F384836

General Info

Members Datasets Scaffolds Average Seq Length
282 183 564 304

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10114628|Ga0081538_101146281
Length 340
Sequence MNVAVSGAWRRARRHSRLDCSGMRIDERIAVGTEPSFSFEFFPPRTDEGERNLGRALAELSRMAPTFVSVTYGAAGSATAKRKTIDIVADLKRNYGMEAMAHFTCVNATVGELRTMLDTMRDAGIENVLALRGDPPEGQTEWTATDGGLRYSRELIELIRDEYDFSIGAACFPEVHIHATDAESDLRYCKEKVDAGARFLITQLFFDNQAYYEFVARARDAGIDVPIIPGIWPITNVSQIKRVTGLCGARIPDRLLRELELRGDQPDAVSNLGVAYATLQCAELLAHGAPGIHFYTLNRSPATRAILSALKLLRPWESGVYGTSSMSSFSATAGLPSARS

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.55
Nodule 0
Rhizoplane 5.67
Rhizosphere 84.4
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10114628 3300005981 Bacteria 1312
2 JGI25406J46586_10017270 3300003203 Bacteria 2988
3 Ga0070676_10141071 3300005328 Bacteria 1534
4 Ga0070683_100003411 3300005329 Bacteria 12889
5 Ga0070683_100384967 3300005329 Bacteria 1336
6 Ga0070683_100393178 3300005329 Bacteria 1322
7 Ga0070670_100102731 3300005331 Bacteria 2462
8 Ga0070680_100010348 3300005336 Bacteria 7190
9 Ga0070682_100001878 3300005337 Bacteria 11732
10 Ga0070682_100218963 3300005337 Bacteria 1353
11 Ga0070682_100358363 3300005337 Bacteria 1090
12 Ga0068868_100006153 3300005338 Bacteria 8484
13 Ga0070661_100024713 3300005344 Bacteria 4310
14 Ga0070692_10014794 3300005345 Bacteria 3675
15 Ga0070674_100034919 3300005356 Bacteria 3363
16 Ga0070673_100174933 3300005364 Bacteria 1834
17 Ga0070688_100107216 3300005365 Bacteria 1852
18 Ga0070659_100003318 3300005366 Bacteria 11462
19 Ga0070659_100049134 3300005366 Bacteria 3316
20 Ga0070667_100132669 3300005367 Bacteria 2175
21 Ga0070713_100483957 3300005436 Bacteria 1166
22 Ga0070701_10015502 3300005438 Bacteria 3522
23 Ga0070701_10064821 3300005438 Bacteria 1937
24 Ga0070711_100047315 3300005439 Bacteria 2936
25 Ga0070700_100003659 3300005441 Bacteria 7947
26 Ga0070708_100003684 3300005445 Bacteria 12011
27 Ga0070708_100316546 3300005445 Bacteria 1470
28 Ga0070663_100007410 3300005455 Bacteria 6677
29 Ga0070678_100317106 3300005456 Bacteria 1330
30 Ga0070662_100016125 3300005457 Bacteria 5012
31 Ga0070662_100085245 3300005457 Bacteria 2361
32 Ga0070685_10061034 3300005466 Bacteria 2207
33 Ga0070685_10075218 3300005466 Bacteria 2011
34 Ga0070706_100002044 3300005467 Bacteria 20669
35 Ga0070706_100542863 3300005467 Unclassified 1081
36 Ga0070698_100084960 3300005471 Bacteria 3152
37 Ga0070679_100015930 3300005530 Bacteria 7237
38 Ga0070684_100030804 3300005535 Bacteria 4563
39 Ga0068853_100096390 3300005539 Bacteria 2610
40 Ga0070665_100262227 3300005548 Bacteria 1729
41 Ga0068855_100021837 3300005563 Bacteria 7676
42 Ga0068855_100191877 3300005563 Unclassified 2304
43 Ga0070664_100118441 3300005564 Bacteria 2316
44 Ga0068857_100064213 3300005577 Bacteria 3264
45 Ga0068854_100061429 3300005578 Bacteria 2721
46 Ga0070702_100012898 3300005615 Bacteria 4207
47 Ga0070702_100024758 3300005615 Bacteria 3206
48 Ga0068852_100037143 3300005616 Bacteria 4082
49 Ga0068852_100075627 3300005616 Bacteria 2971
50 Ga0068852_100138227 3300005616 Bacteria 2252
51 Ga0068864_100077552 3300005618 Bacteria 2906
52 Ga0068863_100341802 3300005841 Bacteria 1456
53 Ga0068858_100108302 3300005842 Bacteria 2594
54 Ga0068862_100023947 3300005844 Bacteria 5118
55 Ga0081455_10309434 3300005937 Bacteria 1130
56 Ga0081538_10001572 3300005981 Bacteria 23438
57 Ga0081538_10019634 3300005981 Bacteria 5010
58 Ga0081538_10065541 3300005981 Bacteria 2044
59 Ga0081538_10068834 3300005981 Bacteria 1965
60 Ga0081540_1038116 3300005983 Bacteria 2538
61 Ga0081539_10002515 3300005985 Bacteria 25631
62 Ga0081539_10003320 3300005985 Bacteria 20075
63 Ga0081539_10049086 3300005985 Bacteria 2397
64 Ga0075365_10003091 3300006038 Bacteria 8459
65 Ga0075363_100010230 3300006048 Bacteria 4441
66 Ga0075363_100014041 3300006048 Bacteria 3901
67 Ga0070712_100000005 3300006175 Bacteria 177449
68 Ga0075367_10103889 3300006178 Bacteria 1739
69 Ga0075428_100086721 3300006844 Bacteria 3415
70 Ga0075428_100527684 3300006844 Bacteria 1262
71 Ga0075431_100003260 3300006847 Bacteria 15714
72 Ga0075433_10049894 3300006852 Bacteria 3642
73 Ga0075434_100206550 3300006871 Bacteria 1984
74 Ga0068865_100040254 3300006881 Bacteria 3174
75 Ga0099794_10013685 3300007265 Bacteria 3538
76 Ga0105240_10160776 3300009093 Bacteria 2667
77 Ga0105240_10210903 3300009093 Bacteria 2270
78 Ga0111539_10004135 3300009094 Bacteria 19042
79 Ga0111539_10017232 3300009094 Bacteria 8941
80 Ga0111539_10061699 3300009094 Bacteria 4441
81 Ga0105247_10115371 3300009101 Bacteria 1733
82 Ga0105243_10006927 3300009148 Bacteria 8736
83 Ga0105243_10039090 3300009148 Bacteria 3698
84 Ga0105237_10149356 3300009545 Unclassified 2333
85 Ga0105249_10113167 3300009553 Bacteria 2567
86 Ga0105249_10167243 3300009553 Bacteria 2130
87 Ga0105249_10367103 3300009553 Bacteria 1462
88 Ga0105249_10427568 3300009553 Bacteria 1359
89 Ga0105246_10058853 3300011119 Bacteria 2663
90 Ga0105246_10211183 3300011119 Bacteria 1515
91 Ga0157370_10013924 3300013104 Bacteria 8259
92 Ga0157375_10062159 3300013308 Bacteria 3710
93 Ga0157380_10629081 3300014326 Bacteria 1067
94 Ga0157377_10026696 3300014745 Bacteria 3093
95 Ga0163161_10348820 3300017792 Bacteria 1176
96 Ga0213876_10006114 3300021384 Bacteria 6578
97 Ga0213875_10011280 3300021388 Bacteria 4451
98 Ga0207656_10065933 3300025321 Bacteria 1599
99 Ga0207688_10008393 3300025901 Bacteria 5618
100 Ga0207643_10204405 3300025908 Bacteria 1204
101 Ga0207705_10087534 3300025909 Bacteria 2278
102 Ga0207684_10000018 3300025910 Bacteria 361536
103 Ga0207707_10005664 3300025912 Bacteria 10935
104 Ga0207671_10144392 3300025914 Unclassified 1835
105 Ga0207693_10000023 3300025915 Bacteria 127876
106 Ga0207693_10027079 3300025915 Bacteria 4534
107 Ga0207660_10005723 3300025917 Bacteria 8064
108 Ga0207657_10190613 3300025919 Bacteria 1654
109 Ga0207652_10073556 3300025921 Bacteria 2973
110 Ga0207681_10049617 3300025923 Bacteria 2838
111 Ga0207681_10318115 3300025923 Bacteria 1237
112 Ga0207659_10037653 3300025926 Bacteria 3360
113 Ga0207706_10001788 3300025933 Bacteria 21121
114 Ga0207669_10061710 3300025937 Bacteria 2305
115 Ga0207704_10111405 3300025938 Bacteria 1851
116 Ga0207661_10020293 3300025944 Bacteria 4964
117 Ga0207661_10064456 3300025944 Bacteria 2971
118 Ga0207667_10402398 3300025949 Bacteria 1394
119 Ga0207651_10042383 3300025960 Bacteria 3029
120 Ga0207712_10134083 3300025961 Bacteria 1891
121 Ga0207640_10046135 3300025981 Bacteria 2802
122 Ga0207677_10006863 3300026023 Bacteria 6257
123 Ga0207677_10199979 3300026023 Bacteria 1587
124 Ga0207703_10060655 3300026035 Bacteria 3093
125 Ga0207639_10107462 3300026041 Bacteria 2267
126 Ga0207678_10006785 3300026067 Bacteria 10150
127 Ga0207678_10078785 3300026067 Bacteria 2822
128 Ga0207708_10018459 3300026075 Bacteria 5253
129 Ga0207648_10108400 3300026089 Bacteria 2438
130 Ga0207648_10194855 3300026089 Bacteria 1796
131 Ga0207676_10014326 3300026095 Bacteria 5704
132 Ga0207676_10257023 3300026095 Bacteria 1575
133 Ga0207674_10049978 3300026116 Bacteria 4274
134 Ga0207675_100018269 3300026118 Bacteria 6538
135 Ga0207675_100018487 3300026118 Bacteria 6501
136 Ga0207683_10125812 3300026121 Bacteria 2303
137 Ga0207698_10162505 3300026142 Bacteria 1955
138 Ga0209588_1005291 3300027671 Bacteria 3690
139 Ga0207428_10096396 3300027907 Bacteria 2290
140 Ga0207428_10141925 3300027907 Bacteria 1833
141 Ga0268266_10312441 3300028379 Bacteria 1469
142 Ga0268265_10098302 3300028380 Bacteria 2357
143 Ga0268264_10079860 3300028381 Bacteria 2792
144 Ga0265319_1000175 3300028563 Bacteria 48774
145 Ga0265330_10105168 3300031235 Bacteria 1207
146 Ga0307408_100121073 3300031548 Bacteria 2027
147 Ga0307408_100251821 3300031548 Bacteria 1457
148 Ga0307410_10020564 3300031852 Bacteria 4040
149 Ga0307410_10093587 3300031852 Bacteria 2139
150 Ga0307406_10031602 3300031901 Bacteria 3225
151 Ga0307407_10044396 3300031903 Bacteria 2505
152 Ga0307409_100103725 3300031995 Bacteria 2366
153 Ga0307409_100139733 3300031995 Bacteria 2085
154 Ga0307409_100193610 3300031995 Bacteria 1812
155 Ga0307409_100347028 3300031995 Bacteria 1399
156 Ga0307416_100003571 3300032002 Bacteria 9174
157 Ga0307416_100700950 3300032002 Bacteria 1101
158 Ga0307414_10209139 3300032004 Bacteria 1593
159 Ga0307415_100000387 3300032126 Bacteria 18675
160 Ga0307415_100039261 3300032126 Bacteria 3127
161 Ga0307415_100140436 3300032126 Bacteria 1844
162 Ga0307415_100295453 3300032126 Bacteria 1339
163 Ga0307415_100402921 3300032126 Bacteria 1168
164 Ga0316574_0030907 3300035398 Bacteria 3246
165 Ga0316574_0125935 3300035398 Bacteria 1647
166 Ga0316582_0170650 3300036647 Bacteria 1477
167 Ga0395905_0415600 3300037471 Bacteria 1241
168 Ga0436364_0011569 3300037853 Bacteria 10709
169 Ga0436364_0412200 3300037853 Bacteria 5749
170 Ga0436364_0975411 3300037853 Bacteria 1788
171 Ga0395901_0214176 3300038443 Bacteria 2015
172 Ga0436365_0679055 3300039437 Bacteria 7776
173 Ga0436365_0856735 3300039437 Bacteria 10107
174 Ga0436365_1292628 3300039437 Bacteria 10027
175 Ga0436365_1502610 3300039437 Bacteria 2697
176 Ga0436365_1503957 3300039437 Bacteria 8815
177 Ga0436360_0776680 3300039438 Bacteria 1618
178 Ga0436360_1089841 3300039438 Bacteria 2871
179 Ga0436363_0708320 3300039450 Bacteria 2393
180 Ga0436363_0744148 3300039450 Bacteria 5963
181 Ga0436363_0855292 3300039450 Bacteria 8292
182 Ga0436363_1366250 3300039450 Bacteria 4462
183 Ga0436362_0786444 3300039453 Bacteria 2225
184 Ga0451797_1464907 3300041453 Bacteria 1316
185 Ga0451853_4106693 3300041512 Bacteria 2129
186 Ga0466966_0133645 3300044684 Bacteria 1518
187 Ga0466963_0112388 3300044694 Bacteria 1870
188 Ga0466963_0119707 3300044694 Bacteria 1811
189 Ga0466964_0052169 3300044706 Bacteria 1681
190 Ga0466964_0055349 3300044706 Bacteria 1638
191 Ga0466964_0139714 3300044706 Bacteria 1112
192 Ga0466964_0188296 3300044706 Bacteria 983
193 Ga0466971_0066464 3300044719 Bacteria 1634
194 Ga0466970_0019779 3300044765 Bacteria 3494
195 Ga0466957_0053269 3300044842 Bacteria 2466
196 Ga0466957_0069381 3300044842 Bacteria 2177
197 Ga0466960_0069177 3300044901 Bacteria 1753
198 Ga0466960_0188692 3300044901 Bacteria 1121
199 Ga0466959_0126548 3300045049 Bacteria 1813
200 Ga0466958_0062671 3300045836 Bacteria 2267
201 Ga0466958_0257625 3300045836 Bacteria 1116
202 Ga0466967_0002616 3300045976 Bacteria 11328
203 Ga0466967_0008358 3300045976 Bacteria 7574
204 Ga0466967_0010659 3300045976 Bacteria 6910
205 Ga0466967_0029700 3300045976 Bacteria 4579
206 Ga0466967_0037620 3300045976 Bacteria 4143
207 Ga0466967_0090855 3300045976 Bacteria 2774
208 Ga0466967_0094349 3300045976 Bacteria 2725
209 Ga0466967_0182349 3300045976 Bacteria 1981
210 Ga0466967_0286938 3300045976 Bacteria 1580
211 Ga0466967_0308553 3300045976 Bacteria 1524
212 Ga0466967_0547608 3300045976 Bacteria 1139
213 Ga0495620_0132420 3300046515 Bacteria 978
214 Ga0495672_0006815 3300047320 Bacteria 8733
215 Ga0496101_0246863 3300048904 Bacteria 1390
216 Ga0496102_0139249 3300048905 Bacteria 2275
217 Ga0496106_0005743 3300048909 Bacteria 9179
218 Ga0496107_0009515 3300048910 Bacteria 6743
219 Ga0496107_0403311 3300048910 Bacteria 1017
220 Ga0496108_0004043 3300048911 Bacteria 11770
221 Ga0496108_0217886 3300048911 Bacteria 1658
222 Ga0496109_0032866 3300048912 Bacteria 4666
223 Ga0496109_0035264 3300048912 Bacteria 4511
224 Ga0496110_0105179 3300048913 Bacteria 2532
225 Ga0496112_0006194 3300048915 Bacteria 10468
226 Ga0496112_0132657 3300048915 Bacteria 2462
227 Ga0496112_0236145 3300048915 Bacteria 1782
228 Ga0496113_0057953 3300048916 Bacteria 2913
229 Ga0496114_0251589 3300048917 Bacteria 1555
230 Ga0496121_0181816 3300048924 Bacteria 1517
231 Ga0496124_0042839 3300048927 Bacteria 3894
232 Ga0496124_0075185 3300048927 Bacteria 2791
233 Ga0501031_0038798 3300049568 Bacteria 3108
234 Ga0501031_0043203 3300049568 Bacteria 2942
235 Ga0501031_0051016 3300049568 Bacteria 2695
236 Ga0501032_0076350 3300049569 Bacteria 2231
237 Ga0501034_0331229 3300049571 Bacteria 1454
238 Ga0501036_0039223 3300049572 Bacteria 4009
239 Ga0501039_0028908 3300049575 Bacteria 4268
240 Ga0501040_0145663 3300049576 Bacteria 1670
241 Ga0501040_0288068 3300049576 Bacteria 1173
242 Ga0501041_0079839 3300049577 Bacteria 2014
243 Ga0501041_0122724 3300049577 Bacteria 1615
244 Ga0501042_0014413 3300049578 Bacteria 5396
245 Ga0501047_0324752 3300049581 Bacteria 1378
246 Ga0501067_0092821 3300049583 Bacteria 1676
247 Ga0501068_0125800 3300049584 Bacteria 1601
248 Ga0501069_0060981 3300049585 Bacteria 2106
249 Ga0501070_0088589 3300049586 Bacteria 2561
250 Ga0501070_0107161 3300049586 Unclassified 2309
251 Ga0501070_0181898 3300049586 Bacteria 1730
252 Ga0501071_0019940 3300049587 Bacteria 4657
253 Ga0501071_0174150 3300049587 Bacteria 1611
254 Ga0501072_0037695 3300049588 Bacteria 3792
255 Ga0501072_0184318 3300049588 Bacteria 1665
256 Ga0501076_0170054 3300049592 Bacteria 1776
257 Ga0501077_0037330 3300049593 Bacteria 3095
258 Ga0501077_0097593 3300049593 Bacteria 1862
259 Ga0501249_003206 3300049679 Bacteria 3295
260 Ga0501079_0040707 3300049741 Bacteria 3585
261 Ga0501080_0040411 3300049742 Bacteria 4350
262 Ga0501083_0272565 3300049744 Bacteria 1101
263 Ga0501045_0022688 3300049824 Bacteria 4495
264 Ga0501045_0046527 3300049824 Bacteria 3160
265 nmdc:mga03n38_20971_c1 3300050490 Bacteria 2622
266 nmdc:mga0yw44_13064_c1 3300050492 Bacteria 4355
267 nmdc:mga0yw44_203707_c1 3300050492 Bacteria 1307
268 nmdc:mga08y16_173345_c1 3300050511 Bacteria 2240
269 nmdc:mga08y16_31489_c1 3300050511 Bacteria 5578
270 nmdc:mga08y16_53383_c1 3300050511 Bacteria 4226
271 nmdc:mga08y16_7104_c1 3300050511 Bacteria 11755
272 nmdc:mga0n895_222136_c1 3300050512 Bacteria 1918
273 nmdc:mga0a205_109618_c1 3300050515 Bacteria 2659
274 Ga0500556_0000266 3300053104 Bacteria 41518
275 Ga0500616_0005629 3300053153 Bacteria 8456
276 Ga0500599_007760 3300053736 Bacteria 1386
277 Ga0501084_0007520 3300054114 Bacteria 8982
278 Ga0501082_0036207 3300060353 Bacteria 4252
279 Ga0501082_0312675 3300060353 Bacteria 1368
280 Ga0530510_0032598 3300061734 Bacteria 3749
281 Ga0530510_0085695 3300061734 Bacteria 2295
282 2731908080 2731639228 Bacteria 4187555
283 Ga0081538_10114628
284 JGI25406J46586_10017270
285 Ga0070676_10141071
286 Ga0070683_100003411
287 Ga0070683_100384967
288 Ga0070683_100393178
289 Ga0070670_100102731
290 Ga0070680_100010348
291 Ga0070682_100001878
292 Ga0070682_100218963
293 Ga0070682_100358363
294 Ga0068868_100006153
295 Ga0070661_100024713
296 Ga0070692_10014794
297 Ga0070674_100034919
298 Ga0070673_100174933
299 Ga0070688_100107216
300 Ga0070659_100003318
301 Ga0070659_100049134
302 Ga0070667_100132669
303 Ga0070713_100483957
304 Ga0070701_10015502
305 Ga0070701_10064821
306 Ga0070711_100047315
307 Ga0070700_100003659
308 Ga0070708_100003684
309 Ga0070708_100316546
310 Ga0070663_100007410
311 Ga0070678_100317106
312 Ga0070662_100016125
313 Ga0070662_100085245
314 Ga0070685_10061034
315 Ga0070685_10075218
316 Ga0070706_100002044
317 Ga0070706_100542863
318 Ga0070698_100084960
319 Ga0070679_100015930
320 Ga0070684_100030804
321 Ga0068853_100096390
322 Ga0070665_100262227
323 Ga0068855_100021837
324 Ga0068855_100191877
325 Ga0070664_100118441
326 Ga0068857_100064213
327 Ga0068854_100061429
328 Ga0070702_100012898
329 Ga0070702_100024758
330 Ga0068852_100037143
331 Ga0068852_100075627
332 Ga0068852_100138227
333 Ga0068864_100077552
334 Ga0068863_100341802
335 Ga0068858_100108302
336 Ga0068862_100023947
337 Ga0081455_10309434
338 Ga0081538_10001572
339 Ga0081538_10019634
340 Ga0081538_10065541
341 Ga0081538_10068834
342 Ga0081540_1038116
343 Ga0081539_10002515
344 Ga0081539_10003320
345 Ga0081539_10049086
346 Ga0075365_10003091
347 Ga0075363_100010230
348 Ga0075363_100014041
349 Ga0070712_100000005
350 Ga0075367_10103889
351 Ga0075428_100086721
352 Ga0075428_100527684
353 Ga0075431_100003260
354 Ga0075433_10049894
355 Ga0075434_100206550
356 Ga0068865_100040254
357 Ga0099794_10013685
358 Ga0105240_10160776
359 Ga0105240_10210903
360 Ga0111539_10004135
361 Ga0111539_10017232
362 Ga0111539_10061699
363 Ga0105247_10115371
364 Ga0105243_10006927
365 Ga0105243_10039090
366 Ga0105237_10149356
367 Ga0105249_10113167
368 Ga0105249_10167243
369 Ga0105249_10367103
370 Ga0105249_10427568
371 Ga0105246_10058853
372 Ga0105246_10211183
373 Ga0157370_10013924
374 Ga0157375_10062159
375 Ga0157380_10629081
376 Ga0157377_10026696
377 Ga0163161_10348820
378 Ga0213876_10006114
379 Ga0213875_10011280
380 Ga0207656_10065933
381 Ga0207688_10008393
382 Ga0207643_10204405
383 Ga0207705_10087534
384 Ga0207684_10000018
385 Ga0207707_10005664
386 Ga0207671_10144392
387 Ga0207693_10000023
388 Ga0207693_10027079
389 Ga0207660_10005723
390 Ga0207657_10190613
391 Ga0207652_10073556
392 Ga0207681_10049617
393 Ga0207681_10318115
394 Ga0207659_10037653
395 Ga0207706_10001788
396 Ga0207669_10061710
397 Ga0207704_10111405
398 Ga0207661_10020293
399 Ga0207661_10064456
400 Ga0207667_10402398
401 Ga0207651_10042383
402 Ga0207712_10134083
403 Ga0207640_10046135
404 Ga0207677_10006863
405 Ga0207677_10199979
406 Ga0207703_10060655
407 Ga0207639_10107462
408 Ga0207678_10006785
409 Ga0207678_10078785
410 Ga0207708_10018459
411 Ga0207648_10108400
412 Ga0207648_10194855
413 Ga0207676_10014326
414 Ga0207676_10257023
415 Ga0207674_10049978
416 Ga0207675_100018269
417 Ga0207675_100018487
418 Ga0207683_10125812
419 Ga0207698_10162505
420 Ga0209588_1005291
421 Ga0207428_10096396
422 Ga0207428_10141925
423 Ga0268266_10312441
424 Ga0268265_10098302
425 Ga0268264_10079860
426 Ga0265319_1000175
427 Ga0265330_10105168
428 Ga0307408_100121073
429 Ga0307408_100251821
430 Ga0307410_10020564
431 Ga0307410_10093587
432 Ga0307406_10031602
433 Ga0307407_10044396
434 Ga0307409_100103725
435 Ga0307409_100139733
436 Ga0307409_100193610
437 Ga0307409_100347028
438 Ga0307416_100003571
439 Ga0307416_100700950
440 Ga0307414_10209139
441 Ga0307415_100000387
442 Ga0307415_100039261
443 Ga0307415_100140436
444 Ga0307415_100295453
445 Ga0307415_100402921
446 Ga0316574_0030907
447 Ga0316574_0125935
448 Ga0316582_0170650
449 Ga0395905_0415600
450 Ga0436364_0011569
451 Ga0436364_0412200
452 Ga0436364_0975411
453 Ga0395901_0214176
454 Ga0436365_0679055
455 Ga0436365_0856735
456 Ga0436365_1292628
457 Ga0436365_1502610
458 Ga0436365_1503957
459 Ga0436360_0776680
460 Ga0436360_1089841
461 Ga0436363_0708320
462 Ga0436363_0744148
463 Ga0436363_0855292
464 Ga0436363_1366250
465 Ga0436362_0786444
466 Ga0451797_1464907
467 Ga0451853_4106693
468 Ga0466966_0133645
469 Ga0466963_0112388
470 Ga0466963_0119707
471 Ga0466964_0052169
472 Ga0466964_0055349
473 Ga0466964_0139714
474 Ga0466964_0188296
475 Ga0466971_0066464
476 Ga0466970_0019779
477 Ga0466957_0053269
478 Ga0466957_0069381
479 Ga0466960_0069177
480 Ga0466960_0188692
481 Ga0466959_0126548
482 Ga0466958_0062671
483 Ga0466958_0257625
484 Ga0466967_0002616
485 Ga0466967_0008358
486 Ga0466967_0010659
487 Ga0466967_0029700
488 Ga0466967_0037620
489 Ga0466967_0090855
490 Ga0466967_0094349
491 Ga0466967_0182349
492 Ga0466967_0286938
493 Ga0466967_0308553
494 Ga0466967_0547608
495 Ga0495620_0132420
496 Ga0495672_0006815
497 Ga0496101_0246863
498 Ga0496102_0139249
499 Ga0496106_0005743
500 Ga0496107_0009515
501 Ga0496107_0403311
502 Ga0496108_0004043
503 Ga0496108_0217886
504 Ga0496109_0032866
505 Ga0496109_0035264
506 Ga0496110_0105179
507 Ga0496112_0006194
508 Ga0496112_0132657
509 Ga0496112_0236145
510 Ga0496113_0057953
511 Ga0496114_0251589
512 Ga0496121_0181816
513 Ga0496124_0042839
514 Ga0496124_0075185
515 Ga0501031_0038798
516 Ga0501031_0043203
517 Ga0501031_0051016
518 Ga0501032_0076350
519 Ga0501034_0331229
520 Ga0501036_0039223
521 Ga0501039_0028908
522 Ga0501040_0145663
523 Ga0501040_0288068
524 Ga0501041_0079839
525 Ga0501041_0122724
526 Ga0501042_0014413
527 Ga0501047_0324752
528 Ga0501067_0092821
529 Ga0501068_0125800
530 Ga0501069_0060981
531 Ga0501070_0088589
532 Ga0501070_0107161
533 Ga0501070_0181898
534 Ga0501071_0019940
535 Ga0501071_0174150
536 Ga0501072_0037695
537 Ga0501072_0184318
538 Ga0501076_0170054
539 Ga0501077_0037330
540 Ga0501077_0097593
541 Ga0501249_003206
542 Ga0501079_0040707
543 Ga0501080_0040411
544 Ga0501083_0272565
545 Ga0501045_0022688
546 Ga0501045_0046527
547 nmdc:mga03n38_20971_c1
548 nmdc:mga0yw44_13064_c1
549 nmdc:mga0yw44_203707_c1
550 nmdc:mga08y16_173345_c1
551 nmdc:mga08y16_31489_c1
552 nmdc:mga08y16_53383_c1
553 nmdc:mga08y16_7104_c1
554 nmdc:mga0n895_222136_c1
555 nmdc:mga0a205_109618_c1
556 Ga0500556_0000266
557 Ga0500616_0005629
558 Ga0500599_007760
559 Ga0501084_0007520
560 Ga0501082_0036207
561 Ga0501082_0312675
562 Ga0530510_0032598
563 Ga0530510_0085695
564 2731908080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

24

311

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7th5-assembly1.cif.gz_B thermus thermophilus methylenetetrahydrofolate reductase 0.9696 1 288
1b5t-assembly1.cif.gz_C escherichia coli methylenetetrahydrofolate reductase 0.9604 12 288
8eac-assembly1.cif.gz_B thermus thermophilus methylenetetrahydrofolate reductase 0.9572 1 288
7th5-assembly1.cif.gz_B thermus thermophilus methylenetetrahydrofolate reductase 0.9563 1 288
2fmo-assembly1.cif.gz_A ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.9514 12 288
ID Description Score Start End Superfamily
af_A0A1D6GER4_1_215_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9644 86 285 3.20.20.220
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9565 1 288 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9488 1 299 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9456 1 299 3.20.20.220
af_Q9WU20_42_335_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9313 1 285 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A3B9AG07-F1-model_v4 Methylenetetrahydrofolate reductase 0.9897 131 273 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A3M1KZ61-F1-model_v4 Methylenetetrahydrofolate reductase 0.9858 120 289 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A836TIV5-F1-model_v4 Methylenetetrahydrofolate reductase (EC 1.5.1.54) 0.9848 1 288 GO:0004489
GO:0005829
GO:0009086
GO:0035999
GO:0071949
AF-A0A7X5SBV7-F1-model_v4 Methylenetetrahydrofolate reductase 0.984 153 253 GO:0004489
GO:0005829
GO:0009086
GO:0035999
GO:0071949
AF-A0A2E5F6N1-F1-model_v4 Methylenetetrahydrofolate reductase 0.9834 104 286 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312

Map