F384920

General Info

Members Datasets Scaffolds Average Seq Length
282 178 282 261

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10003156|Ga0157371_1000315612
Length 280
Sequence MKRGAGHGRPLIGVTTSEVREPKRIQQTPESEPKVREMVLGLTYLRALEAAGALPMVVPPLPEEAIGTLLDRLDGICLSGGPDLDPETYGADPHPELGPIEPDLDRFELAVARCADKREIPILAICRGTQALNVARGGTLIQHLPEASPGFAHRQSAPGNETSHTIDIEAGSRLAAALGEDEVEVRDELDVNSFHHQAIERLGDGLKITARAPDGTPEAIEDPSRPFLIGVQWHAETLVHRAYEAALFRHFVETSLRPPDRRISASSLARVQSTPRSLRP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 11.35
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100001645 3300005329 Bacteria 17312
2 Ga0070683_100017862 3300005329 Bacteria 6270
3 Ga0070683_100029458 3300005329 Bacteria 4971
4 Ga0070670_100043115 3300005331 Bacteria 3879
5 Ga0068869_100004396 3300005334 Bacteria 8755
6 Ga0070666_10048715 3300005335 Bacteria 2848
7 Ga0070666_10146107 3300005335 Bacteria 1648
8 Ga0070680_100333095 3300005336 Bacteria 1289
9 Ga0070682_100006554 3300005337 Bacteria 6531
10 Ga0070682_100087065 3300005337 Bacteria 2036
11 Ga0068868_100015787 3300005338 Bacteria 5594
12 Ga0070660_100104964 3300005339 Bacteria 2242
13 Ga0070660_100598592 3300005339 Bacteria 922
14 Ga0070691_10023211 3300005341 Bacteria 2880
15 Ga0070661_100003829 3300005344 Bacteria 10359
16 Ga0070661_100148329 3300005344 Bacteria 1772
17 Ga0070692_10088212 3300005345 Bacteria 1682
18 Ga0070668_100027772 3300005347 Bacteria 4296
19 Ga0070675_100000058 3300005354 Bacteria 66874
20 Ga0070675_100102242 3300005354 Bacteria 2414
21 Ga0070671_100077488 3300005355 Bacteria 2778
22 Ga0070671_100306932 3300005355 Bacteria 1351
23 Ga0070673_100009422 3300005364 Bacteria 6554
24 Ga0070688_100002866 3300005365 Bacteria 8796
25 Ga0070688_100012800 3300005365 Bacteria 4711
26 Ga0070688_100355792 3300005365 Bacteria 1073
27 Ga0070659_100012767 3300005366 Bacteria 6237
28 Ga0070659_100127987 3300005366 Unclassified 2061
29 Ga0070659_100267059 3300005366 Bacteria 1421
30 Ga0070667_100087297 3300005367 Bacteria 2677
31 Ga0070667_100151569 3300005367 Bacteria 2037
32 Ga0070667_100681450 3300005367 Bacteria 950
33 Ga0070713_100001783 3300005436 Bacteria 13874
34 Ga0070700_100001171 3300005441 Bacteria 12973
35 Ga0070700_100504496 3300005441 Bacteria 931
36 Ga0070663_100017465 3300005455 Bacteria 4683
37 Ga0070678_100031489 3300005456 Bacteria 3660
38 Ga0070662_100014011 3300005457 Bacteria 5344
39 Ga0070662_100323112 3300005457 Bacteria 1259
40 Ga0070681_10032794 3300005458 Bacteria 5214
41 Ga0070685_10000018 3300005466 Bacteria 110132
42 Ga0070685_10022662 3300005466 Bacteria 3427
43 Ga0070685_10035559 3300005466 Bacteria 2811
44 Ga0070685_10109695 3300005466 Bacteria 1698
45 Ga0070679_100021403 3300005530 Bacteria 6312
46 Ga0070684_100005809 3300005535 Bacteria 9491
47 Ga0070684_100045350 3300005535 Bacteria 3807
48 Ga0070684_100532238 3300005535 Bacteria 1090
49 Ga0070686_100290132 3300005544 Bacteria 1210
50 Ga0070665_100007985 3300005548 Bacteria 10722
51 Ga0070704_100288820 3300005549 Bacteria 1362
52 Ga0070664_100104854 3300005564 Bacteria 2462
53 Ga0070664_100232253 3300005564 Bacteria 1653
54 Ga0070664_100326828 3300005564 Bacteria 1391
55 Ga0068854_100001335 3300005578 Bacteria 14874
56 Ga0068854_100006441 3300005578 Bacteria 7467
57 Ga0068854_100059201 3300005578 Bacteria 2768
58 Ga0068856_100019982 3300005614 Bacteria 6501
59 Ga0068856_100054298 3300005614 Bacteria 3951
60 Ga0068852_100000012 3300005616 Bacteria 140734
61 Ga0068852_100021460 3300005616 Bacteria 5157
62 Ga0068852_100042843 3300005616 Bacteria 3834
63 Ga0068852_100083147 3300005616 Bacteria 2846
64 Ga0068852_100214523 3300005616 Bacteria 1828
65 Ga0068859_100133410 3300005617 Bacteria 2555
66 Ga0068864_100002162 3300005618 Bacteria 16232
67 Ga0068851_10001094 3300005834 Bacteria 11760
68 Ga0068851_10020316 3300005834 Bacteria 3215
69 Ga0068851_10042679 3300005834 Bacteria 2284
70 Ga0068870_10112959 3300005840 Bacteria 1554
71 Ga0068863_100041255 3300005841 Bacteria 4388
72 Ga0068863_100078422 3300005841 Bacteria 3128
73 Ga0068858_100652798 3300005842 Bacteria 1022
74 Ga0081455_10033852 3300005937 Bacteria 4585
75 Ga0081455_10079247 3300005937 Bacteria 2697
76 Ga0070716_100338098 3300006173 Bacteria 1061
77 Ga0070712_100010641 3300006175 Bacteria 5811
78 Ga0070712_100040117 3300006175 Bacteria 3208
79 Ga0097621_100054683 3300006237 Bacteria 3257
80 Ga0075430_100020602 3300006846 Bacteria 5609
81 Ga0075431_100135035 3300006847 Unclassified 2543
82 Ga0075433_10014568 3300006852 Bacteria 6428
83 Ga0075434_100065097 3300006871 Bacteria 3630
84 Ga0075434_100131650 3300006871 Bacteria 2520
85 Ga0068865_100000101 3300006881 Bacteria 44302
86 Ga0068865_100470214 3300006881 Bacteria 1043
87 Ga0075436_100336621 3300006914 Bacteria 1086
88 Ga0097620_100133411 3300006931 Bacteria 2555
89 Ga0111539_10210259 3300009094 Bacteria 2267
90 Ga0105245_10002830 3300009098 Bacteria 15591
91 Ga0105245_10006628 3300009098 Bacteria 10169
92 Ga0105245_10015419 3300009098 Bacteria 6661
93 Ga0105245_10696769 3300009098 Bacteria 1049
94 Ga0105247_10003405 3300009101 Bacteria 10392
95 Ga0105243_10079502 3300009148 Bacteria 2673
96 Ga0105243_10089751 3300009148 Bacteria 2528
97 Ga0105241_10154412 3300009174 Bacteria 1881
98 Ga0105242_10000357 3300009176 Bacteria 36537
99 Ga0105242_10000530 3300009176 Bacteria 30053
100 Ga0105242_10356428 3300009176 Bacteria 1353
101 Ga0105248_10000032 3300009177 Bacteria 201114
102 Ga0105249_10785659 3300009553 Bacteria 1015
103 Ga0105239_10027567 3300010375 Bacteria 6252
104 Ga0105239_10081851 3300010375 Bacteria 3554
105 Ga0105239_10425866 3300010375 Bacteria 1504
106 Ga0105246_10496087 3300011119 Bacteria 1036
107 Ga0157371_10003156 3300013102 Bacteria 15182
108 Ga0157369_10000099 3300013105 Bacteria 120032
109 Ga0157378_10005494 3300013297 Bacteria 11110
110 Ga0157378_10060107 3300013297 Bacteria 3391
111 Ga0163162_10705703 3300013306 Unclassified 1130
112 Ga0157372_10866144 3300013307 Bacteria 1049
113 Ga0157375_10005846 3300013308 Bacteria 10706
114 Ga0157375_10185467 3300013308 Bacteria 2233
115 Ga0163163_10048448 3300014325 Bacteria 4178
116 Ga0157380_10001287 3300014326 Bacteria 16323
117 Ga0157377_10003442 3300014745 Bacteria 7169
118 Ga0157379_10289234 3300014968 Bacteria 1492
119 Ga0163161_10605429 3300017792 Bacteria 904
120 Ga0207656_10000325 3300025321 Bacteria 16400
121 Ga0207656_10005393 3300025321 Bacteria 4516
122 Ga0207710_10000369 3300025900 Bacteria 31539
123 Ga0207688_10002755 3300025901 Bacteria 9524
124 Ga0207680_10017856 3300025903 Bacteria 3756
125 Ga0207680_10059291 3300025903 Bacteria 2324
126 Ga0207654_10099017 3300025911 Bacteria 1792
127 Ga0207693_10009297 3300025915 Bacteria 8020
128 Ga0207693_10056096 3300025915 Bacteria 3089
129 Ga0207660_10283298 3300025917 Bacteria 1316
130 Ga0207649_10000640 3300025920 Bacteria 23374
131 Ga0207652_10014685 3300025921 Bacteria 6347
132 Ga0207694_10156107 3300025924 Bacteria 1841
133 Ga0207650_10167660 3300025925 Bacteria 1743
134 Ga0207650_10192547 3300025925 Bacteria 1630
135 Ga0207659_10000020 3300025926 Bacteria 151552
136 Ga0207659_10061774 3300025926 Bacteria 2702
137 Ga0207687_10000007 3300025927 Bacteria 604185
138 Ga0207687_10003179 3300025927 Bacteria 11151
139 Ga0207687_10013707 3300025927 Bacteria 5292
140 Ga0207687_10392980 3300025927 Bacteria 1139
141 Ga0207700_10000070 3300025928 Bacteria 62833
142 Ga0207644_10386540 3300025931 Bacteria 1142
143 Ga0207690_10513379 3300025932 Bacteria 970
144 Ga0207706_10021102 3300025933 Bacteria 5851
145 Ga0207706_10238259 3300025933 Bacteria 1591
146 Ga0207686_10000156 3300025934 Bacteria 51745
147 Ga0207686_10000438 3300025934 Bacteria 27955
148 Ga0207686_10181140 3300025934 Bacteria 1494
149 Ga0207709_10009255 3300025935 Bacteria 5425
150 Ga0207709_10253680 3300025935 Bacteria 1286
151 Ga0207670_10070509 3300025936 Bacteria 2414
152 Ga0207704_10000025 3300025938 Bacteria 135523
153 Ga0207711_10000020 3300025941 Bacteria 363325
154 Ga0207689_10014766 3300025942 Bacteria 6631
155 Ga0207661_10002063 3300025944 Bacteria 13830
156 Ga0207661_10010753 3300025944 Bacteria 6597
157 Ga0207661_10637275 3300025944 Bacteria 979
158 Ga0207679_10089093 3300025945 Bacteria 2381
159 Ga0207679_10091439 3300025945 Bacteria 2355
160 Ga0207651_10487004 3300025960 Bacteria 1064
161 Ga0207668_10008272 3300025972 Bacteria 6198
162 Ga0207640_10000285 3300025981 Bacteria 33957
163 Ga0207640_10021270 3300025981 Bacteria 3865
164 Ga0207658_10130163 3300025986 Bacteria 2021
165 Ga0207677_10001635 3300026023 Bacteria 11877
166 Ga0207703_10339641 3300026035 Bacteria 1380
167 Ga0207678_10018954 3300026067 Bacteria 6046
168 Ga0207678_10029702 3300026067 Bacteria 4772
169 Ga0207678_10561945 3300026067 Bacteria 998
170 Ga0207708_10000752 3300026075 Bacteria 24268
171 Ga0207702_10012042 3300026078 Bacteria 7191
172 Ga0207702_10455877 3300026078 Bacteria 1241
173 Ga0207641_10037823 3300026088 Bacteria 4032
174 Ga0207641_10038504 3300026088 Bacteria 3998
175 Ga0207675_100014368 3300026118 Bacteria 7383
176 Ga0207675_100131941 3300026118 Bacteria 2369
177 Ga0207683_10024444 3300026121 Bacteria 5204
178 Ga0207683_10027098 3300026121 Bacteria 4953
179 Ga0207698_10000012 3300026142 Bacteria 260061
180 Ga0207698_10008377 3300026142 Bacteria 6535
181 Ga0207698_10345827 3300026142 Bacteria 1403
182 Ga0207428_10040590 3300027907 Bacteria 3773
183 Ga0268266_10000553 3300028379 Bacteria 52199
184 Ga0268266_10350671 3300028379 Bacteria 1387
185 Ga0268265_10948372 3300028380 Bacteria 847
186 Ga0265319_1000028 3300028563 Bacteria 135557
187 Ga0265338_10000230 3300028800 Bacteria 103891
188 Ga0265331_10054554 3300031250 Bacteria 1903
189 Ga0307408_100854377 3300031548 Bacteria 830
190 Ga0307410_10039167 3300031852 Bacteria 3110
191 Ga0307410_10635197 3300031852 Bacteria 894
192 Ga0307407_10147759 3300031903 Bacteria 1524
193 Ga0307409_100898430 3300031995 Bacteria 899
194 Ga0307416_100013636 3300032002 Bacteria 5534
195 Ga0307416_100188972 3300032002 Bacteria 1940
196 Ga0307415_100001131 3300032126 Bacteria 12469
197 Ga0395901_0373401 3300038443 Bacteria 1469
198 Ga0451853_2508484 3300041512 Bacteria 1282
199 Ga0466963_0024297 3300044694 Bacteria 3857
200 Ga0466957_0002421 3300044842 Bacteria 10019
201 Ga0466957_0061254 3300044842 Bacteria 2309
202 Ga0466967_0000046 3300045976 Bacteria 43911
203 Ga0466967_0015614 3300045976 Bacteria 5957
204 Ga0466967_0026717 3300045976 Bacteria 4787
205 Ga0466967_0189355 3300045976 Bacteria 1944
206 Ga0466967_0450101 3300045976 Bacteria 1258
207 Ga0495629_0005185 3300046459 Bacteria 9753
208 Ga0495629_0007342 3300046459 Bacteria 8124
209 Ga0495638_0015168 3300046460 Bacteria 5182
210 Ga0495641_0046883 3300046461 Bacteria 1986
211 Ga0495606_0000211 3300046507 Bacteria 103386
212 Ga0495610_0030248 3300046512 Bacteria 2840
213 Ga0495630_0000018 3300046517 Bacteria 186064
214 Ga0495657_0020191 3300046675 Bacteria 4793
215 Ga0495658_0013161 3300046683 Bacteria 4209
216 Ga0495676_0025539 3300047321 Bacteria 5099
217 Ga0495686_0072794 3300047472 Bacteria 2112
218 Ga0495593_0011598 3300047673 Bacteria 5057
219 Ga0496100_0028406 3300048903 Bacteria 3450
220 Ga0496100_0078266 3300048903 Bacteria 2225
221 Ga0496102_0000584 3300048905 Bacteria 38605
222 Ga0496102_0033898 3300048905 Bacteria 4591
223 Ga0496102_0073233 3300048905 Bacteria 3149
224 Ga0496102_0144644 3300048905 Bacteria 2231
225 Ga0496102_0307516 3300048905 Bacteria 1494
226 Ga0496102_0480674 3300048905 Bacteria 1163
227 Ga0496103_0000043 3300048906 Bacteria 167983
228 Ga0496103_0037620 3300048906 Bacteria 2966
229 Ga0496103_0514210 3300048906 Bacteria 766
230 Ga0496104_0000002 3300048907 Bacteria 686017
231 Ga0496104_0019301 3300048907 Bacteria 6235
232 Ga0496105_0000001 3300048908 Bacteria 1328178
233 Ga0496105_0001456 3300048908 Bacteria 16668
234 Ga0496105_0381290 3300048908 Bacteria 1122
235 Ga0496106_0266757 3300048909 Bacteria 1370
236 Ga0496107_0156030 3300048910 Bacteria 1690
237 Ga0496108_0000045 3300048911 Bacteria 137416
238 Ga0496108_0014730 3300048911 Bacteria 6381
239 Ga0496108_0204056 3300048911 Bacteria 1715
240 Ga0496109_0000028 3300048912 Bacteria 168138
241 Ga0496109_0000032 3300048912 Bacteria 162984
242 Ga0496110_0000033 3300048913 Bacteria 65539
243 Ga0496110_0004497 3300048913 Bacteria 10814
244 Ga0496110_0104441 3300048913 Bacteria 2542
245 Ga0496111_0000125 3300048914 Bacteria 33642
246 Ga0496111_0002513 3300048914 Bacteria 11065
247 Ga0496112_0004148 3300048915 Bacteria 12199
248 Ga0496112_0022765 3300048915 Bacteria 5977
249 Ga0496113_0000007 3300048916 Bacteria 95884
250 Ga0496113_0015282 3300048916 Bacteria 5271
251 Ga0496119_0114064 3300048922 Bacteria 1495
252 Ga0496120_0007058 3300048923 Bacteria 8437
253 Ga0496121_0034964 3300048924 Bacteria 4510
254 Ga0496121_0303636 3300048924 Bacteria 1082
255 Ga0496126_0080240 3300048929 Bacteria 2888
256 Ga0501032_0091114 3300049569 Bacteria 2023
257 Ga0501036_0317271 3300049572 Bacteria 1302
258 Ga0501039_0023496 3300049575 Bacteria 4731
259 Ga0501047_0135270 3300049581 Bacteria 2345
260 Ga0501047_0452128 3300049581 Bacteria 1114
261 Ga0501048_0051963 3300049582 Bacteria 2916
262 Ga0501048_0309133 3300049582 Bacteria 1125
263 Ga0501072_0038849 3300049588 Bacteria 3736
264 Ga0501079_0047269 3300049741 Bacteria 3320
265 Ga0501035_0219711 3300049822 Bacteria 1623
266 Ga0501045_0016040 3300049824 Bacteria 5315
267 nmdc:mga0yw44_397581_c1 3300050492 Bacteria 931
268 nmdc:mga0qj67_17720_c1 3300050509 Bacteria 5419
269 nmdc:mga06r32_33159_c1 3300050510 Bacteria 4863
270 nmdc:mga06r32_402437_c1 3300050510 Bacteria 1351
271 nmdc:mga08y16_41550_c1 3300050511 Bacteria 4817
272 nmdc:mga0n895_378675_c1 3300050512 Bacteria 1432
273 nmdc:mga0n895_44189_c1 3300050512 Bacteria 4345
274 nmdc:mga08x19_388951_c1 3300050514 Bacteria 977
275 nmdc:mga0a205_65050_c1 3300050515 Bacteria 3523
276 Ga0495612_0009009 3300053078 Bacteria 4047
277 Ga0495655_0000011 3300053083 Bacteria 118490
278 Ga0495619_0000022 3300053085 Bacteria 184144
279 Ga0500628_000058 3300053129 Bacteria 32870
280 Ga0501082_0095845 3300060353 Bacteria 2565
281 Ga0466962_0014838 3300061719 Bacteria 3753
282 Ga0530510_0038156 3300061734 Bacteria 3468

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0013161 Ga0495658_0013161_788_1465 218
2 3300049582 Ga0501048_0309133 Ga0501048_0309133_28_705 224
3 3300006173 Ga0070716_100338098 Ga0070716_1003380982 227
4 3300049569 Ga0501032_0091114 Ga0501032_0091114_865_1575 235
5 3300049572 Ga0501036_0317271 Ga0501036_0317271_396_1106 235
6 3300049575 Ga0501039_0023496 Ga0501039_0023496_1421_2131 235
7 3300049582 Ga0501048_0051963 Ga0501048_0051963_1350_2060 235
8 3300049588 Ga0501072_0038849 Ga0501072_0038849_515_1225 235
9 3300049741 Ga0501079_0047269 Ga0501079_0047269_490_1200 235
10 3300049824 Ga0501045_0016040 Ga0501045_0016040_1764_2474 235
11 3300060353 Ga0501082_0095845 Ga0501082_0095845_1520_2230 235
12 3300061734 Ga0530510_0038156 Ga0530510_0038156_928_1638 235
13 3300045976 Ga0466967_0026717 Ga0466967_0026717_2917_3642 239
14 3300005337 Ga0070682_100087065 Ga0070682_1000870652 240
15 3300005365 Ga0070688_100355792 Ga0070688_1003557921 240
16 3300005366 Ga0070659_100267059 Ga0070659_1002670591 240
17 3300005457 Ga0070662_100323112 Ga0070662_1003231122 240
18 3300005466 Ga0070685_10109695 Ga0070685_101096952 240
19 3300005564 Ga0070664_100232253 Ga0070664_1002322532 240
20 3300005616 Ga0068852_100083147 Ga0068852_1000831473 240
21 3300005616 Ga0068852_100214523 Ga0068852_1002145232 240
22 3300005834 Ga0068851_10042679 Ga0068851_100426792 240
23 3300009098 Ga0105245_10696769 Ga0105245_106967692 240
24 3300009148 Ga0105243_10089751 Ga0105243_100897512 240
25 3300009553 Ga0105249_10785659 Ga0105249_107856592 240
26 3300010375 Ga0105239_10425866 Ga0105239_104258662 240
27 3300013307 Ga0157372_10866144 Ga0157372_108661442 240
28 3300025927 Ga0207687_10392980 Ga0207687_103929802 240
29 3300025933 Ga0207706_10238259 Ga0207706_102382592 240
30 3300025935 Ga0207709_10253680 Ga0207709_102536802 240
31 3300025944 Ga0207661_10637275 Ga0207661_106372751 240
32 3300025945 Ga0207679_10089093 Ga0207679_100890933 240
33 3300026067 Ga0207678_10561945 Ga0207678_105619452 240
34 3300028379 Ga0268266_10350671 Ga0268266_103506712 240
35 3300028380 Ga0268265_10948372 Ga0268265_109483722 240
36 3300044694 Ga0466963_0024297 Ga0466963_0024297_224_949 240
37 3300045976 Ga0466967_0189355 Ga0466967_0189355_780_1505 240
38 3300048924 Ga0496121_0303636 Ga0496121_0303636_271_996 240
39 3300048929 Ga0496126_0080240 Ga0496126_0080240_928_1653 240
40 3300050492 nmdc:mga0yw44_397581_c1 nmdc:mga0yw44_397581_c1_59_784 240
41 3300061719 Ga0466962_0014838 Ga0466962_0014838_2782_3507 240
42 3300005544 Ga0070686_100290132 Ga0070686_1002901322 241
43 3300005840 Ga0068870_10112959 Ga0068870_101129592 241
44 3300048906 Ga0496103_0514210 Ga0496103_0514210_20_751 241
45 3300053078 Ga0495612_0009009 Ga0495612_0009009_695_1483 241
46 3300026142 Ga0207698_10345827 Ga0207698_103458272 243
47 3300045976 Ga0466967_0015614 Ga0466967_0015614_1718_2563 243
48 3300044842 Ga0466957_0061254 Ga0466957_0061254_43_807 244
49 3300045976 Ga0466967_0450101 Ga0466967_0450101_329_1093 244
50 3300005937 Ga0081455_10033852 Ga0081455_100338524 245
51 3300005339 Ga0070660_100598592 Ga0070660_1005985921 246
52 3300005366 Ga0070659_100127987 Ga0070659_1001279872 246
53 3300031548 Ga0307408_100854377 Ga0307408_1008543771 247
54 3300031852 Ga0307410_10039167 Ga0307410_100391672 247
55 3300031903 Ga0307407_10147759 Ga0307407_101477592 247
56 3300031995 Ga0307409_100898430 Ga0307409_1008984302 247
57 3300032002 Ga0307416_100013636 Ga0307416_1000136363 247
58 3300046460 Ga0495638_0015168 Ga0495638_0015168_3603_4409 247
59 3300013306 Ga0163162_10705703 Ga0163162_107057032 249
60 3300005329 Ga0070683_100017862 Ga0070683_1000178623 251
61 3300005329 Ga0070683_100029458 Ga0070683_1000294582 251
62 3300005331 Ga0070670_100043115 Ga0070670_1000431153 251
63 3300005344 Ga0070661_100003829 Ga0070661_1000038294 251
64 3300005354 Ga0070675_100000058 Ga0070675_10000005860 251
65 3300005365 Ga0070688_100002866 Ga0070688_1000028662 251
66 3300005436 Ga0070713_100001783 Ga0070713_1000017835 251
67 3300005466 Ga0070685_10022662 Ga0070685_100226622 251
68 3300005535 Ga0070684_100045350 Ga0070684_1000453502 251
69 3300005535 Ga0070684_100532238 Ga0070684_1005322382 251
70 3300005564 Ga0070664_100104854 Ga0070664_1001048542 251
71 3300005578 Ga0068854_100001335 Ga0068854_1000013356 251
72 3300005614 Ga0068856_100054298 Ga0068856_1000542983 251
73 3300005616 Ga0068852_100021460 Ga0068852_1000214604 251
74 3300006175 Ga0070712_100010641 Ga0070712_1000106414 251
75 3300009174 Ga0105241_10154412 Ga0105241_101544123 251
76 3300009177 Ga0105248_10000032 Ga0105248_10000032122 251
77 3300013297 Ga0157378_10005494 Ga0157378_100054944 251
78 3300025911 Ga0207654_10099017 Ga0207654_100990172 251
79 3300025915 Ga0207693_10009297 Ga0207693_100092973 251
80 3300025920 Ga0207649_10000640 Ga0207649_100006404 251
81 3300025925 Ga0207650_10167660 Ga0207650_101676603 251
82 3300025926 Ga0207659_10000020 Ga0207659_1000002046 251
83 3300025928 Ga0207700_10000070 Ga0207700_1000007045 251
84 3300025941 Ga0207711_10000020 Ga0207711_10000020252 251
85 3300025944 Ga0207661_10002063 Ga0207661_100020635 251
86 3300025944 Ga0207661_10010753 Ga0207661_100107532 251
87 3300025945 Ga0207679_10091439 Ga0207679_100914393 251
88 3300025981 Ga0207640_10000285 Ga0207640_1000028519 251
89 3300026078 Ga0207702_10012042 Ga0207702_100120424 251
90 3300026142 Ga0207698_10008377 Ga0207698_100083774 251
91 3300032126 Ga0307415_100001131 Ga0307415_10000113111 251
92 3300045976 Ga0466967_0000046 Ga0466967_0000046_21701_22489 251
93 3300046507 Ga0495606_0000211 Ga0495606_0000211_51533_52321 251
94 3300046512 Ga0495610_0030248 Ga0495610_0030248_350_1138 251
95 3300048911 Ga0496108_0014730 Ga0496108_0014730_3895_4683 251
96 3300048912 Ga0496109_0000028 Ga0496109_0000028_146691_147479 251
97 3300053085 Ga0495619_0000022 Ga0495619_0000022_136844_137632 251
98 3300048905 Ga0496102_0033898 Ga0496102_0033898_2984_3763 252
99 3300047472 Ga0495686_0072794 Ga0495686_0072794_515_1282 253
100 3300005365 Ga0070688_100012800 Ga0070688_1000128003 254
101 3300005466 Ga0070685_10000018 Ga0070685_10000018100 254
102 3300013102 Ga0157371_10003156 Ga0157371_1000315612 254
103 3300031852 Ga0307410_10635197 Ga0307410_106351971 254
104 3300032002 Ga0307416_100188972 Ga0307416_1001889723 254
105 3300005441 Ga0070700_100504496 Ga0070700_1005044961 255
106 3300046675 Ga0495657_0020191 Ga0495657_0020191_532_1305 255
107 3300048911 Ga0496108_0000045 Ga0496108_0000045_125313_126113 255
108 3300048912 Ga0496109_0000032 Ga0496109_0000032_11313_12113 255
109 3300009098 Ga0105245_10006628 Ga0105245_100066286 256
110 3300009098 Ga0105245_10015419 Ga0105245_100154193 256
111 3300010375 Ga0105239_10081851 Ga0105239_100818512 256
112 3300013105 Ga0157369_10000099 Ga0157369_1000009914 256
113 3300026118 Ga0207675_100131941 Ga0207675_1001319411 256
114 3300044842 Ga0466957_0002421 Ga0466957_0002421_4097_4903 256
115 3300046517 Ga0495630_0000018 Ga0495630_0000018_10022_10816 256
116 3300047673 Ga0495593_0011598 Ga0495593_0011598_3176_3976 256
117 3300048913 Ga0496110_0000033 Ga0496110_0000033_53236_54030 256
118 3300048914 Ga0496111_0000125 Ga0496111_0000125_8397_9191 256
119 3300048915 Ga0496112_0022765 Ga0496112_0022765_1320_2114 256
120 3300048916 Ga0496113_0000007 Ga0496113_0000007_84535_85329 256
121 3300048922 Ga0496119_0114064 Ga0496119_0114064_565_1380 257
122 3300048923 Ga0496120_0007058 Ga0496120_0007058_1228_2043 257
123 3300005335 Ga0070666_10048715 Ga0070666_100487152 258
124 3300005336 Ga0070680_100333095 Ga0070680_1003330952 258
125 3300005355 Ga0070671_100077488 Ga0070671_1000774882 258
126 3300005367 Ga0070667_100087297 Ga0070667_1000872972 258
127 3300005367 Ga0070667_100151569 Ga0070667_1001515692 258
128 3300005455 Ga0070663_100017465 Ga0070663_1000174653 258
129 3300005458 Ga0070681_10032794 Ga0070681_100327944 258
130 3300005530 Ga0070679_100021403 Ga0070679_1000214035 258
131 3300005616 Ga0068852_100000012 Ga0068852_100000012104 258
132 3300005841 Ga0068863_100041255 Ga0068863_1000412553 258
133 3300005841 Ga0068863_100078422 Ga0068863_1000784222 258
134 3300005937 Ga0081455_10079247 Ga0081455_100792472 258
135 3300006846 Ga0075430_100020602 Ga0075430_1000206022 258
136 3300009101 Ga0105247_10003405 Ga0105247_100034057 258
137 3300009176 Ga0105242_10000357 Ga0105242_1000035724 258
138 3300009176 Ga0105242_10000530 Ga0105242_100005305 258
139 3300025900 Ga0207710_10000369 Ga0207710_100003698 258
140 3300025903 Ga0207680_10017856 Ga0207680_100178564 258
141 3300025917 Ga0207660_10283298 Ga0207660_102832982 258
142 3300025921 Ga0207652_10014685 Ga0207652_100146852 258
143 3300025924 Ga0207694_10156107 Ga0207694_101561072 258
144 3300025934 Ga0207686_10000156 Ga0207686_1000015647 258
145 3300025934 Ga0207686_10000438 Ga0207686_1000043816 258
146 3300025986 Ga0207658_10130163 Ga0207658_101301632 258
147 3300026067 Ga0207678_10018954 Ga0207678_100189542 258
148 3300026088 Ga0207641_10037823 Ga0207641_100378232 258
149 3300026088 Ga0207641_10038504 Ga0207641_100385042 258
150 3300026142 Ga0207698_10000012 Ga0207698_10000012223 258
151 3300046459 Ga0495629_0005185 Ga0495629_0005185_1171_1989 258
152 3300046459 Ga0495629_0007342 Ga0495629_0007342_3675_4484 258
153 3300047321 Ga0495676_0025539 Ga0495676_0025539_2476_3294 258
154 3300048903 Ga0496100_0078266 Ga0496100_0078266_558_1379 258
155 3300048905 Ga0496102_0000584 Ga0496102_0000584_16207_17025 258
156 3300048905 Ga0496102_0073233 Ga0496102_0073233_1938_2744 258
157 3300048905 Ga0496102_0307516 Ga0496102_0307516_420_1229 258
158 3300048906 Ga0496103_0000043 Ga0496103_0000043_94951_95769 258
159 3300048906 Ga0496103_0037620 Ga0496103_0037620_1230_2036 258
160 3300048907 Ga0496104_0000002 Ga0496104_0000002_653166_654008 258
161 3300048908 Ga0496105_0000001 Ga0496105_0000001_674171_675013 258
162 3300048908 Ga0496105_0001456 Ga0496105_0001456_12290_13111 258
163 3300048908 Ga0496105_0381290 Ga0496105_0381290_229_1047 258
164 3300048924 Ga0496121_0034964 Ga0496121_0034964_419_1240 258
165 3300049581 Ga0501047_0135270 Ga0501047_0135270_883_1701 258
166 3300049581 Ga0501047_0452128 Ga0501047_0452128_247_1065 258
167 3300049822 Ga0501035_0219711 Ga0501035_0219711_721_1539 258
168 3300050509 nmdc:mga0qj67_17720_c1 nmdc:mga0qj67_17720_c1_3764_4570 258
169 3300053083 Ga0495655_0000011 Ga0495655_0000011_64946_65764 258
170 3300053129 Ga0500628_000058 Ga0500628_000058_19136_19954 258
171 3300005335 Ga0070666_10146107 Ga0070666_101461072 259
172 3300005347 Ga0070668_100027772 Ga0070668_1000277723 259
173 3300005456 Ga0070678_100031489 Ga0070678_1000314892 259
174 3300005548 Ga0070665_100007985 Ga0070665_1000079857 259
175 3300005578 Ga0068854_100006441 Ga0068854_1000064416 259
176 3300005834 Ga0068851_10001094 Ga0068851_100010945 259
177 3300005834 Ga0068851_10020316 Ga0068851_100203162 259
178 3300006237 Ga0097621_100054683 Ga0097621_1000546833 259
179 3300006881 Ga0068865_100000101 Ga0068865_10000010128 259
180 3300013297 Ga0157378_10060107 Ga0157378_100601072 259
181 3300013308 Ga0157375_10005846 Ga0157375_100058464 259
182 3300014326 Ga0157380_10001287 Ga0157380_1000128713 259
183 3300025321 Ga0207656_10000325 Ga0207656_100003255 259
184 3300025321 Ga0207656_10005393 Ga0207656_100053935 259
185 3300025903 Ga0207680_10059291 Ga0207680_100592912 259
186 3300025927 Ga0207687_10000007 Ga0207687_10000007125 259
187 3300025927 Ga0207687_10003179 Ga0207687_100031795 259
188 3300025935 Ga0207709_10009255 Ga0207709_100092552 259
189 3300025938 Ga0207704_10000025 Ga0207704_10000025111 259
190 3300025972 Ga0207668_10008272 Ga0207668_100082723 259
191 3300026023 Ga0207677_10001635 Ga0207677_100016353 259
192 3300026118 Ga0207675_100014368 Ga0207675_1000143682 259
193 3300026121 Ga0207683_10027098 Ga0207683_100270983 259
194 3300028379 Ga0268266_10000553 Ga0268266_1000055344 259
195 3300028563 Ga0265319_1000028 Ga0265319_1000028112 259
196 3300028800 Ga0265338_10000230 Ga0265338_1000023040 259
197 3300031250 Ga0265331_10054554 Ga0265331_100545542 259
198 3300041512 Ga0451853_2508484 Ga0451853_2508484_337_1167 259
199 3300046461 Ga0495641_0046883 Ga0495641_0046883_677_1501 259
200 3300048913 Ga0496110_0104441 Ga0496110_0104441_747_1571 259
201 3300005329 Ga0070683_100001645 Ga0070683_10000164510 260
202 3300005334 Ga0068869_100004396 Ga0068869_1000043962 260
203 3300005337 Ga0070682_100006554 Ga0070682_1000065542 260
204 3300005338 Ga0068868_100015787 Ga0068868_1000157874 260
205 3300005339 Ga0070660_100104964 Ga0070660_1001049642 260
206 3300005341 Ga0070691_10023211 Ga0070691_100232112 260
207 3300005344 Ga0070661_100148329 Ga0070661_1001483292 260
208 3300005345 Ga0070692_10088212 Ga0070692_100882122 260
209 3300005354 Ga0070675_100102242 Ga0070675_1001022422 260
210 3300005355 Ga0070671_100306932 Ga0070671_1003069322 260
211 3300005364 Ga0070673_100009422 Ga0070673_1000094222 260
212 3300005366 Ga0070659_100012767 Ga0070659_1000127671 260
213 3300005367 Ga0070667_100681450 Ga0070667_1006814502 260
214 3300005441 Ga0070700_100001171 Ga0070700_1000011715 260
215 3300005457 Ga0070662_100014011 Ga0070662_1000140111 260
216 3300005466 Ga0070685_10035559 Ga0070685_100355592 260
217 3300005535 Ga0070684_100005809 Ga0070684_1000058097 260
218 3300005549 Ga0070704_100288820 Ga0070704_1002888202 260
219 3300005564 Ga0070664_100326828 Ga0070664_1003268282 260
220 3300005578 Ga0068854_100059201 Ga0068854_1000592012 260
221 3300005614 Ga0068856_100019982 Ga0068856_1000199825 260
222 3300005616 Ga0068852_100042843 Ga0068852_1000428434 260
223 3300005617 Ga0068859_100133410 Ga0068859_1001334102 260
224 3300005618 Ga0068864_100002162 Ga0068864_1000021627 260
225 3300005842 Ga0068858_100652798 Ga0068858_1006527982 260
226 3300006175 Ga0070712_100040117 Ga0070712_1000401172 260
227 3300006847 Ga0075431_100135035 Ga0075431_1001350352 260
228 3300006852 Ga0075433_10014568 Ga0075433_100145682 260
229 3300006871 Ga0075434_100065097 Ga0075434_1000650972 260
230 3300006871 Ga0075434_100131650 Ga0075434_1001316502 260
231 3300006881 Ga0068865_100470214 Ga0068865_1004702142 260
232 3300006914 Ga0075436_100336621 Ga0075436_1003366212 260
233 3300006931 Ga0097620_100133411 Ga0097620_1001334112 260
234 3300009094 Ga0111539_10210259 Ga0111539_102102592 260
235 3300009098 Ga0105245_10002830 Ga0105245_1000283012 260
236 3300009148 Ga0105243_10079502 Ga0105243_100795022 260
237 3300009176 Ga0105242_10356428 Ga0105242_103564282 260
238 3300010375 Ga0105239_10027567 Ga0105239_100275675 260
239 3300011119 Ga0105246_10496087 Ga0105246_104960871 260
240 3300013308 Ga0157375_10185467 Ga0157375_101854672 260
241 3300014325 Ga0163163_10048448 Ga0163163_100484482 260
242 3300014745 Ga0157377_10003442 Ga0157377_100034423 260
243 3300014968 Ga0157379_10289234 Ga0157379_102892342 260
244 3300017792 Ga0163161_10605429 Ga0163161_106054291 260
245 3300025901 Ga0207688_10002755 Ga0207688_100027554 260
246 3300025915 Ga0207693_10056096 Ga0207693_100560962 260
247 3300025925 Ga0207650_10192547 Ga0207650_101925472 260
248 3300025926 Ga0207659_10061774 Ga0207659_100617742 260
249 3300025927 Ga0207687_10013707 Ga0207687_100137072 260
250 3300025931 Ga0207644_10386540 Ga0207644_103865402 260
251 3300025932 Ga0207690_10513379 Ga0207690_105133792 260
252 3300025933 Ga0207706_10021102 Ga0207706_100211022 260
253 3300025934 Ga0207686_10181140 Ga0207686_101811402 260
254 3300025936 Ga0207670_10070509 Ga0207670_100705092 260
255 3300025942 Ga0207689_10014766 Ga0207689_100147664 260
256 3300025960 Ga0207651_10487004 Ga0207651_104870042 260
257 3300025981 Ga0207640_10021270 Ga0207640_100212702 260
258 3300026035 Ga0207703_10339641 Ga0207703_103396412 260
259 3300026067 Ga0207678_10029702 Ga0207678_100297023 260
260 3300026075 Ga0207708_10000752 Ga0207708_100007526 260
261 3300026078 Ga0207702_10455877 Ga0207702_104558772 260
262 3300026121 Ga0207683_10024444 Ga0207683_100244445 260
263 3300027907 Ga0207428_10040590 Ga0207428_100405904 260
264 3300038443 Ga0395901_0373401 Ga0395901_0373401_22_804 260
265 3300048903 Ga0496100_0028406 Ga0496100_0028406_59_841 260
266 3300048905 Ga0496102_0144644 Ga0496102_0144644_204_998 260
267 3300048905 Ga0496102_0480674 Ga0496102_0480674_175_957 260
268 3300048907 Ga0496104_0019301 Ga0496104_0019301_5240_6022 260
269 3300048909 Ga0496106_0266757 Ga0496106_0266757_445_1227 260
270 3300048910 Ga0496107_0156030 Ga0496107_0156030_463_1245 260
271 3300048911 Ga0496108_0204056 Ga0496108_0204056_590_1372 260
272 3300048913 Ga0496110_0004497 Ga0496110_0004497_9711_10493 260
273 3300048914 Ga0496111_0002513 Ga0496111_0002513_7830_8612 260
274 3300048915 Ga0496112_0004148 Ga0496112_0004148_7031_7813 260
275 3300048916 Ga0496113_0015282 Ga0496113_0015282_52_834 260
276 3300050510 nmdc:mga06r32_33159_c1 nmdc:mga06r32_33159_c1_1506_2288 260
277 3300050510 nmdc:mga06r32_402437_c1 nmdc:mga06r32_402437_c1_144_926 260
278 3300050511 nmdc:mga08y16_41550_c1 nmdc:mga08y16_41550_c1_2955_3737 260
279 3300050512 nmdc:mga0n895_378675_c1 nmdc:mga0n895_378675_c1_428_1210 260
280 3300050512 nmdc:mga0n895_44189_c1 nmdc:mga0n895_44189_c1_2408_3190 260
281 3300050514 nmdc:mga08x19_388951_c1 nmdc:mga08x19_388951_c1_32_814 260
282 3300050515 nmdc:mga0a205_65050_c1 nmdc:mga0a205_65050_c1_654_1436 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

10

236

0.88

PF00117

GATase

Glutamine amidotransferase class-I

42

254

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fij-assembly1.cif.gz_B crystal structure of a uncharacterized protein lin1909 0.9403 4 248
3fij-assembly1.cif.gz_F crystal structure of a uncharacterized protein lin1909 0.9354 4 248
3fij-assembly1.cif.gz_B crystal structure of a uncharacterized protein lin1909 0.9322 4 248
3fij-assembly1.cif.gz_G crystal structure of a uncharacterized protein lin1909 0.9311 4 247
3fij-assembly1.cif.gz_F crystal structure of a uncharacterized protein lin1909 0.9273 4 248
ID Description Score Start End Superfamily
3fijG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9321 4 247 3.40.50.880
af_O33341_63_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9269 5 253 3.40.50.880
3fijG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9239 4 247 3.40.50.880
af_O33341_63_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.905 5 253 3.40.50.880
af_P76038_5_253_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8839 5 253 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A0F2N8F7-F1-model_v4 Uncharacterized protein 0.9673 39 249 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A7C6ING7-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.967 46 250 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A0A0M331-F1-model_v4 deleted 0.9621 37 143
AF-A0A842YL35-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.961 40 247 GO:0005829
GO:0006541
GO:0006598
GO:0033969
AF-A0A7C6HGH3-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9592 4 250 GO:0005829
GO:0006541
GO:0006598
GO:0033969

Feature Viewer

pLDDT pTM Quality
88.6 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map