F384813
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 211 | 254 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300005545|Ga0070695_100143817|Ga0070695_1001438171 |
| Length | 316 |
| Sequence | MSKKKVNKPTPSRPPVRALRLTRPLSTLPLRPLIGPAQGRLRPKPKTAGAPKLKSVVSDAVRNAAAAIRSAYENQKPIPPIRDMLPPNDIAAAYAVQQANTNHWIGQGRRPVGRKIGLTAKAVQAQLGVDQPDYGILYADMEIPDSEEIPTARVMQPRAEAEVALVLKKDLLLEQLTLIDLLDATAYALPAIEVVGSRIAKWDIKIVDTVADNASSGLFVLGTRPVPLDQLDLRNCGMVLEKRGDQVSVGAGVACLSNPLNAALWLARKMVTVGMPLRAGNVILTGALGPMVPVAPGDVLEARISGLGSVRAVFAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 3 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 4 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 5 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 6 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 7 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 8 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 9 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 10 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 11 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 12 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 13 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 14 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 15 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 16 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 17 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 18 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 19 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 20 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 21 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 22 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 23 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 24 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 25 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 26 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 27 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 28 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 29 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 78 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 110 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 111 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 114 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 115 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 116 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 125 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 126 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 127 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 128 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 129 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 130 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 131 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 132 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 133 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 134 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 135 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 136 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 137 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 138 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 139 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 140 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 141 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 142 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 143 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 144 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 147 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 170 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 175 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 176 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 177 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 178 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 179 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 180 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 181 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 182 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 198 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 199 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 201 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 202 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 203 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 205 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 206 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 207 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 208 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 210 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.72 |
| Metatranscriptomes | 0.35 |
| Isolates | 9.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.02 |
| Nodule | 1.77 |
| Rhizoplane | 4.61 |
| Rhizosphere | 58.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000789 | 3300003187 | Bacteria | 25548 |
| 2 | Ga0055532_1000041 | 3300003758 | Bacteria | 195749 |
| 3 | Ga0055527_1000413 | 3300003760 | Bacteria | 17652 |
| 4 | Ga0055535_1000030 | 3300003761 | Bacteria | 195749 |
| 5 | Ga0055529_1000058 | 3300003763 | Bacteria | 195735 |
| 6 | Ga0055526_1009689 | 3300003771 | Bacteria | 4594 |
| 7 | Ga0055524_1000445 | 3300003775 | Bacteria | 34252 |
| 8 | Ga0055534_1000378 | 3300003784 | Bacteria | 27872 |
| 9 | Ga0055530_10012816 | 3300003791 | Bacteria | 2901 |
| 10 | Ga0055540_1000374 | 3300003792 | Bacteria | 37462 |
| 11 | Ga0055531_10000475 | 3300003794 | Bacteria | 37156 |
| 12 | Ga0055531_10000798 | 3300003794 | Bacteria | 26114 |
| 13 | Ga0055541_1000210 | 3300003841 | Bacteria | 24663 |
| 14 | Ga0070670_100048577 | 3300005331 | Bacteria | 3651 |
| 15 | Ga0070680_100418398 | 3300005336 | Bacteria | 1143 |
| 16 | Ga0070675_100014108 | 3300005354 | Bacteria | 6296 |
| 17 | Ga0070671_100140469 | 3300005355 | Bacteria | 2038 |
| 18 | Ga0070681_10138263 | 3300005458 | Bacteria | 2365 |
| 19 | Ga0070698_100027218 | 3300005471 | Bacteria | 5948 |
| 20 | Ga0070698_100044598 | 3300005471 | Bacteria | 4540 |
| 21 | Ga0068853_100011778 | 3300005539 | Bacteria | 7108 |
| 22 | Ga0070695_100143817 | 3300005545 | Bacteria | 1657 |
| 23 | Ga0070696_100280893 | 3300005546 | Bacteria | 1269 |
| 24 | Ga0070665_100110310 | 3300005548 | Bacteria | 2754 |
| 25 | Ga0068854_100000025 | 3300005578 | Bacteria | 123547 |
| 26 | Ga0070702_100096882 | 3300005615 | Bacteria | 1801 |
| 27 | Ga0068852_100002784 | 3300005616 | Bacteria | 12111 |
| 28 | Ga0068852_100056409 | 3300005616 | Bacteria | 3395 |
| 29 | Ga0068859_100328272 | 3300005617 | Bacteria | 1624 |
| 30 | Ga0068861_100499736 | 3300005719 | Bacteria | 1099 |
| 31 | Ga0068860_100443263 | 3300005843 | Bacteria | 1290 |
| 32 | Ga0068862_100066283 | 3300005844 | Bacteria | 3111 |
| 33 | Ga0081455_10054642 | 3300005937 | Bacteria | 3402 |
| 34 | Ga0081539_10025000 | 3300005985 | Bacteria | 3858 |
| 35 | Ga0075362_10114706 | 3300006177 | Bacteria | 1271 |
| 36 | Ga0075370_10036649 | 3300006353 | Bacteria | 2755 |
| 37 | Ga0075370_10061494 | 3300006353 | Bacteria | 2139 |
| 38 | Ga0075428_100038862 | 3300006844 | Bacteria | 5237 |
| 39 | Ga0075428_100069620 | 3300006844 | Bacteria | 3846 |
| 40 | Ga0075431_100010824 | 3300006847 | Bacteria | 9173 |
| 41 | Ga0075431_100017129 | 3300006847 | Bacteria | 7366 |
| 42 | Ga0097620_100328261 | 3300006931 | Bacteria | 1624 |
| 43 | Ga0105240_10002768 | 3300009093 | Bacteria | 27702 |
| 44 | Ga0105240_10005695 | 3300009093 | Bacteria | 18492 |
| 45 | Ga0105240_10036751 | 3300009093 | Bacteria | 6297 |
| 46 | Ga0105240_10071331 | 3300009093 | Bacteria | 4297 |
| 47 | Ga0105240_10083018 | 3300009093 | Bacteria | 3933 |
| 48 | Ga0105243_10003676 | 3300009148 | Bacteria | 12326 |
| 49 | Ga0105241_10354884 | 3300009174 | Bacteria | 1274 |
| 50 | Ga0105237_10000874 | 3300009545 | Bacteria | 40867 |
| 51 | Ga0105237_10004401 | 3300009545 | Bacteria | 16334 |
| 52 | Ga0105238_10011534 | 3300009551 | Bacteria | 8903 |
| 53 | Ga0105238_10024207 | 3300009551 | Bacteria | 6190 |
| 54 | Ga0105238_10130608 | 3300009551 | Bacteria | 2490 |
| 55 | Ga0105239_10000113 | 3300010375 | Bacteria | 114562 |
| 56 | Ga0105239_10023372 | 3300010375 | Bacteria | 6807 |
| 57 | Ga0157326_1000567 | 3300012513 | Bacteria | 4371 |
| 58 | Ga0157373_10000323 | 3300013100 | Bacteria | 38659 |
| 59 | Ga0157373_10053744 | 3300013100 | Bacteria | 2864 |
| 60 | Ga0157369_10000809 | 3300013105 | Bacteria | 39990 |
| 61 | Ga0157380_10005038 | 3300014326 | Bacteria | 9213 |
| 62 | Ga0182008_10000041 | 3300014497 | Bacteria | 118254 |
| 63 | Ga0182006_1001495 | 3300015261 | Bacteria | 14025 |
| 64 | Ga0154015_1576712 | 3300020610 | Bacteria | 11322 |
| 65 | Ga0213872_10021881 | 3300021361 | Bacteria | 2944 |
| 66 | Ga0209566_100536 | 3300025225 | Bacteria | 25712 |
| 67 | Ga0209674_100361 | 3300025226 | Bacteria | 25761 |
| 68 | Ga0209672_100247 | 3300025228 | Bacteria | 40787 |
| 69 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 70 | Ga0209563_112777 | 3300025230 | Bacteria | 1134 |
| 71 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 72 | Ga0209759_1000492 | 3300025256 | Bacteria | 43562 |
| 73 | Ga0209565_1000201 | 3300025263 | Bacteria | 71408 |
| 74 | Ga0209455_1000106 | 3300025272 | Bacteria | 195801 |
| 75 | Ga0209675_1000560 | 3300025291 | Bacteria | 26860 |
| 76 | Ga0209675_1011001 | 3300025291 | Bacteria | 3037 |
| 77 | Ga0209676_1000779 | 3300025292 | Bacteria | 42577 |
| 78 | Ga0209025_1000341 | 3300025294 | Bacteria | 102793 |
| 79 | Ga0209025_1001002 | 3300025294 | Bacteria | 41890 |
| 80 | Ga0209564_1000578 | 3300025295 | Bacteria | 58027 |
| 81 | Ga0209758_1017733 | 3300025297 | Bacteria | 3525 |
| 82 | Ga0209050_1000412 | 3300025298 | Bacteria | 79647 |
| 83 | Ga0209256_1001799 | 3300025299 | Bacteria | 20207 |
| 84 | Ga0209051_1000150 | 3300025303 | Bacteria | 132005 |
| 85 | Ga0209257_1000275 | 3300025304 | Bacteria | 116952 |
| 86 | Ga0207707_10047295 | 3300025912 | Bacteria | 3747 |
| 87 | Ga0207695_10000535 | 3300025913 | Bacteria | 79187 |
| 88 | Ga0207695_10008333 | 3300025913 | Bacteria | 12989 |
| 89 | Ga0207695_10020874 | 3300025913 | Bacteria | 7485 |
| 90 | Ga0207695_10084748 | 3300025913 | Bacteria | 3199 |
| 91 | Ga0207695_10121474 | 3300025913 | Bacteria | 2579 |
| 92 | Ga0207695_10142545 | 3300025913 | Bacteria | 2343 |
| 93 | Ga0207671_10000759 | 3300025914 | Bacteria | 40972 |
| 94 | Ga0207671_10013120 | 3300025914 | Bacteria | 6619 |
| 95 | Ga0207694_10050639 | 3300025924 | Bacteria | 3217 |
| 96 | Ga0207694_10083104 | 3300025924 | Bacteria | 2518 |
| 97 | Ga0207694_10096699 | 3300025924 | Bacteria | 2336 |
| 98 | Ga0207650_10030114 | 3300025925 | Bacteria | 3907 |
| 99 | Ga0207650_10062094 | 3300025925 | Bacteria | 2791 |
| 100 | Ga0207659_10151644 | 3300025926 | Bacteria | 1810 |
| 101 | Ga0207644_10115374 | 3300025931 | Bacteria | 2037 |
| 102 | Ga0207640_10000096 | 3300025981 | Bacteria | 68105 |
| 103 | Ga0207658_10056069 | 3300025986 | Bacteria | 2923 |
| 104 | Ga0207639_10028442 | 3300026041 | Bacteria | 4082 |
| 105 | Ga0207675_100161192 | 3300026118 | Bacteria | 2139 |
| 106 | Ga0207675_100165538 | 3300026118 | Bacteria | 2111 |
| 107 | Ga0207698_10008121 | 3300026142 | Bacteria | 6616 |
| 108 | Ga0207698_10074131 | 3300026142 | Bacteria | 2713 |
| 109 | Ga0268266_10505817 | 3300028379 | Bacteria | 1154 |
| 110 | Ga0307515_10003427 | 3300028794 | Bacteria | 33380 |
| 111 | Ga0307515_10003461 | 3300028794 | Bacteria | 33183 |
| 112 | Ga0307515_10083802 | 3300028794 | Bacteria | 4105 |
| 113 | Ga0316181_1154916 | 3300030744 | Bacteria | 3410 |
| 114 | Ga0265327_10000183 | 3300031251 | Bacteria | 133191 |
| 115 | Ga0307513_10000034 | 3300031456 | Bacteria | 185012 |
| 116 | Ga0307513_10400613 | 3300031456 | Bacteria | 1107 |
| 117 | Ga0307509_10001929 | 3300031507 | Bacteria | 34257 |
| 118 | Ga0307408_100012528 | 3300031548 | Bacteria | 5621 |
| 119 | Ga0307508_10002660 | 3300031616 | Bacteria | 18747 |
| 120 | Ga0307508_10451461 | 3300031616 | Bacteria | 878 |
| 121 | Ga0307514_10003744 | 3300031649 | Bacteria | 14345 |
| 122 | Ga0307410_10213184 | 3300031852 | Bacteria | 1481 |
| 123 | Ga0307412_10009292 | 3300031911 | Bacteria | 5637 |
| 124 | Ga0307412_10383910 | 3300031911 | Bacteria | 1138 |
| 125 | Ga0307409_100069435 | 3300031995 | Bacteria | 2792 |
| 126 | Ga0307416_100119433 | 3300032002 | Bacteria | 2345 |
| 127 | Ga0307416_100186033 | 3300032002 | Bacteria | 1952 |
| 128 | Ga0307507_10019308 | 3300033179 | Bacteria | 7685 |
| 129 | Ga0395899_0000035 | 3300037312 | Bacteria | 295584 |
| 130 | Ga0395900_0000113 | 3300037418 | Bacteria | 139979 |
| 131 | Ga0395900_0001052 | 3300037418 | Bacteria | 35361 |
| 132 | Ga0395898_0000444 | 3300037466 | Bacteria | 85520 |
| 133 | Ga0395905_0001060 | 3300037471 | Bacteria | 34743 |
| 134 | Ga0395905_0020836 | 3300037471 | Bacteria | 6209 |
| 135 | Ga0395905_0116348 | 3300037471 | Bacteria | 2513 |
| 136 | Ga0400483_182915 | 3300039062 | Bacteria | 2307 |
| 137 | Ga0436361_0108407 | 3300039447 | Bacteria | 32994 |
| 138 | Ga0439436_0026861 | 3300041404 | Bacteria | 1685 |
| 139 | Ga0439465_0041098 | 3300041413 | Bacteria | 1496 |
| 140 | Ga0439445_0006499 | 3300042004 | Bacteria | 2689 |
| 141 | Ga0439445_0082135 | 3300042004 | Bacteria | 901 |
| 142 | Ga0439432_001861 | 3300042006 | Bacteria | 7925 |
| 143 | Ga0439432_006592 | 3300042006 | Bacteria | 4137 |
| 144 | Ga0439432_034016 | 3300042006 | Bacteria | 1638 |
| 145 | Ga0439449_0011342 | 3300042007 | Bacteria | 3353 |
| 146 | Ga0439449_0019605 | 3300042007 | Bacteria | 2536 |
| 147 | Ga0439449_0038052 | 3300042007 | Bacteria | 1789 |
| 148 | Ga0439457_006304 | 3300042014 | Bacteria | 2913 |
| 149 | Ga0439457_015363 | 3300042014 | Bacteria | 1710 |
| 150 | Ga0439462_0006133 | 3300042015 | Bacteria | 2979 |
| 151 | Ga0450906_005411 | 3300042145 | Bacteria | 2626 |
| 152 | Ga0450910_020843 | 3300042147 | Bacteria | 990 |
| 153 | Ga0450909_007759 | 3300042185 | Bacteria | 1555 |
| 154 | Ga0450909_009495 | 3300042185 | Bacteria | 1421 |
| 155 | Ga0439464_0000586 | 3300042439 | Bacteria | 7637 |
| 156 | Ga0439460_0014176 | 3300042461 | Bacteria | 2093 |
| 157 | Ga0450918_006985 | 3300042531 | Bacteria | 2007 |
| 158 | Ga0466977_0002577 | 3300044666 | Bacteria | 8363 |
| 159 | Ga0466961_0000852 | 3300044693 | Bacteria | 19075 |
| 160 | Ga0466963_0075465 | 3300044694 | Bacteria | 2275 |
| 161 | Ga0466971_0113707 | 3300044719 | Bacteria | 1250 |
| 162 | Ga0451576_0000619 | 3300045051 | Bacteria | 74347 |
| 163 | Ga0466958_0022274 | 3300045836 | Bacteria | 3709 |
| 164 | Ga0495627_000685 | 3300046453 | Bacteria | 25974 |
| 165 | Ga0495592_0137993 | 3300046454 | Bacteria | 1699 |
| 166 | Ga0495590_0015682 | 3300046457 | Bacteria | 2745 |
| 167 | Ga0495638_0251439 | 3300046460 | Bacteria | 974 |
| 168 | Ga0495650_0001499 | 3300046471 | Bacteria | 22259 |
| 169 | Ga0495650_0005400 | 3300046471 | Bacteria | 8308 |
| 170 | Ga0495650_0009691 | 3300046471 | Bacteria | 5458 |
| 171 | Ga0495650_0015434 | 3300046471 | Bacteria | 3919 |
| 172 | Ga0495585_0000684 | 3300046492 | Bacteria | 30886 |
| 173 | Ga0495606_0035563 | 3300046507 | Bacteria | 3403 |
| 174 | Ga0495637_0102335 | 3300046520 | Bacteria | 1118 |
| 175 | Ga0495648_0104613 | 3300046524 | Bacteria | 1554 |
| 176 | Ga0495642_0000054 | 3300046528 | Bacteria | 69311 |
| 177 | Ga0495656_0178014 | 3300046615 | Bacteria | 1044 |
| 178 | Ga0495625_0002204 | 3300046660 | Bacteria | 21561 |
| 179 | Ga0495671_0000680 | 3300046692 | Bacteria | 24547 |
| 180 | Ga0495660_0000859 | 3300046810 | Bacteria | 22422 |
| 181 | Ga0495660_0001435 | 3300046810 | Bacteria | 16331 |
| 182 | Ga0495636_0053671 | 3300047318 | Bacteria | 1692 |
| 183 | Ga0495672_0000202 | 3300047320 | Bacteria | 85107 |
| 184 | Ga0495672_0234790 | 3300047320 | Bacteria | 898 |
| 185 | Ga0495685_014526 | 3300047447 | Bacteria | 2676 |
| 186 | Ga0495673_0000215 | 3300047469 | Bacteria | 86087 |
| 187 | Ga0495681_0000119 | 3300047470 | Bacteria | 69357 |
| 188 | Ga0495681_0001926 | 3300047470 | Bacteria | 15213 |
| 189 | Ga0495681_0064384 | 3300047470 | Bacteria | 1679 |
| 190 | Ga0495686_0055555 | 3300047472 | Bacteria | 2475 |
| 191 | Ga0496100_0523554 | 3300048903 | Bacteria | 915 |
| 192 | Ga0496102_0000100 | 3300048905 | Bacteria | 123531 |
| 193 | Ga0496102_0000806 | 3300048905 | Bacteria | 30478 |
| 194 | Ga0496103_0000070 | 3300048906 | Bacteria | 121077 |
| 195 | Ga0496103_0035778 | 3300048906 | Bacteria | 3040 |
| 196 | Ga0496103_0104627 | 3300048906 | Bacteria | 1794 |
| 197 | Ga0496105_0208180 | 3300048908 | Bacteria | 1595 |
| 198 | Ga0496107_0305472 | 3300048910 | Bacteria | 1184 |
| 199 | Ga0496108_0022939 | 3300048911 | Bacteria | 5136 |
| 200 | Ga0496114_0085805 | 3300048917 | Bacteria | 2667 |
| 201 | Ga0496116_0000527 | 3300048919 | Bacteria | 51590 |
| 202 | Ga0496116_0019128 | 3300048919 | Bacteria | 5252 |
| 203 | Ga0496117_0000024 | 3300048920 | Bacteria | 418750 |
| 204 | Ga0496117_0000194 | 3300048920 | Bacteria | 123531 |
| 205 | Ga0496118_0000014 | 3300048921 | Bacteria | 561628 |
| 206 | Ga0496118_0000146 | 3300048921 | Bacteria | 123531 |
| 207 | Ga0496118_0091036 | 3300048921 | Bacteria | 2099 |
| 208 | Ga0496118_0138194 | 3300048921 | Bacteria | 1550 |
| 209 | Ga0496119_0019292 | 3300048922 | Bacteria | 5029 |
| 210 | Ga0496120_0018448 | 3300048923 | Bacteria | 4496 |
| 211 | Ga0496120_0021251 | 3300048923 | Bacteria | 4104 |
| 212 | Ga0496121_0000079 | 3300048924 | Bacteria | 232653 |
| 213 | Ga0496121_0023425 | 3300048924 | Bacteria | 5946 |
| 214 | Ga0496122_0000249 | 3300048925 | Bacteria | 121066 |
| 215 | Ga0496122_0027018 | 3300048925 | Bacteria | 4924 |
| 216 | Ga0496122_0178489 | 3300048925 | Bacteria | 1270 |
| 217 | Ga0496123_0008112 | 3300048926 | Bacteria | 9708 |
| 218 | Ga0496123_0037303 | 3300048926 | Bacteria | 3433 |
| 219 | Ga0496124_0000185 | 3300048927 | Bacteria | 123531 |
| 220 | Ga0496124_0204019 | 3300048927 | Bacteria | 1501 |
| 221 | Ga0496125_0006330 | 3300048928 | Bacteria | 12846 |
| 222 | Ga0496125_0008770 | 3300048928 | Bacteria | 10515 |
| 223 | Ga0496125_0068152 | 3300048928 | Bacteria | 2800 |
| 224 | Ga0496126_0020454 | 3300048929 | Bacteria | 6486 |
| 225 | Ga0496126_0044510 | 3300048929 | Bacteria | 4086 |
| 226 | Ga0495682_0000039 | 3300049460 | Bacteria | 119714 |
| 227 | Ga0501032_0074374 | 3300049569 | Bacteria | 2264 |
| 228 | Ga0501034_0000199 | 3300049571 | Bacteria | 113624 |
| 229 | Ga0501034_0005968 | 3300049571 | Bacteria | 13182 |
| 230 | Ga0501038_0268150 | 3300049574 | Bacteria | 1347 |
| 231 | Ga0501042_0127342 | 3300049578 | Bacteria | 1834 |
| 232 | Ga0501047_0154811 | 3300049581 | Bacteria | 2166 |
| 233 | Ga0501047_0171022 | 3300049581 | Bacteria | 2042 |
| 234 | Ga0501048_0291874 | 3300049582 | Bacteria | 1160 |
| 235 | Ga0501067_0251321 | 3300049583 | Bacteria | 984 |
| 236 | Ga0501071_0294276 | 3300049587 | Bacteria | 1230 |
| 237 | Ga0501075_0541525 | 3300049591 | Bacteria | 888 |
| 238 | Ga0501076_0240019 | 3300049592 | Bacteria | 1483 |
| 239 | Ga0501035_0233534 | 3300049822 | Bacteria | 1567 |
| 240 | nmdc:mga03683_142_c1 | 3300050489 | Bacteria | 24361 |
| 241 | nmdc:mga00v17_262556_c1 | 3300050491 | Bacteria | 1120 |
| 242 | nmdc:mga0yw44_231954_c1 | 3300050492 | Bacteria | 1225 |
| 243 | nmdc:mga0k408_29873_c1 | 3300050493 | Bacteria | 3105 |
| 244 | nmdc:mga06z11_19060_c1 | 3300050494 | Bacteria | 3146 |
| 245 | nmdc:mga07m45_22998_c1 | 3300050496 | Bacteria | 3405 |
| 246 | nmdc:mga07m45_24027_c1 | 3300050496 | Bacteria | 3335 |
| 247 | nmdc:mga06r32_16305_c1 | 3300050510 | Bacteria | 6767 |
| 248 | nmdc:mga0sz30_15912_c1 | 3300050516 | Bacteria | 2977 |
| 249 | Ga0500562_003379 | 3300053108 | Bacteria | 3992 |
| 250 | Ga0500618_002466 | 3300053125 | Bacteria | 6963 |
| 251 | Ga0500568_0083023 | 3300053139 | Bacteria | 1215 |
| 252 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 253 | Ga0500634_0042104 | 3300053161 | Bacteria | 2478 |
| 254 | Ga0501082_0263207 | 3300060353 | Bacteria | 1500 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049591 | Ga0501075_0541525 | Ga0501075_0541525_162_872 | 233 |
| 2 | 3300050491 | nmdc:mga00v17_262556_c1 | nmdc:mga00v17_262556_c1_310_1035 | 233 |
| 3 | 3300049583 | Ga0501067_0251321 | Ga0501067_0251321_255_959 | 234 |
| 4 | 3300025986 | Ga0207658_10056069 | Ga0207658_100560692 | 240 |
| 5 | 3300053139 | Ga0500568_0083023 | Ga0500568_0083023_162_887 | 241 |
| 6 | 3300009148 | Ga0105243_10003676 | Ga0105243_1000367611 | 244 |
| 7 | 3300046615 | Ga0495656_0178014 | Ga0495656_0178014_41_865 | 245 |
| 8 | 3300048905 | Ga0496102_0000806 | Ga0496102_0000806_11657_12469 | 247 |
| 9 | 3300048906 | Ga0496103_0035778 | Ga0496103_0035778_723_1535 | 247 |
| 10 | 3300046471 | Ga0495650_0015434 | Ga0495650_0015434_1053_1883 | 252 |
| 11 | 3300005471 | Ga0070698_100027218 | Ga0070698_1000272181 | 255 |
| 12 | 3300006844 | Ga0075428_100069620 | Ga0075428_1000696205 | 255 |
| 13 | 3300006847 | Ga0075431_100017129 | Ga0075431_1000171296 | 255 |
| 14 | iso_pu_bacteria | 2513237151 | 2513962113 | 255 |
| 15 | 3300005336 | Ga0070680_100418398 | Ga0070680_1004183982 | 256 |
| 16 | 3300005458 | Ga0070681_10138263 | Ga0070681_101382632 | 256 |
| 17 | 3300025912 | Ga0207707_10047295 | Ga0207707_100472952 | 256 |
| 18 | iso_pu_bacteria | 2884811622 | 2884812784 | 256 |
| 19 | iso_pu_bacteria | 2884836552 | 2884839048 | 256 |
| 20 | iso_pu_bacteria | 2884852848 | 2884855339 | 256 |
| 21 | iso_pu_bacteria | 2896154374 | 2896159154 | 256 |
| 22 | 3300005471 | Ga0070698_100044598 | Ga0070698_1000445983 | 257 |
| 23 | 3300005937 | Ga0081455_10054642 | Ga0081455_100546423 | 257 |
| 24 | 3300053153 | Ga0500616_0000027 | Ga0500616_0000027_400055_400864 | 257 |
| 25 | 3300005331 | Ga0070670_100048577 | Ga0070670_1000485773 | 258 |
| 26 | 3300005616 | Ga0068852_100002784 | Ga0068852_1000027843 | 258 |
| 27 | 3300009093 | Ga0105240_10036751 | Ga0105240_100367515 | 258 |
| 28 | 3300009093 | Ga0105240_10083018 | Ga0105240_100830182 | 258 |
| 29 | 3300009551 | Ga0105238_10011534 | Ga0105238_100115343 | 258 |
| 30 | 3300025913 | Ga0207695_10008333 | Ga0207695_100083337 | 258 |
| 31 | 3300025913 | Ga0207695_10142545 | Ga0207695_101425453 | 258 |
| 32 | 3300025924 | Ga0207694_10050639 | Ga0207694_100506392 | 258 |
| 33 | 3300025925 | Ga0207650_10030114 | Ga0207650_100301143 | 258 |
| 34 | 3300026142 | Ga0207698_10008121 | Ga0207698_100081214 | 258 |
| 35 | 3300039062 | Ga0400483_182915 | Ga0400483_182915_261_1043 | 258 |
| 36 | 3300046660 | Ga0495625_0002204 | Ga0495625_0002204_16848_17630 | 258 |
| 37 | 3300048919 | Ga0496116_0019128 | Ga0496116_0019128_2395_3177 | 258 |
| 38 | 3300048921 | Ga0496118_0091036 | Ga0496118_0091036_689_1471 | 258 |
| 39 | 3300048924 | Ga0496121_0023425 | Ga0496121_0023425_4477_5259 | 258 |
| 40 | 3300048925 | Ga0496122_0000249 | Ga0496122_0000249_29321_30103 | 258 |
| 41 | 3300048926 | Ga0496123_0008112 | Ga0496123_0008112_4071_4853 | 258 |
| 42 | 3300048927 | Ga0496124_0204019 | Ga0496124_0204019_280_1062 | 258 |
| 43 | 3300048928 | Ga0496125_0006330 | Ga0496125_0006330_8571_9353 | 258 |
| 44 | 3300006353 | Ga0075370_10061494 | Ga0075370_100614943 | 259 |
| 45 | 3300021361 | Ga0213872_10021881 | Ga0213872_100218813 | 259 |
| 46 | 3300039447 | Ga0436361_0108407 | Ga0436361_0108407_4396_5181 | 259 |
| 47 | 3300045051 | Ga0451576_0000619 | Ga0451576_0000619_4467_5255 | 259 |
| 48 | 3300046471 | Ga0495650_0001499 | Ga0495650_0001499_16037_16840 | 259 |
| 49 | 3300048928 | Ga0496125_0008770 | Ga0496125_0008770_4429_5256 | 259 |
| 50 | 3300049460 | Ga0495682_0000039 | Ga0495682_0000039_106662_107456 | 259 |
| 51 | 3300049592 | Ga0501076_0240019 | Ga0501076_0240019_79_864 | 259 |
| 52 | 3300050496 | nmdc:mga07m45_24027_c1 | nmdc:mga07m45_24027_c1_1307_2134 | 259 |
| 53 | iso_pu_bacteria | 2881101125 | 2881104885 | 259 |
| 54 | iso_pu_bacteria | 2895427314 | 2895429732 | 259 |
| 55 | 3300005548 | Ga0070665_100110310 | Ga0070665_1001103102 | 260 |
| 56 | 3300005617 | Ga0068859_100328272 | Ga0068859_1003282721 | 260 |
| 57 | 3300005985 | Ga0081539_10025000 | Ga0081539_100250003 | 260 |
| 58 | 3300006844 | Ga0075428_100038862 | Ga0075428_1000388622 | 260 |
| 59 | 3300006931 | Ga0097620_100328261 | Ga0097620_1003282611 | 260 |
| 60 | 3300014326 | Ga0157380_10005038 | Ga0157380_100050385 | 260 |
| 61 | 3300028379 | Ga0268266_10505817 | Ga0268266_105058172 | 260 |
| 62 | 3300037471 | Ga0395905_0116348 | Ga0395905_0116348_1035_1823 | 260 |
| 63 | 3300042439 | Ga0439464_0000586 | Ga0439464_0000586_4109_4906 | 260 |
| 64 | 3300042461 | Ga0439460_0014176 | Ga0439460_0014176_1179_1976 | 260 |
| 65 | 3300046457 | Ga0495590_0015682 | Ga0495590_0015682_241_1029 | 260 |
| 66 | 3300048903 | Ga0496100_0523554 | Ga0496100_0523554_92_874 | 260 |
| 67 | 3300048906 | Ga0496103_0104627 | Ga0496103_0104627_870_1652 | 260 |
| 68 | 3300048910 | Ga0496107_0305472 | Ga0496107_0305472_15_797 | 260 |
| 69 | 3300048917 | Ga0496114_0085805 | Ga0496114_0085805_1365_2147 | 260 |
| 70 | 3300048920 | Ga0496117_0000024 | Ga0496117_0000024_214646_215428 | 260 |
| 71 | 3300048921 | Ga0496118_0000014 | Ga0496118_0000014_203634_204416 | 260 |
| 72 | 3300048923 | Ga0496120_0018448 | Ga0496120_0018448_246_1028 | 260 |
| 73 | 3300048928 | Ga0496125_0068152 | Ga0496125_0068152_1522_2304 | 260 |
| 74 | 3300048929 | Ga0496126_0044510 | Ga0496126_0044510_948_1730 | 260 |
| 75 | 3300049587 | Ga0501071_0294276 | Ga0501071_0294276_409_1206 | 260 |
| 76 | 3300053108 | Ga0500562_003379 | Ga0500562_003379_1236_2021 | 260 |
| 77 | iso_pu_bacteria | 2744054611 | 2744957677 | 260 |
| 78 | 3300009093 | Ga0105240_10071331 | Ga0105240_100713311 | 261 |
| 79 | 3300009545 | Ga0105237_10000874 | Ga0105237_1000087413 | 261 |
| 80 | 3300009551 | Ga0105238_10130608 | Ga0105238_101306082 | 261 |
| 81 | 3300010375 | Ga0105239_10000113 | Ga0105239_1000011348 | 261 |
| 82 | 3300025294 | Ga0209025_1000341 | Ga0209025_100034162 | 261 |
| 83 | 3300025913 | Ga0207695_10084748 | Ga0207695_100847483 | 261 |
| 84 | 3300025913 | Ga0207695_10121474 | Ga0207695_101214741 | 261 |
| 85 | 3300025914 | Ga0207671_10000759 | Ga0207671_1000075934 | 261 |
| 86 | 3300025924 | Ga0207694_10083104 | Ga0207694_100831042 | 261 |
| 87 | 3300028794 | Ga0307515_10083802 | Ga0307515_100838024 | 261 |
| 88 | 3300046453 | Ga0495627_000685 | Ga0495627_000685_17352_18137 | 261 |
| 89 | 3300046460 | Ga0495638_0251439 | Ga0495638_0251439_48_839 | 261 |
| 90 | 3300046471 | Ga0495650_0005400 | Ga0495650_0005400_6045_6830 | 261 |
| 91 | 3300046471 | Ga0495650_0009691 | Ga0495650_0009691_4454_5239 | 261 |
| 92 | 3300046520 | Ga0495637_0102335 | Ga0495637_0102335_190_975 | 261 |
| 93 | 3300046528 | Ga0495642_0000054 | Ga0495642_0000054_19133_19924 | 261 |
| 94 | 3300046692 | Ga0495671_0000680 | Ga0495671_0000680_11607_12398 | 261 |
| 95 | 3300047320 | Ga0495672_0000202 | Ga0495672_0000202_19133_19924 | 261 |
| 96 | 3300047320 | Ga0495672_0234790 | Ga0495672_0234790_20_853 | 261 |
| 97 | 3300047469 | Ga0495673_0000215 | Ga0495673_0000215_19133_19924 | 261 |
| 98 | 3300047470 | Ga0495681_0000119 | Ga0495681_0000119_49434_50225 | 261 |
| 99 | 3300047470 | Ga0495681_0001926 | Ga0495681_0001926_7869_8654 | 261 |
| 100 | 3300048921 | Ga0496118_0138194 | Ga0496118_0138194_157_966 | 261 |
| 101 | 3300048924 | Ga0496121_0000079 | Ga0496121_0000079_154019_154828 | 261 |
| 102 | 3300048929 | Ga0496126_0020454 | Ga0496126_0020454_4730_5539 | 261 |
| 103 | 3300049581 | Ga0501047_0154811 | Ga0501047_0154811_16_810 | 261 |
| 104 | 3300049581 | Ga0501047_0171022 | Ga0501047_0171022_548_1339 | 261 |
| 105 | iso_pu_bacteria | 8033232454 | 8033234752 | 261 |
| 106 | 3300005545 | Ga0070695_100143817 | Ga0070695_1001438171 | 262 |
| 107 | 3300005546 | Ga0070696_100280893 | Ga0070696_1002808932 | 262 |
| 108 | 3300005615 | Ga0070702_100096882 | Ga0070702_1000968822 | 262 |
| 109 | 3300030744 | Ga0316181_1154916 | Ga0316181_11549161 | 262 |
| 110 | 3300031251 | Ga0265327_10000183 | Ga0265327_1000018349 | 262 |
| 111 | 3300044666 | Ga0466977_0002577 | Ga0466977_0002577_2346_3149 | 262 |
| 112 | 3300046524 | Ga0495648_0104613 | Ga0495648_0104613_540_1352 | 262 |
| 113 | 3300049578 | Ga0501042_0127342 | Ga0501042_0127342_533_1366 | 262 |
| 114 | 3300060353 | Ga0501082_0263207 | Ga0501082_0263207_521_1324 | 262 |
| 115 | iso_pu_bacteria | 2643221672 | 2644399575 | 262 |
| 116 | 3300005539 | Ga0068853_100011778 | Ga0068853_1000117782 | 263 |
| 117 | 3300005616 | Ga0068852_100056409 | Ga0068852_1000564093 | 263 |
| 118 | 3300005719 | Ga0068861_100499736 | Ga0068861_1004997362 | 263 |
| 119 | 3300005843 | Ga0068860_100443263 | Ga0068860_1004432632 | 263 |
| 120 | 3300005844 | Ga0068862_100066283 | Ga0068862_1000662834 | 263 |
| 121 | 3300009093 | Ga0105240_10005695 | Ga0105240_1000569512 | 263 |
| 122 | 3300009174 | Ga0105241_10354884 | Ga0105241_103548842 | 263 |
| 123 | 3300009545 | Ga0105237_10004401 | Ga0105237_100044019 | 263 |
| 124 | 3300009551 | Ga0105238_10024207 | Ga0105238_100242079 | 263 |
| 125 | 3300010375 | Ga0105239_10023372 | Ga0105239_100233726 | 263 |
| 126 | 3300012513 | Ga0157326_1000567 | Ga0157326_10005673 | 263 |
| 127 | 3300025913 | Ga0207695_10020874 | Ga0207695_1002087413 | 263 |
| 128 | 3300025914 | Ga0207671_10013120 | Ga0207671_100131204 | 263 |
| 129 | 3300025924 | Ga0207694_10096699 | Ga0207694_100966991 | 263 |
| 130 | 3300026041 | Ga0207639_10028442 | Ga0207639_100284424 | 263 |
| 131 | 3300026118 | Ga0207675_100161192 | Ga0207675_1001611922 | 263 |
| 132 | 3300026142 | Ga0207698_10074131 | Ga0207698_100741314 | 263 |
| 133 | 3300031616 | Ga0307508_10451461 | Ga0307508_104514611 | 263 |
| 134 | 3300037471 | Ga0395905_0001060 | Ga0395905_0001060_5008_5817 | 263 |
| 135 | 3300046507 | Ga0495606_0035563 | Ga0495606_0035563_175_972 | 263 |
| 136 | 3300046810 | Ga0495660_0000859 | Ga0495660_0000859_7883_8680 | 263 |
| 137 | 3300047472 | Ga0495686_0055555 | Ga0495686_0055555_1314_2111 | 263 |
| 138 | 3300050489 | nmdc:mga03683_142_c1 | nmdc:mga03683_142_c1_2769_3569 | 263 |
| 139 | 3300050492 | nmdc:mga0yw44_231954_c1 | nmdc:mga0yw44_231954_c1_219_1019 | 263 |
| 140 | 3300050516 | nmdc:mga0sz30_15912_c1 | nmdc:mga0sz30_15912_c1_107_907 | 263 |
| 141 | iso_pu_bacteria | 2513020051 | 2513228845 | 263 |
| 142 | 3300003791 | Ga0055530_10012816 | Ga0055530_100128164 | 264 |
| 143 | 3300003792 | Ga0055540_1000374 | Ga0055540_100037424 | 264 |
| 144 | 3300003794 | Ga0055531_10000475 | Ga0055531_1000047521 | 264 |
| 145 | 3300003794 | Ga0055531_10000798 | Ga0055531_1000079823 | 264 |
| 146 | 3300006847 | Ga0075431_100010824 | Ga0075431_1000108243 | 264 |
| 147 | 3300014497 | Ga0182008_10000041 | Ga0182008_1000004143 | 264 |
| 148 | 3300025292 | Ga0209676_1000779 | Ga0209676_100077921 | 264 |
| 149 | 3300025298 | Ga0209050_1000412 | Ga0209050_100041267 | 264 |
| 150 | 3300025303 | Ga0209051_1000150 | Ga0209051_100015076 | 264 |
| 151 | 3300025304 | Ga0209257_1000275 | Ga0209257_100027586 | 264 |
| 152 | 3300026118 | Ga0207675_100165538 | Ga0207675_1001655383 | 264 |
| 153 | 3300028794 | Ga0307515_10003427 | Ga0307515_1000342727 | 264 |
| 154 | 3300028794 | Ga0307515_10003461 | Ga0307515_1000346123 | 264 |
| 155 | 3300031456 | Ga0307513_10000034 | Ga0307513_1000003482 | 264 |
| 156 | 3300031456 | Ga0307513_10400613 | Ga0307513_104006132 | 264 |
| 157 | 3300031507 | Ga0307509_10001929 | Ga0307509_1000192914 | 264 |
| 158 | 3300031616 | Ga0307508_10002660 | Ga0307508_1000266011 | 264 |
| 159 | 3300031649 | Ga0307514_10003744 | Ga0307514_1000374414 | 264 |
| 160 | 3300031852 | Ga0307410_10213184 | Ga0307410_102131842 | 264 |
| 161 | 3300031911 | Ga0307412_10383910 | Ga0307412_103839102 | 264 |
| 162 | 3300031995 | Ga0307409_100069435 | Ga0307409_1000694351 | 264 |
| 163 | 3300033179 | Ga0307507_10019308 | Ga0307507_100193083 | 264 |
| 164 | 3300042004 | Ga0439445_0082135 | Ga0439445_0082135_14_820 | 264 |
| 165 | 3300046454 | Ga0495592_0137993 | Ga0495592_0137993_496_1302 | 264 |
| 166 | 3300048905 | Ga0496102_0000100 | Ga0496102_0000100_28821_29630 | 264 |
| 167 | 3300048906 | Ga0496103_0000070 | Ga0496103_0000070_28802_29611 | 264 |
| 168 | 3300048908 | Ga0496105_0208180 | Ga0496105_0208180_285_1094 | 264 |
| 169 | 3300048919 | Ga0496116_0000527 | Ga0496116_0000527_21985_22794 | 264 |
| 170 | 3300048920 | Ga0496117_0000194 | Ga0496117_0000194_28821_29630 | 264 |
| 171 | 3300048921 | Ga0496118_0000146 | Ga0496118_0000146_28821_29630 | 264 |
| 172 | 3300048922 | Ga0496119_0019292 | Ga0496119_0019292_2406_3215 | 264 |
| 173 | 3300048923 | Ga0496120_0021251 | Ga0496120_0021251_737_1546 | 264 |
| 174 | 3300048925 | Ga0496122_0178489 | Ga0496122_0178489_140_943 | 264 |
| 175 | 3300048927 | Ga0496124_0000185 | Ga0496124_0000185_93902_94711 | 264 |
| 176 | 3300049569 | Ga0501032_0074374 | Ga0501032_0074374_574_1395 | 264 |
| 177 | 3300049571 | Ga0501034_0005968 | Ga0501034_0005968_3940_4761 | 264 |
| 178 | 3300049574 | Ga0501038_0268150 | Ga0501038_0268150_170_991 | 264 |
| 179 | 3300049822 | Ga0501035_0233534 | Ga0501035_0233534_747_1550 | 264 |
| 180 | 3300050510 | nmdc:mga06r32_16305_c1 | nmdc:mga06r32_16305_c1_1088_1891 | 264 |
| 181 | iso_pu_bacteria | 2599185316 | 2600022989 | 264 |
| 182 | iso_pu_bacteria | 2599185325 | 2600076357 | 264 |
| 183 | iso_pu_bacteria | 2738543011 | 2739236133 | 264 |
| 184 | iso_pu_bacteria | 2889300758 | 2889304501 | 264 |
| 185 | iso_pu_bacteria | 2939631187 | 2939633290 | 264 |
| 186 | iso_pu_bacteria | 2939743619 | 2939745101 | 264 |
| 187 | 3300006177 | Ga0075362_10114706 | Ga0075362_101147062 | 265 |
| 188 | 3300006353 | Ga0075370_10036649 | Ga0075370_100366493 | 265 |
| 189 | 3300013100 | Ga0157373_10000323 | Ga0157373_100003232 | 265 |
| 190 | 3300032002 | Ga0307416_100186033 | Ga0307416_1001860332 | 265 |
| 191 | 3300041404 | Ga0439436_0026861 | Ga0439436_0026861_566_1381 | 265 |
| 192 | 3300041413 | Ga0439465_0041098 | Ga0439465_0041098_248_1063 | 265 |
| 193 | 3300042004 | Ga0439445_0006499 | Ga0439445_0006499_762_1577 | 265 |
| 194 | 3300042006 | Ga0439432_001861 | Ga0439432_001861_6717_7532 | 265 |
| 195 | 3300042006 | Ga0439432_006592 | Ga0439432_006592_1298_2113 | 265 |
| 196 | 3300042006 | Ga0439432_034016 | Ga0439432_034016_233_1048 | 265 |
| 197 | 3300042007 | Ga0439449_0011342 | Ga0439449_0011342_1635_2450 | 265 |
| 198 | 3300042007 | Ga0439449_0019605 | Ga0439449_0019605_292_1104 | 265 |
| 199 | 3300042007 | Ga0439449_0038052 | Ga0439449_0038052_904_1719 | 265 |
| 200 | 3300042014 | Ga0439457_006304 | Ga0439457_006304_645_1457 | 265 |
| 201 | 3300042014 | Ga0439457_015363 | Ga0439457_015363_747_1562 | 265 |
| 202 | 3300042015 | Ga0439462_0006133 | Ga0439462_0006133_1511_2323 | 265 |
| 203 | 3300042145 | Ga0450906_005411 | Ga0450906_005411_1119_1934 | 265 |
| 204 | 3300042147 | Ga0450910_020843 | Ga0450910_020843_111_926 | 265 |
| 205 | 3300042185 | Ga0450909_007759 | Ga0450909_007759_76_888 | 265 |
| 206 | 3300042185 | Ga0450909_009495 | Ga0450909_009495_231_1046 | 265 |
| 207 | 3300042531 | Ga0450918_006985 | Ga0450918_006985_113_928 | 265 |
| 208 | 3300050493 | nmdc:mga0k408_29873_c1 | nmdc:mga0k408_29873_c1_895_1710 | 265 |
| 209 | 3300050494 | nmdc:mga06z11_19060_c1 | nmdc:mga06z11_19060_c1_1044_1859 | 265 |
| 210 | 3300050496 | nmdc:mga07m45_22998_c1 | nmdc:mga07m45_22998_c1_1578_2393 | 265 |
| 211 | iso_pu_bacteria | 2565956761 | 2566997102 | 265 |
| 212 | iso_pu_bacteria | 2904535858 | 2904536692 | 265 |
| 213 | 3300037471 | Ga0395905_0020836 | Ga0395905_0020836_3837_4703 | 266 |
| 214 | 3300048911 | Ga0496108_0022939 | Ga0496108_0022939_3984_4811 | 267 |
| 215 | 3300053161 | Ga0500634_0042104 | Ga0500634_0042104_978_1796 | 267 |
| 216 | iso_pu_bacteria | 2599185178 | 2599445195 | 267 |
| 217 | iso_pu_bacteria | 2643221561 | 2643824627 | 267 |
| 218 | iso_pu_bacteria | 2643221696 | 2644535879 | 267 |
| 219 | iso_pu_bacteria | 2744054900 | 2746086212 | 267 |
| 220 | iso_pu_bacteria | 2744054901 | 2746096184 | 267 |
| 221 | iso_pu_bacteria | 2791355137 | 2792838278 | 267 |
| 222 | iso_pu_bacteria | 2842324504 | 2842327847 | 267 |
| 223 | iso_pu_bacteria | 2842348783 | 2842351545 | 267 |
| 224 | iso_pu_bacteria | 2842454564 | 2842460533 | 267 |
| 225 | 3300005354 | Ga0070675_100014108 | Ga0070675_1000141086 | 268 |
| 226 | 3300005355 | Ga0070671_100140469 | Ga0070671_1001404693 | 268 |
| 227 | 3300025925 | Ga0207650_10062094 | Ga0207650_100620942 | 268 |
| 228 | 3300025926 | Ga0207659_10151644 | Ga0207659_101516442 | 268 |
| 229 | 3300025931 | Ga0207644_10115374 | Ga0207644_101153742 | 268 |
| 230 | 3300046492 | Ga0495585_0000684 | Ga0495585_0000684_24423_25235 | 268 |
| 231 | 3300046810 | Ga0495660_0001435 | Ga0495660_0001435_2755_3567 | 268 |
| 232 | 3300047318 | Ga0495636_0053671 | Ga0495636_0053671_119_967 | 268 |
| 233 | 3300047447 | Ga0495685_014526 | Ga0495685_014526_430_1278 | 268 |
| 234 | 3300047470 | Ga0495681_0064384 | Ga0495681_0064384_762_1574 | 268 |
| 235 | 3300049571 | Ga0501034_0000199 | Ga0501034_0000199_104795_105619 | 268 |
| 236 | 3300049582 | Ga0501048_0291874 | Ga0501048_0291874_216_1049 | 268 |
| 237 | 3300053125 | Ga0500618_002466 | Ga0500618_002466_1894_2745 | 268 |
| 238 | 3300003758 | Ga0055532_1000041 | Ga0055532_100004175 | 269 |
| 239 | 3300003760 | Ga0055527_1000413 | Ga0055527_10004133 | 269 |
| 240 | 3300003761 | Ga0055535_1000030 | Ga0055535_1000030102 | 269 |
| 241 | 3300003763 | Ga0055529_1000058 | Ga0055529_100005875 | 269 |
| 242 | 3300003841 | Ga0055541_1000210 | Ga0055541_10002109 | 269 |
| 243 | 3300005578 | Ga0068854_100000025 | Ga0068854_10000002578 | 269 |
| 244 | 3300009093 | Ga0105240_10002768 | Ga0105240_1000276820 | 269 |
| 245 | 3300013100 | Ga0157373_10053744 | Ga0157373_100537442 | 269 |
| 246 | 3300013105 | Ga0157369_10000809 | Ga0157369_1000080919 | 269 |
| 247 | 3300015261 | Ga0182006_1001495 | Ga0182006_10014956 | 269 |
| 248 | 3300020610 | Ga0154015_1576712 | Ga0154015_15767122 | 269 |
| 249 | 3300025225 | Ga0209566_100536 | Ga0209566_1005369 | 269 |
| 250 | 3300025226 | Ga0209674_100361 | Ga0209674_10036111 | 269 |
| 251 | 3300025228 | Ga0209672_100247 | Ga0209672_10024721 | 269 |
| 252 | 3300025229 | Ga0209147_100008 | Ga0209147_100008646 | 269 |
| 253 | 3300025230 | Ga0209563_112777 | Ga0209563_1127772 | 269 |
| 254 | 3300025242 | Ga0209258_100013 | Ga0209258_100013646 | 269 |
| 255 | 3300025256 | Ga0209759_1000492 | Ga0209759_100049219 | 269 |
| 256 | 3300025272 | Ga0209455_1000106 | Ga0209455_100010677 | 269 |
| 257 | 3300025913 | Ga0207695_10000535 | Ga0207695_1000053552 | 269 |
| 258 | 3300025981 | Ga0207640_10000096 | Ga0207640_1000009642 | 269 |
| 259 | 3300031548 | Ga0307408_100012528 | Ga0307408_1000125285 | 269 |
| 260 | 3300031911 | Ga0307412_10009292 | Ga0307412_100092922 | 269 |
| 261 | 3300032002 | Ga0307416_100119433 | Ga0307416_1001194332 | 269 |
| 262 | 3300037312 | Ga0395899_0000035 | Ga0395899_0000035_68381_69202 | 269 |
| 263 | 3300037418 | Ga0395900_0000113 | Ga0395900_0000113_68381_69202 | 269 |
| 264 | 3300037418 | Ga0395900_0001052 | Ga0395900_0001052_12213_13034 | 269 |
| 265 | 3300037466 | Ga0395898_0000444 | Ga0395898_0000444_65205_66026 | 269 |
| 266 | 3300044693 | Ga0466961_0000852 | Ga0466961_0000852_2723_3544 | 269 |
| 267 | 3300044694 | Ga0466963_0075465 | Ga0466963_0075465_248_1069 | 269 |
| 268 | 3300044719 | Ga0466971_0113707 | Ga0466971_0113707_166_987 | 269 |
| 269 | 3300045836 | Ga0466958_0022274 | Ga0466958_0022274_207_1028 | 269 |
| 270 | 3300048925 | Ga0496122_0027018 | Ga0496122_0027018_1124_1960 | 270 |
| 271 | 3300048926 | Ga0496123_0037303 | Ga0496123_0037303_871_1707 | 270 |
| 272 | 3300003187 | JGI25151J46595_10000789 | JGI25151J46595_100007898 | 276 |
| 273 | 3300003771 | Ga0055526_1009689 | Ga0055526_10096894 | 276 |
| 274 | 3300003775 | Ga0055524_1000445 | Ga0055524_100044529 | 276 |
| 275 | 3300003784 | Ga0055534_1000378 | Ga0055534_100037820 | 276 |
| 276 | 3300025263 | Ga0209565_1000201 | Ga0209565_100020111 | 276 |
| 277 | 3300025291 | Ga0209675_1000560 | Ga0209675_10005608 | 276 |
| 278 | 3300025291 | Ga0209675_1011001 | Ga0209675_10110012 | 276 |
| 279 | 3300025294 | Ga0209025_1001002 | Ga0209025_100100234 | 276 |
| 280 | 3300025295 | Ga0209564_1000578 | Ga0209564_100057852 | 276 |
| 281 | 3300025297 | Ga0209758_1017733 | Ga0209758_10177332 | 276 |
| 282 | 3300025299 | Ga0209256_1001799 | Ga0209256_100179915 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wqt-assembly1.cif.gz_A | dodecahedral assembly of mhpd | 0.9811 | 7 | 270 |
| 2wqt-assembly1.cif.gz_A | dodecahedral assembly of mhpd | 0.9552 | 7 | 270 |
| 5d2k-assembly2.cif.gz_B | 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate | 0.9375 | 7 | 268 |
| 5d2i-assembly2.cif.gz_B | 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate | 0.9283 | 7 | 268 |
| 2eb5-assembly1.cif.gz_A | crystal structure of hpcg complexed with oxalate | 0.9273 | 1 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wqtB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9791 | 7 | 270 | 3.90.850.10 |
| af_I6XHH5_1_260_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9646 | 1 | 268 | 3.90.850.10 |
| af_I6XHH5_1_260_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9537 | 1 | 268 | 3.90.850.10 |
| 2wqtB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9533 | 7 | 270 | 3.90.850.10 |
| 5d2kB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9375 | 7 | 268 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356HBZ7-F1-model_v4 | deleted | 1 | 110 | 251 |
|
| AF-A0A3C0VKX9-F1-model_v4 | 2-keto-4-pentenoate hydratase | 0.9914 | 97 | 269 |
GO:0005737
GO:0008684 |
| AF-F0FXD2-F1-model_v4 | 4-oxalocrotonate decarboxylase | 0.9904 | 140 | 269 |
GO:0005737
GO:0008684 GO:0019628 GO:0050385 |
| AF-A0A2V1H065-F1-model_v4 | deleted | 0.9872 | 178 | 271 |
|
| AF-A0A2V2T535-F1-model_v4 | 2-keto-4-pentenoate hydratase | 0.9855 | 156 | 271 |
GO:0005737
GO:0008684 GO:0009056 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar