F384813

General Info

Members Datasets Scaffolds Average Seq Length
282 211 254 267

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100143817|Ga0070695_1001438171
Length 316
Sequence MSKKKVNKPTPSRPPVRALRLTRPLSTLPLRPLIGPAQGRLRPKPKTAGAPKLKSVVSDAVRNAAAAIRSAYENQKPIPPIRDMLPPNDIAAAYAVQQANTNHWIGQGRRPVGRKIGLTAKAVQAQLGVDQPDYGILYADMEIPDSEEIPTARVMQPRAEAEVALVLKKDLLLEQLTLIDLLDATAYALPAIEVVGSRIAKWDIKIVDTVADNASSGLFVLGTRPVPLDQLDLRNCGMVLEKRGDQVSVGAGVACLSNPLNAALWLARKMVTVGMPLRAGNVILTGALGPMVPVAPGDVLEARISGLGSVRAVFAA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
5 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
6 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
7 2643221561 Nocardioides sp. Root151 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221696 Nocardioides sp. Root140 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
12 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
13 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
14 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
15 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
16 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
17 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
18 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
19 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
20 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
21 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
22 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
23 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
24 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
25 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
26 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
27 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
136 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
137 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
141 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.72
Metatranscriptomes 0.35
Isolates 9.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.02
Nodule 1.77
Rhizoplane 4.61
Rhizosphere 58.51
Stem 0
Stem Tuber 0
Unclassified 18.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000789 3300003187 Bacteria 25548
2 Ga0055532_1000041 3300003758 Bacteria 195749
3 Ga0055527_1000413 3300003760 Bacteria 17652
4 Ga0055535_1000030 3300003761 Bacteria 195749
5 Ga0055529_1000058 3300003763 Bacteria 195735
6 Ga0055526_1009689 3300003771 Bacteria 4594
7 Ga0055524_1000445 3300003775 Bacteria 34252
8 Ga0055534_1000378 3300003784 Bacteria 27872
9 Ga0055530_10012816 3300003791 Bacteria 2901
10 Ga0055540_1000374 3300003792 Bacteria 37462
11 Ga0055531_10000475 3300003794 Bacteria 37156
12 Ga0055531_10000798 3300003794 Bacteria 26114
13 Ga0055541_1000210 3300003841 Bacteria 24663
14 Ga0070670_100048577 3300005331 Bacteria 3651
15 Ga0070680_100418398 3300005336 Bacteria 1143
16 Ga0070675_100014108 3300005354 Bacteria 6296
17 Ga0070671_100140469 3300005355 Bacteria 2038
18 Ga0070681_10138263 3300005458 Bacteria 2365
19 Ga0070698_100027218 3300005471 Bacteria 5948
20 Ga0070698_100044598 3300005471 Bacteria 4540
21 Ga0068853_100011778 3300005539 Bacteria 7108
22 Ga0070695_100143817 3300005545 Bacteria 1657
23 Ga0070696_100280893 3300005546 Bacteria 1269
24 Ga0070665_100110310 3300005548 Bacteria 2754
25 Ga0068854_100000025 3300005578 Bacteria 123547
26 Ga0070702_100096882 3300005615 Bacteria 1801
27 Ga0068852_100002784 3300005616 Bacteria 12111
28 Ga0068852_100056409 3300005616 Bacteria 3395
29 Ga0068859_100328272 3300005617 Bacteria 1624
30 Ga0068861_100499736 3300005719 Bacteria 1099
31 Ga0068860_100443263 3300005843 Bacteria 1290
32 Ga0068862_100066283 3300005844 Bacteria 3111
33 Ga0081455_10054642 3300005937 Bacteria 3402
34 Ga0081539_10025000 3300005985 Bacteria 3858
35 Ga0075362_10114706 3300006177 Bacteria 1271
36 Ga0075370_10036649 3300006353 Bacteria 2755
37 Ga0075370_10061494 3300006353 Bacteria 2139
38 Ga0075428_100038862 3300006844 Bacteria 5237
39 Ga0075428_100069620 3300006844 Bacteria 3846
40 Ga0075431_100010824 3300006847 Bacteria 9173
41 Ga0075431_100017129 3300006847 Bacteria 7366
42 Ga0097620_100328261 3300006931 Bacteria 1624
43 Ga0105240_10002768 3300009093 Bacteria 27702
44 Ga0105240_10005695 3300009093 Bacteria 18492
45 Ga0105240_10036751 3300009093 Bacteria 6297
46 Ga0105240_10071331 3300009093 Bacteria 4297
47 Ga0105240_10083018 3300009093 Bacteria 3933
48 Ga0105243_10003676 3300009148 Bacteria 12326
49 Ga0105241_10354884 3300009174 Bacteria 1274
50 Ga0105237_10000874 3300009545 Bacteria 40867
51 Ga0105237_10004401 3300009545 Bacteria 16334
52 Ga0105238_10011534 3300009551 Bacteria 8903
53 Ga0105238_10024207 3300009551 Bacteria 6190
54 Ga0105238_10130608 3300009551 Bacteria 2490
55 Ga0105239_10000113 3300010375 Bacteria 114562
56 Ga0105239_10023372 3300010375 Bacteria 6807
57 Ga0157326_1000567 3300012513 Bacteria 4371
58 Ga0157373_10000323 3300013100 Bacteria 38659
59 Ga0157373_10053744 3300013100 Bacteria 2864
60 Ga0157369_10000809 3300013105 Bacteria 39990
61 Ga0157380_10005038 3300014326 Bacteria 9213
62 Ga0182008_10000041 3300014497 Bacteria 118254
63 Ga0182006_1001495 3300015261 Bacteria 14025
64 Ga0154015_1576712 3300020610 Bacteria 11322
65 Ga0213872_10021881 3300021361 Bacteria 2944
66 Ga0209566_100536 3300025225 Bacteria 25712
67 Ga0209674_100361 3300025226 Bacteria 25761
68 Ga0209672_100247 3300025228 Bacteria 40787
69 Ga0209147_100008 3300025229 Bacteria 777096
70 Ga0209563_112777 3300025230 Bacteria 1134
71 Ga0209258_100013 3300025242 Bacteria 777096
72 Ga0209759_1000492 3300025256 Bacteria 43562
73 Ga0209565_1000201 3300025263 Bacteria 71408
74 Ga0209455_1000106 3300025272 Bacteria 195801
75 Ga0209675_1000560 3300025291 Bacteria 26860
76 Ga0209675_1011001 3300025291 Bacteria 3037
77 Ga0209676_1000779 3300025292 Bacteria 42577
78 Ga0209025_1000341 3300025294 Bacteria 102793
79 Ga0209025_1001002 3300025294 Bacteria 41890
80 Ga0209564_1000578 3300025295 Bacteria 58027
81 Ga0209758_1017733 3300025297 Bacteria 3525
82 Ga0209050_1000412 3300025298 Bacteria 79647
83 Ga0209256_1001799 3300025299 Bacteria 20207
84 Ga0209051_1000150 3300025303 Bacteria 132005
85 Ga0209257_1000275 3300025304 Bacteria 116952
86 Ga0207707_10047295 3300025912 Bacteria 3747
87 Ga0207695_10000535 3300025913 Bacteria 79187
88 Ga0207695_10008333 3300025913 Bacteria 12989
89 Ga0207695_10020874 3300025913 Bacteria 7485
90 Ga0207695_10084748 3300025913 Bacteria 3199
91 Ga0207695_10121474 3300025913 Bacteria 2579
92 Ga0207695_10142545 3300025913 Bacteria 2343
93 Ga0207671_10000759 3300025914 Bacteria 40972
94 Ga0207671_10013120 3300025914 Bacteria 6619
95 Ga0207694_10050639 3300025924 Bacteria 3217
96 Ga0207694_10083104 3300025924 Bacteria 2518
97 Ga0207694_10096699 3300025924 Bacteria 2336
98 Ga0207650_10030114 3300025925 Bacteria 3907
99 Ga0207650_10062094 3300025925 Bacteria 2791
100 Ga0207659_10151644 3300025926 Bacteria 1810
101 Ga0207644_10115374 3300025931 Bacteria 2037
102 Ga0207640_10000096 3300025981 Bacteria 68105
103 Ga0207658_10056069 3300025986 Bacteria 2923
104 Ga0207639_10028442 3300026041 Bacteria 4082
105 Ga0207675_100161192 3300026118 Bacteria 2139
106 Ga0207675_100165538 3300026118 Bacteria 2111
107 Ga0207698_10008121 3300026142 Bacteria 6616
108 Ga0207698_10074131 3300026142 Bacteria 2713
109 Ga0268266_10505817 3300028379 Bacteria 1154
110 Ga0307515_10003427 3300028794 Bacteria 33380
111 Ga0307515_10003461 3300028794 Bacteria 33183
112 Ga0307515_10083802 3300028794 Bacteria 4105
113 Ga0316181_1154916 3300030744 Bacteria 3410
114 Ga0265327_10000183 3300031251 Bacteria 133191
115 Ga0307513_10000034 3300031456 Bacteria 185012
116 Ga0307513_10400613 3300031456 Bacteria 1107
117 Ga0307509_10001929 3300031507 Bacteria 34257
118 Ga0307408_100012528 3300031548 Bacteria 5621
119 Ga0307508_10002660 3300031616 Bacteria 18747
120 Ga0307508_10451461 3300031616 Bacteria 878
121 Ga0307514_10003744 3300031649 Bacteria 14345
122 Ga0307410_10213184 3300031852 Bacteria 1481
123 Ga0307412_10009292 3300031911 Bacteria 5637
124 Ga0307412_10383910 3300031911 Bacteria 1138
125 Ga0307409_100069435 3300031995 Bacteria 2792
126 Ga0307416_100119433 3300032002 Bacteria 2345
127 Ga0307416_100186033 3300032002 Bacteria 1952
128 Ga0307507_10019308 3300033179 Bacteria 7685
129 Ga0395899_0000035 3300037312 Bacteria 295584
130 Ga0395900_0000113 3300037418 Bacteria 139979
131 Ga0395900_0001052 3300037418 Bacteria 35361
132 Ga0395898_0000444 3300037466 Bacteria 85520
133 Ga0395905_0001060 3300037471 Bacteria 34743
134 Ga0395905_0020836 3300037471 Bacteria 6209
135 Ga0395905_0116348 3300037471 Bacteria 2513
136 Ga0400483_182915 3300039062 Bacteria 2307
137 Ga0436361_0108407 3300039447 Bacteria 32994
138 Ga0439436_0026861 3300041404 Bacteria 1685
139 Ga0439465_0041098 3300041413 Bacteria 1496
140 Ga0439445_0006499 3300042004 Bacteria 2689
141 Ga0439445_0082135 3300042004 Bacteria 901
142 Ga0439432_001861 3300042006 Bacteria 7925
143 Ga0439432_006592 3300042006 Bacteria 4137
144 Ga0439432_034016 3300042006 Bacteria 1638
145 Ga0439449_0011342 3300042007 Bacteria 3353
146 Ga0439449_0019605 3300042007 Bacteria 2536
147 Ga0439449_0038052 3300042007 Bacteria 1789
148 Ga0439457_006304 3300042014 Bacteria 2913
149 Ga0439457_015363 3300042014 Bacteria 1710
150 Ga0439462_0006133 3300042015 Bacteria 2979
151 Ga0450906_005411 3300042145 Bacteria 2626
152 Ga0450910_020843 3300042147 Bacteria 990
153 Ga0450909_007759 3300042185 Bacteria 1555
154 Ga0450909_009495 3300042185 Bacteria 1421
155 Ga0439464_0000586 3300042439 Bacteria 7637
156 Ga0439460_0014176 3300042461 Bacteria 2093
157 Ga0450918_006985 3300042531 Bacteria 2007
158 Ga0466977_0002577 3300044666 Bacteria 8363
159 Ga0466961_0000852 3300044693 Bacteria 19075
160 Ga0466963_0075465 3300044694 Bacteria 2275
161 Ga0466971_0113707 3300044719 Bacteria 1250
162 Ga0451576_0000619 3300045051 Bacteria 74347
163 Ga0466958_0022274 3300045836 Bacteria 3709
164 Ga0495627_000685 3300046453 Bacteria 25974
165 Ga0495592_0137993 3300046454 Bacteria 1699
166 Ga0495590_0015682 3300046457 Bacteria 2745
167 Ga0495638_0251439 3300046460 Bacteria 974
168 Ga0495650_0001499 3300046471 Bacteria 22259
169 Ga0495650_0005400 3300046471 Bacteria 8308
170 Ga0495650_0009691 3300046471 Bacteria 5458
171 Ga0495650_0015434 3300046471 Bacteria 3919
172 Ga0495585_0000684 3300046492 Bacteria 30886
173 Ga0495606_0035563 3300046507 Bacteria 3403
174 Ga0495637_0102335 3300046520 Bacteria 1118
175 Ga0495648_0104613 3300046524 Bacteria 1554
176 Ga0495642_0000054 3300046528 Bacteria 69311
177 Ga0495656_0178014 3300046615 Bacteria 1044
178 Ga0495625_0002204 3300046660 Bacteria 21561
179 Ga0495671_0000680 3300046692 Bacteria 24547
180 Ga0495660_0000859 3300046810 Bacteria 22422
181 Ga0495660_0001435 3300046810 Bacteria 16331
182 Ga0495636_0053671 3300047318 Bacteria 1692
183 Ga0495672_0000202 3300047320 Bacteria 85107
184 Ga0495672_0234790 3300047320 Bacteria 898
185 Ga0495685_014526 3300047447 Bacteria 2676
186 Ga0495673_0000215 3300047469 Bacteria 86087
187 Ga0495681_0000119 3300047470 Bacteria 69357
188 Ga0495681_0001926 3300047470 Bacteria 15213
189 Ga0495681_0064384 3300047470 Bacteria 1679
190 Ga0495686_0055555 3300047472 Bacteria 2475
191 Ga0496100_0523554 3300048903 Bacteria 915
192 Ga0496102_0000100 3300048905 Bacteria 123531
193 Ga0496102_0000806 3300048905 Bacteria 30478
194 Ga0496103_0000070 3300048906 Bacteria 121077
195 Ga0496103_0035778 3300048906 Bacteria 3040
196 Ga0496103_0104627 3300048906 Bacteria 1794
197 Ga0496105_0208180 3300048908 Bacteria 1595
198 Ga0496107_0305472 3300048910 Bacteria 1184
199 Ga0496108_0022939 3300048911 Bacteria 5136
200 Ga0496114_0085805 3300048917 Bacteria 2667
201 Ga0496116_0000527 3300048919 Bacteria 51590
202 Ga0496116_0019128 3300048919 Bacteria 5252
203 Ga0496117_0000024 3300048920 Bacteria 418750
204 Ga0496117_0000194 3300048920 Bacteria 123531
205 Ga0496118_0000014 3300048921 Bacteria 561628
206 Ga0496118_0000146 3300048921 Bacteria 123531
207 Ga0496118_0091036 3300048921 Bacteria 2099
208 Ga0496118_0138194 3300048921 Bacteria 1550
209 Ga0496119_0019292 3300048922 Bacteria 5029
210 Ga0496120_0018448 3300048923 Bacteria 4496
211 Ga0496120_0021251 3300048923 Bacteria 4104
212 Ga0496121_0000079 3300048924 Bacteria 232653
213 Ga0496121_0023425 3300048924 Bacteria 5946
214 Ga0496122_0000249 3300048925 Bacteria 121066
215 Ga0496122_0027018 3300048925 Bacteria 4924
216 Ga0496122_0178489 3300048925 Bacteria 1270
217 Ga0496123_0008112 3300048926 Bacteria 9708
218 Ga0496123_0037303 3300048926 Bacteria 3433
219 Ga0496124_0000185 3300048927 Bacteria 123531
220 Ga0496124_0204019 3300048927 Bacteria 1501
221 Ga0496125_0006330 3300048928 Bacteria 12846
222 Ga0496125_0008770 3300048928 Bacteria 10515
223 Ga0496125_0068152 3300048928 Bacteria 2800
224 Ga0496126_0020454 3300048929 Bacteria 6486
225 Ga0496126_0044510 3300048929 Bacteria 4086
226 Ga0495682_0000039 3300049460 Bacteria 119714
227 Ga0501032_0074374 3300049569 Bacteria 2264
228 Ga0501034_0000199 3300049571 Bacteria 113624
229 Ga0501034_0005968 3300049571 Bacteria 13182
230 Ga0501038_0268150 3300049574 Bacteria 1347
231 Ga0501042_0127342 3300049578 Bacteria 1834
232 Ga0501047_0154811 3300049581 Bacteria 2166
233 Ga0501047_0171022 3300049581 Bacteria 2042
234 Ga0501048_0291874 3300049582 Bacteria 1160
235 Ga0501067_0251321 3300049583 Bacteria 984
236 Ga0501071_0294276 3300049587 Bacteria 1230
237 Ga0501075_0541525 3300049591 Bacteria 888
238 Ga0501076_0240019 3300049592 Bacteria 1483
239 Ga0501035_0233534 3300049822 Bacteria 1567
240 nmdc:mga03683_142_c1 3300050489 Bacteria 24361
241 nmdc:mga00v17_262556_c1 3300050491 Bacteria 1120
242 nmdc:mga0yw44_231954_c1 3300050492 Bacteria 1225
243 nmdc:mga0k408_29873_c1 3300050493 Bacteria 3105
244 nmdc:mga06z11_19060_c1 3300050494 Bacteria 3146
245 nmdc:mga07m45_22998_c1 3300050496 Bacteria 3405
246 nmdc:mga07m45_24027_c1 3300050496 Bacteria 3335
247 nmdc:mga06r32_16305_c1 3300050510 Bacteria 6767
248 nmdc:mga0sz30_15912_c1 3300050516 Bacteria 2977
249 Ga0500562_003379 3300053108 Bacteria 3992
250 Ga0500618_002466 3300053125 Bacteria 6963
251 Ga0500568_0083023 3300053139 Bacteria 1215
252 Ga0500616_0000027 3300053153 Bacteria 441053
253 Ga0500634_0042104 3300053161 Bacteria 2478
254 Ga0501082_0263207 3300060353 Bacteria 1500

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0541525 Ga0501075_0541525_162_872 233
2 3300050491 nmdc:mga00v17_262556_c1 nmdc:mga00v17_262556_c1_310_1035 233
3 3300049583 Ga0501067_0251321 Ga0501067_0251321_255_959 234
4 3300025986 Ga0207658_10056069 Ga0207658_100560692 240
5 3300053139 Ga0500568_0083023 Ga0500568_0083023_162_887 241
6 3300009148 Ga0105243_10003676 Ga0105243_1000367611 244
7 3300046615 Ga0495656_0178014 Ga0495656_0178014_41_865 245
8 3300048905 Ga0496102_0000806 Ga0496102_0000806_11657_12469 247
9 3300048906 Ga0496103_0035778 Ga0496103_0035778_723_1535 247
10 3300046471 Ga0495650_0015434 Ga0495650_0015434_1053_1883 252
11 3300005471 Ga0070698_100027218 Ga0070698_1000272181 255
12 3300006844 Ga0075428_100069620 Ga0075428_1000696205 255
13 3300006847 Ga0075431_100017129 Ga0075431_1000171296 255
14 iso_pu_bacteria 2513237151 2513962113 255
15 3300005336 Ga0070680_100418398 Ga0070680_1004183982 256
16 3300005458 Ga0070681_10138263 Ga0070681_101382632 256
17 3300025912 Ga0207707_10047295 Ga0207707_100472952 256
18 iso_pu_bacteria 2884811622 2884812784 256
19 iso_pu_bacteria 2884836552 2884839048 256
20 iso_pu_bacteria 2884852848 2884855339 256
21 iso_pu_bacteria 2896154374 2896159154 256
22 3300005471 Ga0070698_100044598 Ga0070698_1000445983 257
23 3300005937 Ga0081455_10054642 Ga0081455_100546423 257
24 3300053153 Ga0500616_0000027 Ga0500616_0000027_400055_400864 257
25 3300005331 Ga0070670_100048577 Ga0070670_1000485773 258
26 3300005616 Ga0068852_100002784 Ga0068852_1000027843 258
27 3300009093 Ga0105240_10036751 Ga0105240_100367515 258
28 3300009093 Ga0105240_10083018 Ga0105240_100830182 258
29 3300009551 Ga0105238_10011534 Ga0105238_100115343 258
30 3300025913 Ga0207695_10008333 Ga0207695_100083337 258
31 3300025913 Ga0207695_10142545 Ga0207695_101425453 258
32 3300025924 Ga0207694_10050639 Ga0207694_100506392 258
33 3300025925 Ga0207650_10030114 Ga0207650_100301143 258
34 3300026142 Ga0207698_10008121 Ga0207698_100081214 258
35 3300039062 Ga0400483_182915 Ga0400483_182915_261_1043 258
36 3300046660 Ga0495625_0002204 Ga0495625_0002204_16848_17630 258
37 3300048919 Ga0496116_0019128 Ga0496116_0019128_2395_3177 258
38 3300048921 Ga0496118_0091036 Ga0496118_0091036_689_1471 258
39 3300048924 Ga0496121_0023425 Ga0496121_0023425_4477_5259 258
40 3300048925 Ga0496122_0000249 Ga0496122_0000249_29321_30103 258
41 3300048926 Ga0496123_0008112 Ga0496123_0008112_4071_4853 258
42 3300048927 Ga0496124_0204019 Ga0496124_0204019_280_1062 258
43 3300048928 Ga0496125_0006330 Ga0496125_0006330_8571_9353 258
44 3300006353 Ga0075370_10061494 Ga0075370_100614943 259
45 3300021361 Ga0213872_10021881 Ga0213872_100218813 259
46 3300039447 Ga0436361_0108407 Ga0436361_0108407_4396_5181 259
47 3300045051 Ga0451576_0000619 Ga0451576_0000619_4467_5255 259
48 3300046471 Ga0495650_0001499 Ga0495650_0001499_16037_16840 259
49 3300048928 Ga0496125_0008770 Ga0496125_0008770_4429_5256 259
50 3300049460 Ga0495682_0000039 Ga0495682_0000039_106662_107456 259
51 3300049592 Ga0501076_0240019 Ga0501076_0240019_79_864 259
52 3300050496 nmdc:mga07m45_24027_c1 nmdc:mga07m45_24027_c1_1307_2134 259
53 iso_pu_bacteria 2881101125 2881104885 259
54 iso_pu_bacteria 2895427314 2895429732 259
55 3300005548 Ga0070665_100110310 Ga0070665_1001103102 260
56 3300005617 Ga0068859_100328272 Ga0068859_1003282721 260
57 3300005985 Ga0081539_10025000 Ga0081539_100250003 260
58 3300006844 Ga0075428_100038862 Ga0075428_1000388622 260
59 3300006931 Ga0097620_100328261 Ga0097620_1003282611 260
60 3300014326 Ga0157380_10005038 Ga0157380_100050385 260
61 3300028379 Ga0268266_10505817 Ga0268266_105058172 260
62 3300037471 Ga0395905_0116348 Ga0395905_0116348_1035_1823 260
63 3300042439 Ga0439464_0000586 Ga0439464_0000586_4109_4906 260
64 3300042461 Ga0439460_0014176 Ga0439460_0014176_1179_1976 260
65 3300046457 Ga0495590_0015682 Ga0495590_0015682_241_1029 260
66 3300048903 Ga0496100_0523554 Ga0496100_0523554_92_874 260
67 3300048906 Ga0496103_0104627 Ga0496103_0104627_870_1652 260
68 3300048910 Ga0496107_0305472 Ga0496107_0305472_15_797 260
69 3300048917 Ga0496114_0085805 Ga0496114_0085805_1365_2147 260
70 3300048920 Ga0496117_0000024 Ga0496117_0000024_214646_215428 260
71 3300048921 Ga0496118_0000014 Ga0496118_0000014_203634_204416 260
72 3300048923 Ga0496120_0018448 Ga0496120_0018448_246_1028 260
73 3300048928 Ga0496125_0068152 Ga0496125_0068152_1522_2304 260
74 3300048929 Ga0496126_0044510 Ga0496126_0044510_948_1730 260
75 3300049587 Ga0501071_0294276 Ga0501071_0294276_409_1206 260
76 3300053108 Ga0500562_003379 Ga0500562_003379_1236_2021 260
77 iso_pu_bacteria 2744054611 2744957677 260
78 3300009093 Ga0105240_10071331 Ga0105240_100713311 261
79 3300009545 Ga0105237_10000874 Ga0105237_1000087413 261
80 3300009551 Ga0105238_10130608 Ga0105238_101306082 261
81 3300010375 Ga0105239_10000113 Ga0105239_1000011348 261
82 3300025294 Ga0209025_1000341 Ga0209025_100034162 261
83 3300025913 Ga0207695_10084748 Ga0207695_100847483 261
84 3300025913 Ga0207695_10121474 Ga0207695_101214741 261
85 3300025914 Ga0207671_10000759 Ga0207671_1000075934 261
86 3300025924 Ga0207694_10083104 Ga0207694_100831042 261
87 3300028794 Ga0307515_10083802 Ga0307515_100838024 261
88 3300046453 Ga0495627_000685 Ga0495627_000685_17352_18137 261
89 3300046460 Ga0495638_0251439 Ga0495638_0251439_48_839 261
90 3300046471 Ga0495650_0005400 Ga0495650_0005400_6045_6830 261
91 3300046471 Ga0495650_0009691 Ga0495650_0009691_4454_5239 261
92 3300046520 Ga0495637_0102335 Ga0495637_0102335_190_975 261
93 3300046528 Ga0495642_0000054 Ga0495642_0000054_19133_19924 261
94 3300046692 Ga0495671_0000680 Ga0495671_0000680_11607_12398 261
95 3300047320 Ga0495672_0000202 Ga0495672_0000202_19133_19924 261
96 3300047320 Ga0495672_0234790 Ga0495672_0234790_20_853 261
97 3300047469 Ga0495673_0000215 Ga0495673_0000215_19133_19924 261
98 3300047470 Ga0495681_0000119 Ga0495681_0000119_49434_50225 261
99 3300047470 Ga0495681_0001926 Ga0495681_0001926_7869_8654 261
100 3300048921 Ga0496118_0138194 Ga0496118_0138194_157_966 261
101 3300048924 Ga0496121_0000079 Ga0496121_0000079_154019_154828 261
102 3300048929 Ga0496126_0020454 Ga0496126_0020454_4730_5539 261
103 3300049581 Ga0501047_0154811 Ga0501047_0154811_16_810 261
104 3300049581 Ga0501047_0171022 Ga0501047_0171022_548_1339 261
105 iso_pu_bacteria 8033232454 8033234752 261
106 3300005545 Ga0070695_100143817 Ga0070695_1001438171 262
107 3300005546 Ga0070696_100280893 Ga0070696_1002808932 262
108 3300005615 Ga0070702_100096882 Ga0070702_1000968822 262
109 3300030744 Ga0316181_1154916 Ga0316181_11549161 262
110 3300031251 Ga0265327_10000183 Ga0265327_1000018349 262
111 3300044666 Ga0466977_0002577 Ga0466977_0002577_2346_3149 262
112 3300046524 Ga0495648_0104613 Ga0495648_0104613_540_1352 262
113 3300049578 Ga0501042_0127342 Ga0501042_0127342_533_1366 262
114 3300060353 Ga0501082_0263207 Ga0501082_0263207_521_1324 262
115 iso_pu_bacteria 2643221672 2644399575 262
116 3300005539 Ga0068853_100011778 Ga0068853_1000117782 263
117 3300005616 Ga0068852_100056409 Ga0068852_1000564093 263
118 3300005719 Ga0068861_100499736 Ga0068861_1004997362 263
119 3300005843 Ga0068860_100443263 Ga0068860_1004432632 263
120 3300005844 Ga0068862_100066283 Ga0068862_1000662834 263
121 3300009093 Ga0105240_10005695 Ga0105240_1000569512 263
122 3300009174 Ga0105241_10354884 Ga0105241_103548842 263
123 3300009545 Ga0105237_10004401 Ga0105237_100044019 263
124 3300009551 Ga0105238_10024207 Ga0105238_100242079 263
125 3300010375 Ga0105239_10023372 Ga0105239_100233726 263
126 3300012513 Ga0157326_1000567 Ga0157326_10005673 263
127 3300025913 Ga0207695_10020874 Ga0207695_1002087413 263
128 3300025914 Ga0207671_10013120 Ga0207671_100131204 263
129 3300025924 Ga0207694_10096699 Ga0207694_100966991 263
130 3300026041 Ga0207639_10028442 Ga0207639_100284424 263
131 3300026118 Ga0207675_100161192 Ga0207675_1001611922 263
132 3300026142 Ga0207698_10074131 Ga0207698_100741314 263
133 3300031616 Ga0307508_10451461 Ga0307508_104514611 263
134 3300037471 Ga0395905_0001060 Ga0395905_0001060_5008_5817 263
135 3300046507 Ga0495606_0035563 Ga0495606_0035563_175_972 263
136 3300046810 Ga0495660_0000859 Ga0495660_0000859_7883_8680 263
137 3300047472 Ga0495686_0055555 Ga0495686_0055555_1314_2111 263
138 3300050489 nmdc:mga03683_142_c1 nmdc:mga03683_142_c1_2769_3569 263
139 3300050492 nmdc:mga0yw44_231954_c1 nmdc:mga0yw44_231954_c1_219_1019 263
140 3300050516 nmdc:mga0sz30_15912_c1 nmdc:mga0sz30_15912_c1_107_907 263
141 iso_pu_bacteria 2513020051 2513228845 263
142 3300003791 Ga0055530_10012816 Ga0055530_100128164 264
143 3300003792 Ga0055540_1000374 Ga0055540_100037424 264
144 3300003794 Ga0055531_10000475 Ga0055531_1000047521 264
145 3300003794 Ga0055531_10000798 Ga0055531_1000079823 264
146 3300006847 Ga0075431_100010824 Ga0075431_1000108243 264
147 3300014497 Ga0182008_10000041 Ga0182008_1000004143 264
148 3300025292 Ga0209676_1000779 Ga0209676_100077921 264
149 3300025298 Ga0209050_1000412 Ga0209050_100041267 264
150 3300025303 Ga0209051_1000150 Ga0209051_100015076 264
151 3300025304 Ga0209257_1000275 Ga0209257_100027586 264
152 3300026118 Ga0207675_100165538 Ga0207675_1001655383 264
153 3300028794 Ga0307515_10003427 Ga0307515_1000342727 264
154 3300028794 Ga0307515_10003461 Ga0307515_1000346123 264
155 3300031456 Ga0307513_10000034 Ga0307513_1000003482 264
156 3300031456 Ga0307513_10400613 Ga0307513_104006132 264
157 3300031507 Ga0307509_10001929 Ga0307509_1000192914 264
158 3300031616 Ga0307508_10002660 Ga0307508_1000266011 264
159 3300031649 Ga0307514_10003744 Ga0307514_1000374414 264
160 3300031852 Ga0307410_10213184 Ga0307410_102131842 264
161 3300031911 Ga0307412_10383910 Ga0307412_103839102 264
162 3300031995 Ga0307409_100069435 Ga0307409_1000694351 264
163 3300033179 Ga0307507_10019308 Ga0307507_100193083 264
164 3300042004 Ga0439445_0082135 Ga0439445_0082135_14_820 264
165 3300046454 Ga0495592_0137993 Ga0495592_0137993_496_1302 264
166 3300048905 Ga0496102_0000100 Ga0496102_0000100_28821_29630 264
167 3300048906 Ga0496103_0000070 Ga0496103_0000070_28802_29611 264
168 3300048908 Ga0496105_0208180 Ga0496105_0208180_285_1094 264
169 3300048919 Ga0496116_0000527 Ga0496116_0000527_21985_22794 264
170 3300048920 Ga0496117_0000194 Ga0496117_0000194_28821_29630 264
171 3300048921 Ga0496118_0000146 Ga0496118_0000146_28821_29630 264
172 3300048922 Ga0496119_0019292 Ga0496119_0019292_2406_3215 264
173 3300048923 Ga0496120_0021251 Ga0496120_0021251_737_1546 264
174 3300048925 Ga0496122_0178489 Ga0496122_0178489_140_943 264
175 3300048927 Ga0496124_0000185 Ga0496124_0000185_93902_94711 264
176 3300049569 Ga0501032_0074374 Ga0501032_0074374_574_1395 264
177 3300049571 Ga0501034_0005968 Ga0501034_0005968_3940_4761 264
178 3300049574 Ga0501038_0268150 Ga0501038_0268150_170_991 264
179 3300049822 Ga0501035_0233534 Ga0501035_0233534_747_1550 264
180 3300050510 nmdc:mga06r32_16305_c1 nmdc:mga06r32_16305_c1_1088_1891 264
181 iso_pu_bacteria 2599185316 2600022989 264
182 iso_pu_bacteria 2599185325 2600076357 264
183 iso_pu_bacteria 2738543011 2739236133 264
184 iso_pu_bacteria 2889300758 2889304501 264
185 iso_pu_bacteria 2939631187 2939633290 264
186 iso_pu_bacteria 2939743619 2939745101 264
187 3300006177 Ga0075362_10114706 Ga0075362_101147062 265
188 3300006353 Ga0075370_10036649 Ga0075370_100366493 265
189 3300013100 Ga0157373_10000323 Ga0157373_100003232 265
190 3300032002 Ga0307416_100186033 Ga0307416_1001860332 265
191 3300041404 Ga0439436_0026861 Ga0439436_0026861_566_1381 265
192 3300041413 Ga0439465_0041098 Ga0439465_0041098_248_1063 265
193 3300042004 Ga0439445_0006499 Ga0439445_0006499_762_1577 265
194 3300042006 Ga0439432_001861 Ga0439432_001861_6717_7532 265
195 3300042006 Ga0439432_006592 Ga0439432_006592_1298_2113 265
196 3300042006 Ga0439432_034016 Ga0439432_034016_233_1048 265
197 3300042007 Ga0439449_0011342 Ga0439449_0011342_1635_2450 265
198 3300042007 Ga0439449_0019605 Ga0439449_0019605_292_1104 265
199 3300042007 Ga0439449_0038052 Ga0439449_0038052_904_1719 265
200 3300042014 Ga0439457_006304 Ga0439457_006304_645_1457 265
201 3300042014 Ga0439457_015363 Ga0439457_015363_747_1562 265
202 3300042015 Ga0439462_0006133 Ga0439462_0006133_1511_2323 265
203 3300042145 Ga0450906_005411 Ga0450906_005411_1119_1934 265
204 3300042147 Ga0450910_020843 Ga0450910_020843_111_926 265
205 3300042185 Ga0450909_007759 Ga0450909_007759_76_888 265
206 3300042185 Ga0450909_009495 Ga0450909_009495_231_1046 265
207 3300042531 Ga0450918_006985 Ga0450918_006985_113_928 265
208 3300050493 nmdc:mga0k408_29873_c1 nmdc:mga0k408_29873_c1_895_1710 265
209 3300050494 nmdc:mga06z11_19060_c1 nmdc:mga06z11_19060_c1_1044_1859 265
210 3300050496 nmdc:mga07m45_22998_c1 nmdc:mga07m45_22998_c1_1578_2393 265
211 iso_pu_bacteria 2565956761 2566997102 265
212 iso_pu_bacteria 2904535858 2904536692 265
213 3300037471 Ga0395905_0020836 Ga0395905_0020836_3837_4703 266
214 3300048911 Ga0496108_0022939 Ga0496108_0022939_3984_4811 267
215 3300053161 Ga0500634_0042104 Ga0500634_0042104_978_1796 267
216 iso_pu_bacteria 2599185178 2599445195 267
217 iso_pu_bacteria 2643221561 2643824627 267
218 iso_pu_bacteria 2643221696 2644535879 267
219 iso_pu_bacteria 2744054900 2746086212 267
220 iso_pu_bacteria 2744054901 2746096184 267
221 iso_pu_bacteria 2791355137 2792838278 267
222 iso_pu_bacteria 2842324504 2842327847 267
223 iso_pu_bacteria 2842348783 2842351545 267
224 iso_pu_bacteria 2842454564 2842460533 267
225 3300005354 Ga0070675_100014108 Ga0070675_1000141086 268
226 3300005355 Ga0070671_100140469 Ga0070671_1001404693 268
227 3300025925 Ga0207650_10062094 Ga0207650_100620942 268
228 3300025926 Ga0207659_10151644 Ga0207659_101516442 268
229 3300025931 Ga0207644_10115374 Ga0207644_101153742 268
230 3300046492 Ga0495585_0000684 Ga0495585_0000684_24423_25235 268
231 3300046810 Ga0495660_0001435 Ga0495660_0001435_2755_3567 268
232 3300047318 Ga0495636_0053671 Ga0495636_0053671_119_967 268
233 3300047447 Ga0495685_014526 Ga0495685_014526_430_1278 268
234 3300047470 Ga0495681_0064384 Ga0495681_0064384_762_1574 268
235 3300049571 Ga0501034_0000199 Ga0501034_0000199_104795_105619 268
236 3300049582 Ga0501048_0291874 Ga0501048_0291874_216_1049 268
237 3300053125 Ga0500618_002466 Ga0500618_002466_1894_2745 268
238 3300003758 Ga0055532_1000041 Ga0055532_100004175 269
239 3300003760 Ga0055527_1000413 Ga0055527_10004133 269
240 3300003761 Ga0055535_1000030 Ga0055535_1000030102 269
241 3300003763 Ga0055529_1000058 Ga0055529_100005875 269
242 3300003841 Ga0055541_1000210 Ga0055541_10002109 269
243 3300005578 Ga0068854_100000025 Ga0068854_10000002578 269
244 3300009093 Ga0105240_10002768 Ga0105240_1000276820 269
245 3300013100 Ga0157373_10053744 Ga0157373_100537442 269
246 3300013105 Ga0157369_10000809 Ga0157369_1000080919 269
247 3300015261 Ga0182006_1001495 Ga0182006_10014956 269
248 3300020610 Ga0154015_1576712 Ga0154015_15767122 269
249 3300025225 Ga0209566_100536 Ga0209566_1005369 269
250 3300025226 Ga0209674_100361 Ga0209674_10036111 269
251 3300025228 Ga0209672_100247 Ga0209672_10024721 269
252 3300025229 Ga0209147_100008 Ga0209147_100008646 269
253 3300025230 Ga0209563_112777 Ga0209563_1127772 269
254 3300025242 Ga0209258_100013 Ga0209258_100013646 269
255 3300025256 Ga0209759_1000492 Ga0209759_100049219 269
256 3300025272 Ga0209455_1000106 Ga0209455_100010677 269
257 3300025913 Ga0207695_10000535 Ga0207695_1000053552 269
258 3300025981 Ga0207640_10000096 Ga0207640_1000009642 269
259 3300031548 Ga0307408_100012528 Ga0307408_1000125285 269
260 3300031911 Ga0307412_10009292 Ga0307412_100092922 269
261 3300032002 Ga0307416_100119433 Ga0307416_1001194332 269
262 3300037312 Ga0395899_0000035 Ga0395899_0000035_68381_69202 269
263 3300037418 Ga0395900_0000113 Ga0395900_0000113_68381_69202 269
264 3300037418 Ga0395900_0001052 Ga0395900_0001052_12213_13034 269
265 3300037466 Ga0395898_0000444 Ga0395898_0000444_65205_66026 269
266 3300044693 Ga0466961_0000852 Ga0466961_0000852_2723_3544 269
267 3300044694 Ga0466963_0075465 Ga0466963_0075465_248_1069 269
268 3300044719 Ga0466971_0113707 Ga0466971_0113707_166_987 269
269 3300045836 Ga0466958_0022274 Ga0466958_0022274_207_1028 269
270 3300048925 Ga0496122_0027018 Ga0496122_0027018_1124_1960 270
271 3300048926 Ga0496123_0037303 Ga0496123_0037303_871_1707 270
272 3300003187 JGI25151J46595_10000789 JGI25151J46595_100007898 276
273 3300003771 Ga0055526_1009689 Ga0055526_10096894 276
274 3300003775 Ga0055524_1000445 Ga0055524_100044529 276
275 3300003784 Ga0055534_1000378 Ga0055534_100037820 276
276 3300025263 Ga0209565_1000201 Ga0209565_100020111 276
277 3300025291 Ga0209675_1000560 Ga0209675_10005608 276
278 3300025291 Ga0209675_1011001 Ga0209675_10110012 276
279 3300025294 Ga0209025_1001002 Ga0209025_100100234 276
280 3300025295 Ga0209564_1000578 Ga0209564_100057852 276
281 3300025297 Ga0209758_1017733 Ga0209758_10177332 276
282 3300025299 Ga0209256_1001799 Ga0209256_100179915 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

102

315

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wqt-assembly1.cif.gz_A dodecahedral assembly of mhpd 0.9811 7 270
2wqt-assembly1.cif.gz_A dodecahedral assembly of mhpd 0.9552 7 270
5d2k-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate 0.9375 7 268
5d2i-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate 0.9283 7 268
2eb5-assembly1.cif.gz_A crystal structure of hpcg complexed with oxalate 0.9273 1 268
ID Description Score Start End Superfamily
2wqtB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9791 7 270 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9646 1 268 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9537 1 268 3.90.850.10
2wqtB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9533 7 270 3.90.850.10
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9375 7 268 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A356HBZ7-F1-model_v4 deleted 1 110 251
AF-A0A3C0VKX9-F1-model_v4 2-keto-4-pentenoate hydratase 0.9914 97 269 GO:0005737
GO:0008684
AF-F0FXD2-F1-model_v4 4-oxalocrotonate decarboxylase 0.9904 140 269 GO:0005737
GO:0008684
GO:0019628
GO:0050385
AF-A0A2V1H065-F1-model_v4 deleted 0.9872 178 271
AF-A0A2V2T535-F1-model_v4 2-keto-4-pentenoate hydratase 0.9855 156 271 GO:0005737
GO:0008684
GO:0009056

Feature Viewer

pLDDT pTM Quality
95.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map