | Bacteria | 11151 |
| 139 | Ga0207687_10013707 | 3300025927 | Bacteria | 5292 |
| 140 | Ga0207687_10392980 | 3300025927 | Bacteria | 1139 |
| 141 | Ga0207700_10000070 | 3300025928 | Bacteria | 62833 |
| 142 | Ga0207644_10386540 | 3300025931 | Bacteria | 1142 |
| 143 | Ga0207690_10513379 | 3300025932 | Bacteria | 970 |
| 144 | Ga0207706_10021102 | 3300025933 | Bacteria | 5851 |
| 145 | Ga0207706_10238259 | 3300025933 | Bacteria | 1591 |
| 146 | Ga0207686_10000156 | 3300025934 | Bacteria | 51745 |
| 147 | Ga0207686_10000438 | 3300025934 | Bacteria | 27955 |
| 148 | Ga0207686_10181140 | 3300025934 | Bacteria | 1494 |
| 149 | Ga0207709_10009255 | 3300025935 | Bacteria | 5425 |
| 150 | Ga0207709_10253680 | 3300025935 | Bacteria | 1286 |
| 151 | Ga0207670_10070509 | 3300025936 | Bacteria | 2414 |
| 152 | Ga0207704_10000025 | 3300025938 | Bacteria | 135523 |
| 153 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 154 | Ga0207689_10014766 | 3300025942 | Bacteria | 6631 |
| 155 | Ga0207661_10002063 | 3300025944 | Bacteria | 13830 |
| 156 | Ga0207661_10010753 | 3300025944 | Bacteria | 6597 |
| 157 | Ga0207661_10637275 | 3300025944 | Bacteria | 979 |
| 158 | Ga0207679_10089093 | 3300025945 | Bacteria | 2381 |
| 159 | Ga0207679_10091439 | 3300025945 | Bacteria | 2355 |
| 160 | Ga0207651_10487004 | 3300025960 | Bacteria | 1064 |
| 161 | Ga0207668_10008272 | 3300025972 | Bacteria | 6198 |
| 162 | Ga0207640_10000285 | 3300025981 | Bacteria | 33957 |
| 163 | Ga0207640_10021270 | 3300025981 | Bacteria | 3865 |
| 164 | Ga0207658_10130163 | 3300025986 | Bacteria | 2021 |
| 165 | Ga0207677_10001635 | 3300026023 | Bacteria | 11877 |
| 166 | Ga0207703_10339641 | 3300026035 | Bacteria | 1380 |
| 167 | Ga0207678_10018954 | 3300026067 | Bacteria | 6046 |
| 168 | Ga0207678_10029702 | 3300026067 | Bacteria | 4772 |
| 169 | Ga0207678_10561945 | 3300026067 | Bacteria | 998 |
| 170 | Ga0207708_10000752 | 3300026075 | Bacteria | 24268 |
| 171 | Ga0207702_10012042 | 3300026078 | Bacteria | 7191 |
| 172 | Ga0207702_10455877 | 3300026078 | Bacteria | 1241 |
| 173 | Ga0207641_10037823 | 3300026088 | Bacteria | 4032 |
| 174 | Ga0207641_10038504 | 3300026088 | Bacteria | 3998 |
| 175 | Ga0207675_100014368 | 3300026118 | Bacteria | 7383 |
| 176 | Ga0207675_100131941 | 3300026118 | Bacteria | 2369 |
| 177 | Ga0207683_10024444 | 3300026121 | Bacteria | 5204 |
| 178 | Ga0207683_10027098 | 3300026121 | Bacteria | 4953 |
| 179 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 180 | Ga0207698_10008377 | 3300026142 | Bacteria | 6535 |
| 181 | Ga0207698_10345827 | 3300026142 | Bacteria | 1403 |
| 182 | Ga0207428_10040590 | 3300027907 | Bacteria | 3773 |
| 183 | Ga0268266_10000553 | 3300028379 | Bacteria | 52199 |
| 184 | Ga0268266_10350671 | 3300028379 | Bacteria | 1387 |
| 185 | Ga0268265_10948372 | 3300028380 | Bacteria | 847 |
| 186 | Ga0265319_1000028 | 3300028563 | Bacteria | 135557 |
| 187 | Ga0265338_10000230 | 3300028800 | Bacteria | 103891 |
| 188 | Ga0265331_10054554 | 3300031250 | Bacteria | 1903 |
| 189 | Ga0307408_100854377 | 3300031548 | Bacteria | 830 |
| 190 | Ga0307410_10039167 | 3300031852 | Bacteria | 3110 |
| 191 | Ga0307410_10635197 | 3300031852 | Bacteria | 894 |
| 192 | Ga0307407_10147759 | 3300031903 | Bacteria | 1524 |
| 193 | Ga0307409_100898430 | 3300031995 | Bacteria | 899 |
| 194 | Ga0307416_100013636 | 3300032002 | Bacteria | 5534 |
| 195 | Ga0307416_100188972 | 3300032002 | Bacteria | 1940 |
| 196 | Ga0307415_100001131 | 3300032126 | Bacteria | 12469 |
| 197 | Ga0395901_0373401 | 3300038443 | Bacteria | 1469 |
| 198 | Ga0451853_2508484 | 3300041512 | Bacteria | 1282 |
| 199 | Ga0466963_0024297 | 3300044694 | Bacteria | 3857 |
| 200 | Ga0466957_0002421 | 3300044842 | Bacteria | 10019 |
| 201 | Ga0466957_0061254 | 3300044842 | Bacteria | 2309 |
| 202 | Ga0466967_0000046 | 3300045976 | Bacteria | 43911 |
| 203 | Ga0466967_0015614 | 3300045976 | Bacteria | 5957 |
| 204 | Ga0466967_0026717 | 3300045976 | Bacteria | 4787 |
| 205 | Ga0466967_0189355 | 3300045976 | Bacteria | 1944 |
| 206 | Ga0466967_0450101 | 3300045976 | Bacteria | 1258 |
| 207 | Ga0495629_0005185 | 3300046459 | Bacteria | 9753 |
| 208 | Ga0495629_0007342 | 3300046459 | Bacteria | 8124 |
| 209 | Ga0495638_0015168 | 3300046460 | Bacteria | 5182 |
| 210 | Ga0495641_0046883 | 3300046461 | Bacteria | 1986 |
| 211 | Ga0495606_0000211 | 3300046507 | Bacteria | 103386 |
| 212 | Ga0495610_0030248 | 3300046512 | Bacteria | 2840 |
| 213 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 214 | Ga0495657_0020191 | 3300046675 | Bacteria | 4793 |
| 215 | Ga0495658_0013161 | 3300046683 | Bacteria | 4209 |
| 216 | Ga0495676_0025539 | 3300047321 | Bacteria | 5099 |
| 217 | Ga0495686_0072794 | 3300047472 | Bacteria | 2112 |
| 218 | Ga0495593_0011598 | 3300047673 | Bacteria | 5057 |
| 219 | Ga0496100_0028406 | 3300048903 | Bacteria | 3450 |
| 220 | Ga0496100_0078266 | 3300048903 | Bacteria | 2225 |
| 221 | Ga0496102_0000584 | 3300048905 | Bacteria | 38605 |
| 222 | Ga0496102_0033898 | 3300048905 | Bacteria | 4591 |
| 223 | Ga0496102_0073233 | 3300048905 | Bacteria | 3149 |
| 224 | Ga0496102_0144644 | 3300048905 | Bacteria | 2231 |
| 225 | Ga0496102_0307516 | 3300048905 | Bacteria | 1494 |
| 226 | Ga0496102_0480674 | 3300048905 | Bacteria | 1163 |
| 227 | Ga0496103_0000043 | 3300048906 | Bacteria | 167983 |
| 228 | Ga0496103_0037620 | 3300048906 | Bacteria | 2966 |
| 229 | Ga0496103_0514210 | 3300048906 | Bacteria | 766 |
| 230 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 231 | Ga0496104_0019301 | 3300048907 | Bacteria | 6235 |
| 232 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 233 | Ga0496105_0001456 | 3300048908 | Bacteria | 16668 |
| 234 | Ga0496105_0381290 | 3300048908 | Bacteria | 1122 |
| 235 | Ga0496106_0266757 | 3300048909 | Bacteria | 1370 |
| 236 | Ga0496107_0156030 | 3300048910 | Bacteria | 1690 |
| 237 | Ga0496108_0000045 | 3300048911 | Bacteria | 137416 |
| 238 | Ga0496108_0014730 | 3300048911 | Bacteria | 6381 |
| 239 | Ga0496108_0204056 | 3300048911 | Bacteria | 1715 |
| 240 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 241 | Ga0496109_0000032 | 3300048912 | Bacteria | 162984 |
| 242 | Ga0496110_0000033 | 3300048913 | Bacteria | 65539 |
| 243 | Ga0496110_0004497 | 3300048913 | Bacteria | 10814 |
| 244 | Ga0496110_0104441 | 3300048913 | Bacteria | 2542 |
| 245 | Ga0496111_0000125 | 3300048914 | Bacteria | 33642 |
| 246 | Ga0496111_0002513 | 3300048914 | Bacteria | 11065 |
| 247 | Ga0496112_0004148 | 3300048915 | Bacteria | 12199 |
| 248 | Ga0496112_0022765 | 3300048915 | Bacteria | 5977 |
| 249 | Ga0496113_0000007 | 3300048916 | Bacteria | 95884 |
| 250 | Ga0496113_0015282 | 3300048916 | Bacteria | 5271 |
| 251 | Ga0496119_0114064 | 3300048922 | Bacteria | 1495 |
| 252 | Ga0496120_0007058 | 3300048923 | Bacteria | 8437 |
| 253 | Ga0496121_0034964 | 3300048924 | Bacteria | 4510 |
| 254 | Ga0496121_0303636 | 3300048924 | Bacteria | 1082 |
| 255 | Ga0496126_0080240 | 3300048929 | Bacteria | 2888 |
| 256 | Ga0501032_0091114 | 3300049569 | Bacteria | 2023 |
| 257 | Ga0501036_0317271 | 3300049572 | Bacteria | 1302 |
| 258 | Ga0501039_0023496 | 3300049575 | Bacteria | 4731 |
| 259 | Ga0501047_0135270 | 3300049581 | Bacteria | 2345 |
| 260 | Ga0501047_0452128 | 3300049581 | Bacteria | 1114 |
| 261 | Ga0501048_0051963 | 3300049582 | Bacteria | 2916 |
| 262 | Ga0501048_0309133 | 3300049582 | Bacteria | 1125 |
| 263 | Ga0501072_0038849 | 3300049588 | Bacteria | 3736 |
| 264 | Ga0501079_0047269 | 3300049741 | Bacteria | 3320 |
| 265 | Ga0501035_0219711 | 3300049822 | Bacteria | 1623 |
| 266 | Ga0501045_0016040 | 3300049824 | Bacteria | 5315 |
| 267 | nmdc:mga0yw44_397581_c1 | 3300050492 | Bacteria | 931 |
| 268 | nmdc:mga0qj67_17720_c1 | 3300050509 | Bacteria | 5419 |
| 269 | nmdc:mga06r32_33159_c1 | 3300050510 | Bacteria | 4863 |
| 270 | nmdc:mga06r32_402437_c1 | 3300050510 | Bacteria | 1351 |
| 271 | nmdc:mga08y16_41550_c1 | 3300050511 | Bacteria | 4817 |
| 272 | nmdc:mga0n895_378675_c1 | 3300050512 | Bacteria | 1432 |
| 273 | nmdc:mga0n895_44189_c1 | 3300050512 | Bacteria | 4345 |
| 274 | nmdc:mga08x19_388951_c1 | 3300050514 | Bacteria | 977 |
| 275 | nmdc:mga0a205_65050_c1 | 3300050515 | Bacteria | 3523 |
| 276 | Ga0495612_0009009 | 3300053078 | Bacteria | 4047 |
| 277 | Ga0495655_0000011 | 3300053083 | Bacteria | 118490 |
| 278 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 279 | Ga0500628_000058 | 3300053129 | Bacteria | 32870 |
| 280 | Ga0501082_0095845 | 3300060353 | Bacteria | 2565 |
| 281 | Ga0466962_0014838 | 3300061719 | Bacteria | 3753 |
| 282 | Ga0530510_0038156 | 3300061734 | Bacteria | 3468 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046683 | Ga0495658_0013161 | Ga0495658_0013161_788_1465 | 218 |
| 2 | 3300049582 | Ga0501048_0309133 | Ga0501048_0309133_28_705 | 224 |
| 3 | 3300006173 | Ga0070716_100338098 | Ga0070716_1003380982 | 227 |
| 4 | 3300049569 | Ga0501032_0091114 | Ga0501032_0091114_865_1575 | 235 |
| 5 | 3300049572 | Ga0501036_0317271 | Ga0501036_0317271_396_1106 | 235 |
| 6 | 3300049575 | Ga0501039_0023496 | Ga0501039_0023496_1421_2131 | 235 |
| 7 | 3300049582 | Ga0501048_0051963 | Ga0501048_0051963_1350_2060 | 235 |
| 8 | 3300049588 | Ga0501072_0038849 | Ga0501072_0038849_515_1225 | 235 |
| 9 | 3300049741 | Ga0501079_0047269 | Ga0501079_0047269_490_1200 | 235 |
| 10 | 3300049824 | Ga0501045_0016040 | Ga0501045_0016040_1764_2474 | 235 |
| 11 | 3300060353 | Ga0501082_0095845 | Ga0501082_0095845_1520_2230 | 235 |
| 12 | 3300061734 | Ga0530510_0038156 | Ga0530510_0038156_928_1638 | 235 |
| 13 | 3300045976 | Ga0466967_0026717 | Ga0466967_0026717_2917_3642 | 239 |
| 14 | 3300005337 | Ga0070682_100087065 | Ga0070682_1000870652 | 240 |
| 15 | 3300005365 | Ga0070688_100355792 | Ga0070688_1003557921 | 240 |
| 16 | 3300005366 | Ga0070659_100267059 | Ga0070659_1002670591 | 240 |
| 17 | 3300005457 | Ga0070662_100323112 | Ga0070662_1003231122 | 240 |
| 18 | 3300005466 | Ga0070685_10109695 | Ga0070685_101096952 | 240 |
| 19 | 3300005564 | Ga0070664_100232253 | Ga0070664_1002322532 | 240 |
| 20 | 3300005616 | Ga0068852_100083147 | Ga0068852_1000831473 | 240 |
| 21 | 3300005616 | Ga0068852_100214523 | Ga0068852_1002145232 | 240 |
| 22 | 3300005834 | Ga0068851_10042679 | Ga0068851_100426792 | 240 |
| 23 | 3300009098 | Ga0105245_10696769 | Ga0105245_106967692 | 240 |
| 24 | 3300009148 | Ga0105243_10089751 | Ga0105243_100897512 | 240 |
| 25 | 3300009553 | Ga0105249_10785659 | Ga0105249_107856592 | 240 |
| 26 | 3300010375 | Ga0105239_10425866 | Ga0105239_104258662 | 240 |
| 27 | 3300013307 | Ga0157372_10866144 | Ga0157372_108661442 | 240 |
| 28 | 3300025927 | Ga0207687_10392980 | Ga0207687_103929802 | 240 |
| 29 | 3300025933 | Ga0207706_10238259 | Ga0207706_102382592 | 240 |
| 30 | 3300025935 | Ga0207709_10253680 | Ga0207709_102536802 | 240 |
| 31 | 3300025944 | Ga0207661_10637275 | Ga0207661_106372751 | 240 |
| 32 | 3300025945 | Ga0207679_10089093 | Ga0207679_100890933 | 240 |
| 33 | 3300026067 | Ga0207678_10561945 | Ga0207678_105619452 | 240 |
| 34 | 3300028379 | Ga0268266_10350671 | Ga0268266_103506712 | 240 |
| 35 | 3300028380 | Ga0268265_10948372 | Ga0268265_109483722 | 240 |
| 36 | 3300044694 | Ga0466963_0024297 | Ga0466963_0024297_224_949 | 240 |
| 37 | 3300045976 | Ga0466967_0189355 | Ga0466967_0189355_780_1505 | 240 |
| 38 | 3300048924 | Ga0496121_0303636 | Ga0496121_0303636_271_996 | 240 |
| 39 | 3300048929 | Ga0496126_0080240 | Ga0496126_0080240_928_1653 | 240 |
| 40 | 3300050492 | nmdc:mga0yw44_397581_c1 | nmdc:mga0yw44_397581_c1_59_784 | 240 |
| 41 | 3300061719 | Ga0466962_0014838 | Ga0466962_0014838_2782_3507 | 240 |
| 42 | 3300005544 | Ga0070686_100290132 | Ga0070686_1002901322 | 241 |
| 43 | 3300005840 | Ga0068870_10112959 | Ga0068870_101129592 | 241 |
| 44 | 3300048906 | Ga0496103_0514210 | Ga0496103_0514210_20_751 | 241 |
| 45 | 3300053078 | Ga0495612_0009009 | Ga0495612_0009009_695_1483 | 241 |
| 46 | 3300026142 | Ga0207698_10345827 | Ga0207698_103458272 | 243 |
| 47 | 3300045976 | Ga0466967_0015614 | Ga0466967_0015614_1718_2563 | 243 |
| 48 | 3300044842 | Ga0466957_0061254 | Ga0466957_0061254_43_807 | 244 |
| 49 | 3300045976 | Ga0466967_0450101 | Ga0466967_0450101_329_1093 | 244 |
| 50 | 3300005937 | Ga0081455_10033852 | Ga0081455_100338524 | 245 |
| 51 | 3300005339 | Ga0070660_100598592 | Ga0070660_1005985921 | 246 |
| 52 | 3300005366 | Ga0070659_100127987 | Ga0070659_1001279872 | 246 |
| 53 | 3300031548 | Ga0307408_100854377 | Ga0307408_1008543771 | 247 |
| 54 | 3300031852 | Ga0307410_10039167 | Ga0307410_100391672 | 247 |
| 55 | 3300031903 | Ga0307407_10147759 | Ga0307407_101477592 | 247 |
| 56 | 3300031995 | Ga0307409_100898430 | Ga0307409_1008984302 | 247 |
| 57 | 3300032002 | Ga0307416_100013636 | Ga0307416_1000136363 | 247 |
| 58 | 3300046460 | Ga0495638_0015168 | Ga0495638_0015168_3603_4409 | 247 |
| 59 | 3300013306 | Ga0163162_10705703 | Ga0163162_107057032 | 249 |
| 60 | 3300005329 | Ga0070683_100017862 | Ga0070683_1000178623 | 251 |
| 61 | 3300005329 | Ga0070683_100029458 | Ga0070683_1000294582 | 251 |
| 62 | 3300005331 | Ga0070670_100043115 | Ga0070670_1000431153 | 251 |
| 63 | 3300005344 | Ga0070661_100003829 | Ga0070661_1000038294 | 251 |
| 64 | 3300005354 | Ga0070675_100000058 | Ga0070675_10000005860 | 251 |
| 65 | 3300005365 | Ga0070688_100002866 | Ga0070688_1000028662 | 251 |
| 66 | 3300005436 | Ga0070713_100001783 | Ga0070713_1000017835 | 251 |
| 67 | 3300005466 | Ga0070685_10022662 | Ga0070685_100226622 | 251 |
| 68 | 3300005535 | Ga0070684_100045350 | Ga0070684_1000453502 | 251 |
| 69 | 3300005535 | Ga0070684_100532238 | Ga0070684_1005322382 | 251 |
| 70 | 3300005564 | Ga0070664_100104854 | Ga0070664_1001048542 | 251 |
| 71 | 3300005578 | Ga0068854_100001335 | Ga0068854_1000013356 | 251 |
| 72 | 3300005614 | Ga0068856_100054298 | Ga0068856_1000542983 | 251 |
| 73 | 3300005616 | Ga0068852_100021460 | Ga0068852_1000214604 | 251 |
| 74 | 3300006175 | Ga0070712_100010641 | Ga0070712_1000106414 | 251 |
| 75 | 3300009174 | Ga0105241_10154412 | Ga0105241_101544123 | 251 |
| 76 | 3300009177 | Ga0105248_10000032 | Ga0105248_10000032122 | 251 |
| 77 | 3300013297 | Ga0157378_10005494 | Ga0157378_100054944 | 251 |
| 78 | 3300025911 | Ga0207654_10099017 | Ga0207654_100990172 | 251 |
| 79 | 3300025915 | Ga0207693_10009297 | Ga0207693_100092973 | 251 |
| 80 | 3300025920 | Ga0207649_10000640 | Ga0207649_100006404 | 251 |
| 81 | 3300025925 | Ga0207650_10167660 | Ga0207650_101676603 | 251 |
| 82 | 3300025926 | Ga0207659_10000020 | Ga0207659_1000002046 | 251 |
| 83 | 3300025928 | Ga0207700_10000070 | Ga0207700_1000007045 | 251 |
| 84 | 3300025941 | Ga0207711_10000020 | Ga0207711_10000020252 | 251 |
| 85 | 3300025944 | Ga0207661_10002063 | Ga0207661_100020635 | 251 |
| 86 | 3300025944 | Ga0207661_10010753 | Ga0207661_100107532 | 251 |
| 87 | 3300025945 | Ga0207679_10091439 | Ga0207679_100914393 | 251 |
| 88 | 3300025981 | Ga0207640_10000285 | Ga0207640_1000028519 | 251 |
| 89 | 3300026078 | Ga0207702_10012042 | Ga0207702_100120424 | 251 |
| 90 | 3300026142 | Ga0207698_10008377 | Ga0207698_100083774 | 251 |
| 91 | 3300032126 | Ga0307415_100001131 | Ga0307415_10000113111 | 251 |
| 92 | 3300045976 | Ga0466967_0000046 | Ga0466967_0000046_21701_22489 | 251 |
| 93 | 3300046507 | Ga0495606_0000211 | Ga0495606_0000211_51533_52321 | 251 |
| 94 | 3300046512 | Ga0495610_0030248 | Ga0495610_0030248_350_1138 | 251 |
| 95 | 3300048911 | Ga0496108_0014730 | Ga0496108_0014730_3895_4683 | 251 |
| 96 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_146691_147479 | 251 |
| 97 | 3300053085 | Ga0495619_0000022 | Ga0495619_0000022_136844_137632 | 251 |
| 98 | 3300048905 | Ga0496102_0033898 | Ga0496102_0033898_2984_3763 | 252 |
| 99 | 3300047472 | Ga0495686_0072794 | Ga0495686_0072794_515_1282 | 253 |
| 100 | 3300005365 | Ga0070688_100012800 | Ga0070688_1000128003 | 254 |
| 101 | 3300005466 | Ga0070685_10000018 | Ga0070685_10000018100 | 254 |
| 102 | 3300013102 | Ga0157371_10003156 | Ga0157371_1000315612 | 254 |
| 103 | 3300031852 | Ga0307410_10635197 | Ga0307410_106351971 | 254 |
| 104 | 3300032002 | Ga0307416_100188972 | Ga0307416_1001889723 | 254 |
| 105 | 3300005441 | Ga0070700_100504496 | Ga0070700_1005044961 | 255 |
| 106 | 3300046675 | Ga0495657_0020191 | Ga0495657_0020191_532_1305 | 255 |
| 107 | 3300048911 | Ga0496108_0000045 | Ga0496108_0000045_125313_126113 | 255 |
| 108 | 3300048912 | Ga0496109_0000032 | Ga0496109_0000032_11313_12113 | 255 |
| 109 | 3300009098 | Ga0105245_10006628 | Ga0105245_100066286 | 256 |
| 110 | 3300009098 | Ga0105245_10015419 | Ga0105245_100154193 | 256 |
| 111 | 3300010375 | Ga0105239_10081851 | Ga0105239_100818512 | 256 |
| 112 | 3300013105 | Ga0157369_10000099 | Ga0157369_1000009914 | 256 |
| 113 | 3300026118 | Ga0207675_100131941 | Ga0207675_1001319411 | 256 |
| 114 | 3300044842 | Ga0466957_0002421 | Ga0466957_0002421_4097_4903 | 256 |
| 115 | 3300046517 | Ga0495630_0000018 | Ga0495630_0000018_10022_10816 | 256 |
| 116 | 3300047673 | Ga0495593_0011598 | Ga0495593_0011598_3176_3976 | 256 |
| 117 | 3300048913 | Ga0496110_0000033 | Ga0496110_0000033_53236_54030 | 256 |
| 118 | 3300048914 | Ga0496111_0000125 | Ga0496111_0000125_8397_9191 | 256 |
| 119 | 3300048915 | Ga0496112_0022765 | Ga0496112_0022765_1320_2114 | 256 |
| 120 | 3300048916 | Ga0496113_0000007 | Ga0496113_0000007_84535_85329 | 256 |
| 121 | 3300048922 | Ga0496119_0114064 | Ga0496119_0114064_565_1380 | 257 |
| 122 | 3300048923 | Ga0496120_0007058 | Ga0496120_0007058_1228_2043 | 257 |
| 123 | 3300005335 | Ga0070666_10048715 | Ga0070666_100487152 | 258 |
| 124 | 3300005336 | Ga0070680_100333095 | Ga0070680_1003330952 | 258 |
| 125 | 3300005355 | Ga0070671_100077488 | Ga0070671_1000774882 | 258 |
| 126 | 3300005367 | Ga0070667_100087297 | Ga0070667_1000872972 | 258 |
| 127 | 3300005367 | Ga0070667_100151569 | Ga0070667_1001515692 | 258 |
| 128 | 3300005455 | Ga0070663_100017465 | Ga0070663_1000174653 | 258 |
| 129 | 3300005458 | Ga0070681_10032794 | Ga0070681_100327944 | 258 |
| 130 | 3300005530 | Ga0070679_100021403 | Ga0070679_1000214035 | 258 |
| 131 | 3300005616 | Ga0068852_100000012 | Ga0068852_100000012104 | 258 |
| 132 | 3300005841 | Ga0068863_100041255 | Ga0068863_1000412553 | 258 |
| 133 | 3300005841 | Ga0068863_100078422 | Ga0068863_1000784222 | 258 |
| 134 | 3300005937 | Ga0081455_10079247 | Ga0081455_100792472 | 258 |
| 135 | 3300006846 | Ga0075430_100020602 | Ga0075430_1000206022 | 258 |
| 136 | 3300009101 | Ga0105247_10003405 | Ga0105247_100034057 | 258 |
| 137 | 3300009176 | Ga0105242_10000357 | Ga0105242_1000035724 | 258 |
| 138 | 3300009176 | Ga0105242_10000530 | Ga0105242_100005305 | 258 |
| 139 | 3300025900 | Ga0207710_10000369 | Ga0207710_100003698 | 258 |
| 140 | 3300025903 | Ga0207680_10017856 | Ga0207680_100178564 | 258 |
| 141 | 3300025917 | Ga0207660_10283298 | Ga0207660_102832982 | 258 |
| 142 | 3300025921 | Ga0207652_10014685 | Ga0207652_100146852 | 258 |
| 143 | 3300025924 | Ga0207694_10156107 | Ga0207694_101561072 | 258 |
| 144 | 3300025934 | Ga0207686_10000156 | Ga0207686_1000015647 | 258 |
| 145 | 3300025934 | Ga0207686_10000438 | Ga0207686_1000043816 | 258 |
| 146 | 3300025986 | Ga0207658_10130163 | Ga0207658_101301632 | 258 |
| 147 | 3300026067 | Ga0207678_10018954 | Ga0207678_100189542 | 258 |
| 148 | 3300026088 | Ga0207641_10037823 | Ga0207641_100378232 | 258 |
| 149 | 3300026088 | Ga0207641_10038504 | Ga0207641_100385042 | 258 |
| 150 | 3300026142 | Ga0207698_10000012 | Ga0207698_10000012223 | 258 |
| 151 | 3300046459 | Ga0495629_0005185 | Ga0495629_0005185_1171_1989 | 258 |
| 152 | 3300046459 | Ga0495629_0007342 | Ga0495629_0007342_3675_4484 | 258 |
| 153 | 3300047321 | Ga0495676_0025539 | Ga0495676_0025539_2476_3294 | 258 |
| 154 | 3300048903 | Ga0496100_0078266 | Ga0496100_0078266_558_1379 | 258 |
| 155 | 3300048905 | Ga0496102_0000584 | Ga0496102_0000584_16207_17025 | 258 |
| 156 | 3300048905 | Ga0496102_0073233 | Ga0496102_0073233_1938_2744 | 258 |
| 157 | 3300048905 | Ga0496102_0307516 | Ga0496102_0307516_420_1229 | 258 |
| 158 | 3300048906 | Ga0496103_0000043 | Ga0496103_0000043_94951_95769 | 258 |
| 159 | 3300048906 | Ga0496103_0037620 | Ga0496103_0037620_1230_2036 | 258 |
| 160 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_653166_654008 | 258 |
| 161 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_674171_675013 | 258 |
| 162 | 3300048908 | Ga0496105_0001456 | Ga0496105_0001456_12290_13111 | 258 |
| 163 | 3300048908 | Ga0496105_0381290 | Ga0496105_0381290_229_1047 | 258 |
| 164 | 3300048924 | Ga0496121_0034964 | Ga0496121_0034964_419_1240 | 258 |
| 165 | 3300049581 | Ga0501047_0135270 | Ga0501047_0135270_883_1701 | 258 |
| 166 | 3300049581 | Ga0501047_0452128 | Ga0501047_0452128_247_1065 | 258 |
| 167 | 3300049822 | Ga0501035_0219711 | Ga0501035_0219711_721_1539 | 258 |
| 168 | 3300050509 | nmdc:mga0qj67_17720_c1 | nmdc:mga0qj67_17720_c1_3764_4570 | 258 |
| 169 | 3300053083 | Ga0495655_0000011 | Ga0495655_0000011_64946_65764 | 258 |
| 170 | 3300053129 | Ga0500628_000058 | Ga0500628_000058_19136_19954 | 258 |
| 171 | 3300005335 | Ga0070666_10146107 | Ga0070666_101461072 | 259 |
| 172 | 3300005347 | Ga0070668_100027772 | Ga0070668_1000277723 | 259 |
| 173 | 3300005456 | Ga0070678_100031489 | Ga0070678_1000314892 | 259 |
| 174 | 3300005548 | Ga0070665_100007985 | Ga0070665_1000079857 | 259 |
| 175 | 3300005578 | Ga0068854_100006441 | Ga0068854_1000064416 | 259 |
| 176 | 3300005834 | Ga0068851_10001094 | Ga0068851_100010945 | 259 |
| 177 | 3300005834 | Ga0068851_10020316 | Ga0068851_100203162 | 259 |
| 178 | 3300006237 | Ga0097621_100054683 | Ga0097621_1000546833 | 259 |
| 179 | 3300006881 | Ga0068865_100000101 | Ga0068865_10000010128 | 259 |
| 180 | 3300013297 | Ga0157378_10060107 | Ga0157378_100601072 | 259 |
| 181 | 3300013308 | Ga0157375_10005846 | Ga0157375_100058464 | 259 |
| 182 | 3300014326 | Ga0157380_10001287 | Ga0157380_1000128713 | 259 |
| 183 | 3300025321 | Ga0207656_10000325 | Ga0207656_100003255 | 259 |
| 184 | 3300025321 | Ga0207656_10005393 | Ga0207656_100053935 | 259 |
| 185 | 3300025903 | Ga0207680_10059291 | Ga0207680_100592912 | 259 |
| 186 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007125 | 259 |
| 187 | 3300025927 | Ga0207687_10003179 | Ga0207687_100031795 | 259 |
| 188 | 3300025935 | Ga0207709_10009255 | Ga0207709_100092552 | 259 |
| 189 | 3300025938 | Ga0207704_10000025 | Ga0207704_10000025111 | 259 |
| 190 | 3300025972 | Ga0207668_10008272 | Ga0207668_100082723 | 259 |
| 191 | 3300026023 | Ga0207677_10001635 | Ga0207677_100016353 | 259 |
| 192 | 3300026118 | Ga0207675_100014368 | Ga0207675_1000143682 | 259 |
| 193 | 3300026121 | Ga0207683_10027098 | Ga0207683_100270983 | 259 |
| 194 | 3300028379 | Ga0268266_10000553 | Ga0268266_1000055344 | 259 |
| 195 | 3300028563 | Ga0265319_1000028 | Ga0265319_1000028112 | 259 |
| 196 | 3300028800 | Ga0265338_10000230 | Ga0265338_1000023040 | 259 |
| 197 | 3300031250 | Ga0265331_10054554 | Ga0265331_100545542 | 259 |
| 198 | 3300041512 | Ga0451853_2508484 | Ga0451853_2508484_337_1167 | 259 |
| 199 | 3300046461 | Ga0495641_0046883 | Ga0495641_0046883_677_1501 | 259 |
| 200 | 3300048913 | Ga0496110_0104441 | Ga0496110_0104441_747_1571 | 259 |
| 201 | 3300005329 | Ga0070683_100001645 | Ga0070683_10000164510 | 260 |
| 202 | 3300005334 | Ga0068869_100004396 | Ga0068869_1000043962 | 260 |
| 203 | 3300005337 | Ga0070682_100006554 | Ga0070682_1000065542 | 260 |
| 204 | 3300005338 | Ga0068868_100015787 | Ga0068868_1000157874 | 260 |
| 205 | 3300005339 | Ga0070660_100104964 | Ga0070660_1001049642 | 260 |
| 206 | 3300005341 | Ga0070691_10023211 | Ga0070691_100232112 | 260 |
| 207 | 3300005344 | Ga0070661_100148329 | Ga0070661_1001483292 | 260 |
| 208 | 3300005345 | Ga0070692_10088212 | Ga0070692_100882122 | 260 |
| 209 | 3300005354 | Ga0070675_100102242 | Ga0070675_1001022422 | 260 |
| 210 | 3300005355 | Ga0070671_100306932 | Ga0070671_1003069322 | 260 |
| 211 | 3300005364 | Ga0070673_100009422 | Ga0070673_1000094222 | 260 |
| 212 | 3300005366 | Ga0070659_100012767 | Ga0070659_1000127671 | 260 |
| 213 | 3300005367 | Ga0070667_100681450 | Ga0070667_1006814502 | 260 |
| 214 | 3300005441 | Ga0070700_100001171 | Ga0070700_1000011715 | 260 |
| 215 | 3300005457 | Ga0070662_100014011 | Ga0070662_1000140111 | 260 |
| 216 | 3300005466 | Ga0070685_10035559 | Ga0070685_100355592 | 260 |
| 217 | 3300005535 | Ga0070684_100005809 | Ga0070684_1000058097 | 260 |
| 218 | 3300005549 | Ga0070704_100288820 | Ga0070704_1002888202 | 260 |
| 219 | 3300005564 | Ga0070664_100326828 | Ga0070664_1003268282 | 260 |
| 220 | 3300005578 | Ga0068854_100059201 | Ga0068854_1000592012 | 260 |
| 221 | 3300005614 | Ga0068856_100019982 | Ga0068856_1000199825 | 260 |
| 222 | 3300005616 | Ga0068852_100042843 | Ga0068852_1000428434 | 260 |
| 223 | 3300005617 | Ga0068859_100133410 | Ga0068859_1001334102 | 260 |
| 224 | 3300005618 | Ga0068864_100002162 | Ga0068864_1000021627 | 260 |
| 225 | 3300005842 | Ga0068858_100652798 | Ga0068858_1006527982 | 260 |
| 226 | 3300006175 | Ga0070712_100040117 | Ga0070712_1000401172 | 260 |
| 227 | 3300006847 | Ga0075431_100135035 | Ga0075431_1001350352 | 260 |
| 228 | 3300006852 | Ga0075433_10014568 | Ga0075433_100145682 | 260 |
| 229 | 3300006871 | Ga0075434_100065097 | Ga0075434_1000650972 | 260 |
| 230 | 3300006871 | Ga0075434_100131650 | Ga0075434_1001316502 | 260 |
| 231 | 3300006881 | Ga0068865_100470214 | Ga0068865_1004702142 | 260 |
| 232 | 3300006914 | Ga0075436_100336621 | Ga0075436_1003366212 | 260 |
| 233 | 3300006931 | Ga0097620_100133411 | Ga0097620_1001334112 | 260 |
| 234 | 3300009094 | Ga0111539_10210259 | Ga0111539_102102592 | 260 |
| 235 | 3300009098 | Ga0105245_10002830 | Ga0105245_1000283012 | 260 |
| 236 | 3300009148 | Ga0105243_10079502 | Ga0105243_100795022 | 260 |
| 237 | 3300009176 | Ga0105242_10356428 | Ga0105242_103564282 | 260 |
| 238 | 3300010375 | Ga0105239_10027567 | Ga0105239_100275675 | 260 |
| 239 | 3300011119 | Ga0105246_10496087 | Ga0105246_104960871 | 260 |
| 240 | 3300013308 | Ga0157375_10185467 | Ga0157375_101854672 | 260 |
| 241 | 3300014325 | Ga0163163_10048448 | Ga0163163_100484482 | 260 |
| 242 | 3300014745 | Ga0157377_10003442 | Ga0157377_100034423 | 260 |
| 243 | 3300014968 | Ga0157379_10289234 | Ga0157379_102892342 | 260 |
| 244 | 3300017792 | Ga0163161_10605429 | Ga0163161_106054291 | 260 |
| 245 | 3300025901 | Ga0207688_10002755 | Ga0207688_100027554 | 260 |
| 246 | 3300025915 | Ga0207693_10056096 | Ga0207693_100560962 | 260 |
| 247 | 3300025925 | Ga0207650_10192547 | Ga0207650_101925472 | 260 |
| 248 | 3300025926 | Ga0207659_10061774 | Ga0207659_100617742 | 260 |
| 249 | 3300025927 | Ga0207687_10013707 | Ga0207687_100137072 | 260 |
| 250 | 3300025931 | Ga0207644_10386540 | Ga0207644_103865402 | 260 |
| 251 | 3300025932 | Ga0207690_10513379 | Ga0207690_105133792 | 260 |
| 252 | 3300025933 | Ga0207706_10021102 | Ga0207706_100211022 | 260 |
| 253 | 3300025934 | Ga0207686_10181140 | Ga0207686_101811402 | 260 |
| 254 | 3300025936 | Ga0207670_10070509 | Ga0207670_100705092 | 260 |
| 255 | 3300025942 | Ga0207689_10014766 | Ga0207689_100147664 | 260 |
| 256 | 3300025960 | Ga0207651_10487004 | Ga0207651_104870042 | 260 |
| 257 | 3300025981 | Ga0207640_10021270 | Ga0207640_100212702 | 260 |
| 258 | 3300026035 | Ga0207703_10339641 | Ga0207703_103396412 | 260 |
| 259 | 3300026067 | Ga0207678_10029702 | Ga0207678_100297023 | 260 |
| 260 | 3300026075 | Ga0207708_10000752 | Ga0207708_100007526 | 260 |
| 261 | 3300026078 | Ga0207702_10455877 | Ga0207702_104558772 | 260 |
| 262 | 3300026121 | Ga0207683_10024444 | Ga0207683_100244445 | 260 |
| 263 | 3300027907 | Ga0207428_10040590 | Ga0207428_100405904 | 260 |
| 264 | 3300038443 | Ga0395901_0373401 | Ga0395901_0373401_22_804 | 260 |
| 265 | 3300048903 | Ga0496100_0028406 | Ga0496100_0028406_59_841 | 260 |
| 266 | 3300048905 | Ga0496102_0144644 | Ga0496102_0144644_204_998 | 260 |
| 267 | 3300048905 | Ga0496102_0480674 | Ga0496102_0480674_175_957 | 260 |
| 268 | 3300048907 | Ga0496104_0019301 | Ga0496104_0019301_5240_6022 | 260 |
| 269 | 3300048909 | Ga0496106_0266757 | Ga0496106_0266757_445_1227 | 260 |
| 270 | 3300048910 | Ga0496107_0156030 | Ga0496107_0156030_463_1245 | 260 |
| 271 | 3300048911 | Ga0496108_0204056 | Ga0496108_0204056_590_1372 | 260 |
| 272 | 3300048913 | Ga0496110_0004497 | Ga0496110_0004497_9711_10493 | 260 |
| 273 | 3300048914 | Ga0496111_0002513 | Ga0496111_0002513_7830_8612 | 260 |
| 274 | 3300048915 | Ga0496112_0004148 | Ga0496112_0004148_7031_7813 | 260 |
| 275 | 3300048916 | Ga0496113_0015282 | Ga0496113_0015282_52_834 | 260 |
| 276 | 3300050510 | nmdc:mga06r32_33159_c1 | nmdc:mga06r32_33159_c1_1506_2288 | 260 |
| 277 | 3300050510 | nmdc:mga06r32_402437_c1 | nmdc:mga06r32_402437_c1_144_926 | 260 |
| 278 | 3300050511 | nmdc:mga08y16_41550_c1 | nmdc:mga08y16_41550_c1_2955_3737 | 260 |
| 279 | 3300050512 | nmdc:mga0n895_378675_c1 | nmdc:mga0n895_378675_c1_428_1210 | 260 |
| 280 | 3300050512 | nmdc:mga0n895_44189_c1 | nmdc:mga0n895_44189_c1_2408_3190 | 260 |
| 281 | 3300050514 | nmdc:mga08x19_388951_c1 | nmdc:mga08x19_388951_c1_32_814 | 260 |
| 282 | 3300050515 | nmdc:mga0a205_65050_c1 | nmdc:mga0a205_65050_c1_654_1436 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fij-assembly1.cif.gz_B | crystal structure of a uncharacterized protein lin1909 | 0.9403 | 4 | 248 |
| 3fij-assembly1.cif.gz_F | crystal structure of a uncharacterized protein lin1909 | 0.9354 | 4 | 248 |
| 3fij-assembly1.cif.gz_B | crystal structure of a uncharacterized protein lin1909 | 0.9322 | 4 | 248 |
| 3fij-assembly1.cif.gz_G | crystal structure of a uncharacterized protein lin1909 | 0.9311 | 4 | 247 |
| 3fij-assembly1.cif.gz_F | crystal structure of a uncharacterized protein lin1909 | 0.9273 | 4 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fijG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9321 | 4 | 247 | 3.40.50.880 |
| af_O33341_63_305_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9269 | 5 | 253 | 3.40.50.880 |
| 3fijG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9239 | 4 | 247 | 3.40.50.880 |
| af_O33341_63_305_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.905 | 5 | 253 | 3.40.50.880 |
| af_P76038_5_253_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8839 | 5 | 253 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F2N8F7-F1-model_v4 | Uncharacterized protein | 0.9673 | 39 | 249 |
GO:0005829
GO:0006541 GO:0006598 GO:0033969 |
| AF-A0A7C6ING7-F1-model_v4 | Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | 0.967 | 46 | 250 |
GO:0005829
GO:0006541 GO:0006598 GO:0033969 |
| AF-A0A0A0M331-F1-model_v4 | deleted | 0.9621 | 37 | 143 |
|
| AF-A0A842YL35-F1-model_v4 | Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | 0.961 | 40 | 247 |
GO:0005829
GO:0006541 GO:0006598 GO:0033969 |
| AF-A0A7C6HGH3-F1-model_v4 | Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | 0.9592 | 4 | 250 |
GO:0005829
GO:0006541 GO:0006598 GO:0033969 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar