F384711

General Info

Members Datasets Scaffolds Average Seq Length
282 179 282 69

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10270098|Ga0070676_102700981
Length 70
Sequence MKLSARNQLPATVRSVTQGAVMAEVVVTVDGGHEVVAAITAESARRLGLAVGTRVTVVIKSTEVMLATDD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 7.09
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10641984 3300005327 Bacteria 921
2 Ga0070676_10270098 3300005328 Bacteria 1142
3 Ga0070683_101068502 3300005329 Bacteria 775
4 Ga0070677_10522744 3300005333 Unclassified 646
5 Ga0070680_101664541 3300005336 Bacteria 553
6 Ga0070682_101004869 3300005337 Bacteria 692
7 Ga0068868_100574832 3300005338 Bacteria 996
8 Ga0068868_101487185 3300005338 Bacteria 634
9 Ga0070689_100081846 3300005340 Bacteria 2535
10 Ga0070687_100411007 3300005343 Bacteria 890
11 Ga0070661_100232910 3300005344 Bacteria 1416
12 Ga0070661_101159600 3300005344 Bacteria 645
13 Ga0070668_100149726 3300005347 Bacteria 1886
14 Ga0070668_101775633 3300005347 Bacteria 567
15 Ga0070669_100525789 3300005353 Bacteria 984
16 Ga0070673_100975595 3300005364 Bacteria 788
17 Ga0070688_100613334 3300005365 Unclassified 834
18 Ga0070659_100538365 3300005366 Bacteria 999
19 Ga0070667_102247880 3300005367 Bacteria 514
20 Ga0070709_10194722 3300005434 Bacteria 1432
21 Ga0070714_100105103 3300005435 Bacteria 2492
22 Ga0070714_100763968 3300005435 Bacteria 935
23 Ga0070713_100504128 3300005436 Bacteria 1142
24 Ga0070713_100951931 3300005436 Bacteria 827
25 Ga0070713_101657561 3300005436 Bacteria 621
26 Ga0070711_100972198 3300005439 Bacteria 727
27 Ga0070705_100230778 3300005440 Bacteria 1288
28 Ga0070678_100694591 3300005456 Bacteria 916
29 Ga0070662_100184641 3300005457 Bacteria 1646
30 Ga0070662_101592594 3300005457 Bacteria 564
31 Ga0070662_101687756 3300005457 Unclassified 547
32 Ga0068867_101363445 3300005459 Bacteria 656
33 Ga0068867_102367228 3300005459 Bacteria 505
34 Ga0070685_10841174 3300005466 Bacteria 679
35 Ga0070684_100109324 3300005535 Bacteria 2478
36 Ga0070684_100398867 3300005535 Bacteria 1268
37 Ga0070686_100621404 3300005544 Unclassified 854
38 Ga0070686_101832387 3300005544 Unclassified 517
39 Ga0070696_100256303 3300005546 Bacteria 1325
40 Ga0070696_100918103 3300005546 Unclassified 727
41 Ga0070693_100835605 3300005547 Bacteria 685
42 Ga0070693_101197897 3300005547 Bacteria 583
43 Ga0070664_102286656 3300005564 Bacteria 513
44 Ga0068854_100467331 3300005578 Bacteria 1057
45 Ga0068856_100544516 3300005614 Bacteria 1182
46 Ga0070702_100782161 3300005615 Bacteria 736
47 Ga0068852_100492841 3300005616 Bacteria 1219
48 Ga0068852_102350305 3300005616 Bacteria 554
49 Ga0068864_100162188 3300005618 Bacteria 2033
50 Ga0068864_100616977 3300005618 Bacteria 1054
51 Ga0068866_10364612 3300005718 Bacteria 922
52 Ga0068861_101465267 3300005719 Bacteria 669
53 Ga0068863_101901016 3300005841 Bacteria 605
54 Ga0068858_102602114 3300005842 Bacteria 500
55 Ga0068862_100916790 3300005844 Bacteria 862
56 Ga0081538_10115704 3300005981 Bacteria 1303
57 Ga0075365_10035119 3300006038 Bacteria 3242
58 Ga0070712_100089621 3300006175 Bacteria 2250
59 Ga0097621_100484698 3300006237 Bacteria 1118
60 Ga0097621_101499337 3300006237 Bacteria 640
61 Ga0068871_101355915 3300006358 Bacteria 670
62 Ga0075428_101099020 3300006844 Bacteria 840
63 Ga0075428_101210257 3300006844 Bacteria 796
64 Ga0075431_101392836 3300006847 Bacteria 661
65 Ga0075433_10200158 3300006852 Bacteria 1776
66 Ga0075434_100165331 3300006871 Bacteria 2233
67 Ga0075434_100383556 3300006871 Bacteria 1426
68 Ga0068865_100476947 3300006881 Bacteria 1036
69 Ga0068865_100724876 3300006881 Bacteria 852
70 Ga0068865_100802029 3300006881 Unclassified 812
71 Ga0075435_100277317 3300007076 Bacteria 1431
72 Ga0075435_101072429 3300007076 Bacteria 704
73 Ga0075435_101577425 3300007076 Bacteria 576
74 Ga0111539_10409906 3300009094 Bacteria 1578
75 Ga0111539_10446675 3300009094 Bacteria 1506
76 Ga0111539_11317506 3300009094 Unclassified 838
77 Ga0105245_10228710 3300009098 Bacteria 1798
78 Ga0105245_10277907 3300009098 Bacteria 1636
79 Ga0105245_10321848 3300009098 Bacteria 1524
80 Ga0105245_10339556 3300009098 Unclassified 1485
81 Ga0105245_10672264 3300009098 Bacteria 1067
82 Ga0105245_11167014 3300009098 Bacteria 817
83 Ga0105245_11223310 3300009098 Bacteria 799
84 Ga0105245_11418239 3300009098 Unclassified 745
85 Ga0105245_13028660 3300009098 Bacteria 521
86 Ga0114129_11069792 3300009147 Bacteria 1012
87 Ga0114129_12522409 3300009147 Unclassified 614
88 Ga0114129_12961292 3300009147 Unclassified 560
89 Ga0114129_13032250 3300009147 Unclassified 551
90 Ga0105243_10118662 3300009148 Bacteria 2226
91 Ga0105243_11482368 3300009148 Bacteria 702
92 Ga0105243_12879833 3300009148 Bacteria 521
93 Ga0105241_11495785 3300009174 Bacteria 650
94 Ga0105242_10426011 3300009176 Bacteria 1245
95 Ga0105248_10548711 3300009177 Bacteria 1304
96 Ga0105238_12037760 3300009551 Unclassified 608
97 Ga0105249_10745970 3300009553 Bacteria 1041
98 Ga0105249_10782220 3300009553 Bacteria 1018
99 Ga0105249_11595926 3300009553 Bacteria 725
100 Ga0105249_12057253 3300009553 Unclassified 644
101 Ga0105249_12214551 3300009553 Bacteria 622
102 Ga0105239_10120038 3300010375 Bacteria 2919
103 Ga0105239_11269542 3300010375 Bacteria 849
104 Ga0105239_11355608 3300010375 Bacteria 821
105 Ga0105246_10187922 3300011119 Bacteria 1596
106 Ga0105246_11334937 3300011119 Bacteria 666
107 Ga0105246_11698039 3300011119 Bacteria 600
108 Ga0105246_11977497 3300011119 Unclassified 562
109 Ga0105246_12504603 3300011119 Bacteria 508
110 Ga0157374_11329653 3300013296 Bacteria 741
111 Ga0157378_10536399 3300013297 Bacteria 1174
112 Ga0163162_11119919 3300013306 Unclassified 892
113 Ga0163162_12021802 3300013306 Bacteria 660
114 Ga0163162_12179901 3300013306 Bacteria 636
115 Ga0157372_11841298 3300013307 Bacteria 696
116 Ga0157372_12267019 3300013307 Bacteria 624
117 Ga0157375_10429088 3300013308 Bacteria 1488
118 Ga0157375_11428318 3300013308 Bacteria 815
119 Ga0157375_11517082 3300013308 Bacteria 791
120 Ga0163163_10147042 3300014325 Bacteria 2401
121 Ga0163163_13084683 3300014325 Bacteria 520
122 Ga0157380_11915895 3300014326 Bacteria 653
123 Ga0157377_10833525 3300014745 Bacteria 683
124 Ga0157379_10779868 3300014968 Bacteria 901
125 Ga0157379_11957260 3300014968 Bacteria 578
126 Ga0157376_12544797 3300014969 Unclassified 552
127 Ga0163161_10614052 3300017792 Bacteria 898
128 Ga0163161_11936349 3300017792 Bacteria 524
129 Ga0213875_10081184 3300021388 Unclassified 1513
130 Ga0207426_1054973 3300025302 Unclassified 1168
131 Ga0207688_10273968 3300025901 Bacteria 1027
132 Ga0207699_10224796 3300025906 Bacteria 1283
133 Ga0207693_11108776 3300025915 Bacteria 601
134 Ga0207660_11604621 3300025917 Bacteria 524
135 Ga0207660_11720701 3300025917 Unclassified 504
136 Ga0207649_10184993 3300025920 Bacteria 1461
137 Ga0207659_11136587 3300025926 Bacteria 672
138 Ga0207687_10321993 3300025927 Bacteria 1252
139 Ga0207687_10649313 3300025927 Bacteria 892
140 Ga0207687_10833978 3300025927 Bacteria 787
141 Ga0207687_11341291 3300025927 Bacteria 615
142 Ga0207700_10399631 3300025928 Bacteria 1204
143 Ga0207664_10022885 3300025929 Bacteria 4674
144 Ga0207664_10287673 3300025929 Unclassified 1444
145 Ga0207690_11762853 3300025932 Bacteria 517
146 Ga0207706_10143195 3300025933 Bacteria 2103
147 Ga0207706_11554893 3300025933 Unclassified 537
148 Ga0207686_10995871 3300025934 Bacteria 680
149 Ga0207709_10238963 3300025935 Bacteria 1320
150 Ga0207709_10395132 3300025935 Unclassified 1056
151 Ga0207670_11089704 3300025936 Bacteria 674
152 Ga0207704_10297170 3300025938 Bacteria 1235
153 Ga0207704_10421344 3300025938 Bacteria 1058
154 Ga0207691_10680676 3300025940 Unclassified 868
155 Ga0207691_10867019 3300025940 Bacteria 757
156 Ga0207689_11481447 3300025942 Bacteria 567
157 Ga0207661_10546654 3300025944 Bacteria 1061
158 Ga0207661_11714030 3300025944 Bacteria 574
159 Ga0207679_11048335 3300025945 Bacteria 748
160 Ga0207679_11510901 3300025945 Bacteria 616
161 Ga0207679_11542290 3300025945 Unclassified 609
162 Ga0207651_11788383 3300025960 Bacteria 553
163 Ga0207712_10859521 3300025961 Bacteria 800
164 Ga0207712_11326940 3300025961 Bacteria 643
165 Ga0207712_11469310 3300025961 Bacteria 610
166 Ga0207668_10321668 3300025972 Unclassified 1284
167 Ga0207668_10601261 3300025972 Bacteria 958
168 Ga0207677_10608073 3300026023 Bacteria 960
169 Ga0207677_11891393 3300026023 Bacteria 554
170 Ga0207677_12115113 3300026023 Bacteria 523
171 Ga0207678_10433948 3300026067 Bacteria 1140
172 Ga0207708_10106696 3300026075 Bacteria 2172
173 Ga0207702_10119094 3300026078 Bacteria 2360
174 Ga0207648_10145034 3300026089 Bacteria 2094
175 Ga0207648_11267365 3300026089 Bacteria 693
176 Ga0207648_11911068 3300026089 Bacteria 555
177 Ga0207648_12010886 3300026089 Unclassified 539
178 Ga0207676_10211476 3300026095 Bacteria 1721
179 Ga0207676_10610495 3300026095 Bacteria 1049
180 Ga0207675_100652142 3300026118 Bacteria 1059
181 Ga0207675_101650383 3300026118 Bacteria 661
182 Ga0207683_11329042 3300026121 Bacteria 665
183 Ga0207683_11846749 3300026121 Unclassified 553
184 Ga0207698_10373751 3300026142 Bacteria 1354
185 Ga0209970_1035582 3300027614 Bacteria 875
186 Ga0209983_1039484 3300027665 Bacteria 1020
187 Ga0209974_10300482 3300027876 Unclassified 614
188 Ga0207428_10744103 3300027907 Bacteria 699
189 Ga0265326_10185401 3300028558 Bacteria 596
190 Ga0265334_10266231 3300028573 Bacteria 589
191 Ga0265323_10127157 3300028653 Bacteria 827
192 Ga0265330_10058981 3300031235 Bacteria 1672
193 Ga0265328_10226237 3300031239 Unclassified 713
194 Ga0265320_10482135 3300031240 Bacteria 548
195 Ga0265329_10040783 3300031242 Bacteria 1490
196 Ga0265331_10184555 3300031250 Bacteria 942
197 Ga0265316_10400511 3300031344 Bacteria 988
198 Ga0265314_10475244 3300031711 Unclassified 662
199 Ga0265342_10026471 3300031712 Bacteria 3634
200 Ga0307410_11043191 3300031852 Bacteria 707
201 Ga0307407_11648646 3300031903 Bacteria 510
202 Ga0307409_101718953 3300031995 Bacteria 656
203 Ga0307414_10330741 3300032004 Bacteria 1301
204 Ga0307415_102092580 3300032126 Bacteria 552
205 Ga0373931_0581700 3300035691 Unclassified 730
206 Ga0436364_1308319 3300037853 Bacteria 2612
207 Ga0436365_1598048 3300039437 Bacteria 1003
208 Ga0439459_0039290 3300042438 Bacteria 999
209 Ga0466963_0080225 3300044694 Bacteria 2209
210 Ga0466963_0772879 3300044694 Unclassified 677
211 Ga0466964_0106304 3300044706 Bacteria 1245
212 Ga0466971_0595586 3300044719 Unclassified 551
213 Ga0466957_0054816 3300044842 Bacteria 2435
214 Ga0466960_0301525 3300044901 Bacteria 903
215 Ga0466959_0097778 3300045049 Bacteria 2103
216 Ga0466959_0131602 3300045049 Bacteria 1773
217 Ga0466958_0098414 3300045836 Bacteria 1816
218 Ga0466958_0261037 3300045836 Unclassified 1109
219 Ga0466967_0328301 3300045976 Bacteria 1477
220 Ga0466967_0597726 3300045976 Bacteria 1089
221 Ga0466967_0636709 3300045976 Bacteria 1054
222 Ga0466967_0979848 3300045976 Bacteria 842
223 Ga0466967_1355670 3300045976 Bacteria 708
224 Ga0466967_1778607 3300045976 Bacteria 613
225 Ga0466967_2369132 3300045976 Bacteria 526
226 Ga0495582_0421769 3300046473 Bacteria 770
227 Ga0495662_0066504 3300046476 Bacteria 1744
228 Ga0495596_0237190 3300046500 Unclassified 708
229 Ga0495608_0121504 3300046511 Bacteria 1675
230 Ga0495620_0078547 3300046515 Archaea 1338
231 Ga0495630_0448781 3300046517 Unclassified 988
232 Ga0495644_0137926 3300046523 Bacteria 931
233 Ga0495663_0180370 3300046525 Unclassified 731
234 Ga0495652_0584289 3300046529 Bacteria 764
235 Ga0495640_0073254 3300046533 Bacteria 2293
236 Ga0495587_0469902 3300046536 Bacteria 696
237 Ga0495587_0521847 3300046536 Bacteria 656
238 Ga0495656_0643984 3300046615 Bacteria 569
239 Ga0495635_0120203 3300046663 Bacteria 1792
240 Ga0495588_0384627 3300046674 Unclassified 737
241 Ga0495599_0708390 3300046678 Bacteria 580
242 Ga0495624_0444724 3300046690 Unclassified 777
243 Ga0495604_0778681 3300047317 Bacteria 604
244 Ga0495674_0245540 3300047319 Bacteria 1474
245 Ga0495680_0123218 3300047322 Bacteria 1912
246 Ga0496100_0754509 3300048903 Unclassified 761
247 Ga0496100_1203601 3300048903 Unclassified 598
248 Ga0496102_0199177 3300048905 Bacteria 1888
249 Ga0496102_0576542 3300048905 Bacteria 1048
250 Ga0496104_0805156 3300048907 Bacteria 846
251 Ga0496104_1832979 3300048907 Bacteria 509
252 Ga0496105_0216208 3300048908 Bacteria 1561
253 Ga0496107_0651258 3300048910 Bacteria 777
254 Ga0496108_1336665 3300048911 Bacteria 602
255 Ga0496109_0034063 3300048912 Bacteria 4584
256 Ga0496109_0352296 3300048912 Bacteria 1391
257 Ga0496109_1826349 3300048912 Bacteria 541
258 Ga0496110_0930544 3300048913 Bacteria 776
259 Ga0496110_0995049 3300048913 Unclassified 746
260 Ga0496110_1530204 3300048913 Bacteria 577
261 Ga0496111_0350014 3300048914 Bacteria 1094
262 Ga0496111_0366129 3300048914 Bacteria 1067
263 Ga0496112_1016550 3300048915 Bacteria 749
264 Ga0496112_1021448 3300048915 Bacteria 746
265 Ga0496114_0716418 3300048917 Bacteria 877
266 Ga0496126_0006909 3300048929 Bacteria 12569
267 Ga0501076_0096071 3300049592 Bacteria 2387
268 nmdc:mga05p37_1403006_c1 3300050507 Unclassified 703
269 nmdc:mga05p37_1559938_c1 3300050507 Bacteria 653
270 nmdc:mga06r32_1346111_c1 3300050510 Bacteria 657
271 nmdc:mga08y16_239170_c1 3300050511 Bacteria 1877
272 nmdc:mga08y16_479714_c1 3300050511 Bacteria 1265
273 nmdc:mga0n895_323249_c2 3300050512 Unclassified 776
274 nmdc:mga0n895_75733_c1 3300050512 Bacteria 3345
275 nmdc:mga0rr50_1021907_c1 3300050513 Bacteria 704
276 nmdc:mga0rr50_1769734_c1 3300050513 Bacteria 520
277 nmdc:mga0a205_510158_c1 3300050515 Unclassified 1059
278 Ga0495601_0060586 3300053077 Bacteria 2401
279 Ga0495619_0219958 3300053085 Bacteria 1315
280 Ga0495619_1096429 3300053085 Bacteria 530
281 Ga0466962_0140902 3300061719 Unclassified 1168
282 Ga0466962_0345716 3300061719 Bacteria 740

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_11355608 Ga0105239_113556081 57
2 3300032004 Ga0307414_10330741 Ga0307414_103307412 57
3 3300005618 Ga0068864_100616977 Ga0068864_1006169771 58
4 3300026095 Ga0207676_10610495 Ga0207676_106104952 58
5 3300048912 Ga0496109_0034063 Ga0496109_0034063_2081_2293 58
6 3300025917 Ga0207660_11720701 Ga0207660_117207012 64
7 3300005336 Ga0070680_101664541 Ga0070680_1016645412 68
8 3300005435 Ga0070714_100763968 Ga0070714_1007639682 68
9 3300005436 Ga0070713_101657561 Ga0070713_1016575612 68
10 3300006038 Ga0075365_10035119 Ga0075365_100351193 68
11 3300021388 Ga0213875_10081184 Ga0213875_100811842 68
12 3300025929 Ga0207664_10287673 Ga0207664_102876732 68
13 3300031995 Ga0307409_101718953 Ga0307409_1017189532 68
14 3300032126 Ga0307415_102092580 Ga0307415_1020925802 68
15 3300037853 Ga0436364_1308319 Ga0436364_1308319_230_436 68
16 3300039437 Ga0436365_1598048 Ga0436365_1598048_269_475 68
17 3300044842 Ga0466957_0054816 Ga0466957_0054816_685_891 68
18 3300045049 Ga0466959_0131602 Ga0466959_0131602_192_398 68
19 3300045836 Ga0466958_0098414 Ga0466958_0098414_898_1104 68
20 3300045976 Ga0466967_1355670 Ga0466967_1355670_160_366 68
21 3300046523 Ga0495644_0137926 Ga0495644_0137926_93_299 68
22 3300046525 Ga0495663_0180370 Ga0495663_0180370_355_561 68
23 3300046615 Ga0495656_0643984 Ga0495656_0643984_114_320 68
24 3300053085 Ga0495619_1096429 Ga0495619_1096429_301_510 68
25 3300061719 Ga0466962_0345716 Ga0466962_0345716_318_524 68
26 3300005327 Ga0070658_10641984 Ga0070658_106419842 69
27 3300005328 Ga0070676_10270098 Ga0070676_102700981 69
28 3300005329 Ga0070683_101068502 Ga0070683_1010685021 69
29 3300005333 Ga0070677_10522744 Ga0070677_105227442 69
30 3300005337 Ga0070682_101004869 Ga0070682_1010048691 69
31 3300005338 Ga0068868_100574832 Ga0068868_1005748321 69
32 3300005338 Ga0068868_101487185 Ga0068868_1014871852 69
33 3300005340 Ga0070689_100081846 Ga0070689_1000818463 69
34 3300005343 Ga0070687_100411007 Ga0070687_1004110072 69
35 3300005344 Ga0070661_100232910 Ga0070661_1002329102 69
36 3300005344 Ga0070661_101159600 Ga0070661_1011596002 69
37 3300005347 Ga0070668_100149726 Ga0070668_1001497263 69
38 3300005347 Ga0070668_101775633 Ga0070668_1017756331 69
39 3300005353 Ga0070669_100525789 Ga0070669_1005257892 69
40 3300005364 Ga0070673_100975595 Ga0070673_1009755952 69
41 3300005365 Ga0070688_100613334 Ga0070688_1006133342 69
42 3300005366 Ga0070659_100538365 Ga0070659_1005383652 69
43 3300005367 Ga0070667_102247880 Ga0070667_1022478801 69
44 3300005434 Ga0070709_10194722 Ga0070709_101947222 69
45 3300005435 Ga0070714_100105103 Ga0070714_1001051032 69
46 3300005436 Ga0070713_100504128 Ga0070713_1005041282 69
47 3300005436 Ga0070713_100951931 Ga0070713_1009519312 69
48 3300005439 Ga0070711_100972198 Ga0070711_1009721981 69
49 3300005440 Ga0070705_100230778 Ga0070705_1002307782 69
50 3300005456 Ga0070678_100694591 Ga0070678_1006945912 69
51 3300005457 Ga0070662_100184641 Ga0070662_1001846413 69
52 3300005457 Ga0070662_101592594 Ga0070662_1015925941 69
53 3300005457 Ga0070662_101687756 Ga0070662_1016877562 69
54 3300005459 Ga0068867_101363445 Ga0068867_1013634452 69
55 3300005459 Ga0068867_102367228 Ga0068867_1023672282 69
56 3300005466 Ga0070685_10841174 Ga0070685_108411742 69
57 3300005535 Ga0070684_100109324 Ga0070684_1001093243 69
58 3300005535 Ga0070684_100398867 Ga0070684_1003988672 69
59 3300005544 Ga0070686_100621404 Ga0070686_1006214042 69
60 3300005544 Ga0070686_101832387 Ga0070686_1018323872 69
61 3300005546 Ga0070696_100256303 Ga0070696_1002563033 69
62 3300005546 Ga0070696_100918103 Ga0070696_1009181032 69
63 3300005547 Ga0070693_100835605 Ga0070693_1008356052 69
64 3300005547 Ga0070693_101197897 Ga0070693_1011978972 69
65 3300005564 Ga0070664_102286656 Ga0070664_1022866562 69
66 3300005578 Ga0068854_100467331 Ga0068854_1004673312 69
67 3300005614 Ga0068856_100544516 Ga0068856_1005445162 69
68 3300005615 Ga0070702_100782161 Ga0070702_1007821611 69
69 3300005616 Ga0068852_100492841 Ga0068852_1004928412 69
70 3300005616 Ga0068852_102350305 Ga0068852_1023503052 69
71 3300005618 Ga0068864_100162188 Ga0068864_1001621882 69
72 3300005718 Ga0068866_10364612 Ga0068866_103646122 69
73 3300005719 Ga0068861_101465267 Ga0068861_1014652672 69
74 3300005841 Ga0068863_101901016 Ga0068863_1019010162 69
75 3300005842 Ga0068858_102602114 Ga0068858_1026021141 69
76 3300005844 Ga0068862_100916790 Ga0068862_1009167902 69
77 3300005981 Ga0081538_10115704 Ga0081538_101157042 69
78 3300006175 Ga0070712_100089621 Ga0070712_1000896213 69
79 3300006237 Ga0097621_100484698 Ga0097621_1004846982 69
80 3300006237 Ga0097621_101499337 Ga0097621_1014993372 69
81 3300006358 Ga0068871_101355915 Ga0068871_1013559151 69
82 3300006844 Ga0075428_101099020 Ga0075428_1010990202 69
83 3300006844 Ga0075428_101210257 Ga0075428_1012102572 69
84 3300006847 Ga0075431_101392836 Ga0075431_1013928362 69
85 3300006852 Ga0075433_10200158 Ga0075433_102001583 69
86 3300006871 Ga0075434_100165331 Ga0075434_1001653313 69
87 3300006871 Ga0075434_100383556 Ga0075434_1003835562 69
88 3300006881 Ga0068865_100476947 Ga0068865_1004769472 69
89 3300006881 Ga0068865_100724876 Ga0068865_1007248763 69
90 3300006881 Ga0068865_100802029 Ga0068865_1008020292 69
91 3300007076 Ga0075435_100277317 Ga0075435_1002773171 69
92 3300007076 Ga0075435_101072429 Ga0075435_1010724292 69
93 3300007076 Ga0075435_101577425 Ga0075435_1015774252 69
94 3300009094 Ga0111539_10409906 Ga0111539_104099061 69
95 3300009094 Ga0111539_10446675 Ga0111539_104466753 69
96 3300009094 Ga0111539_11317506 Ga0111539_113175062 69
97 3300009098 Ga0105245_10228710 Ga0105245_102287104 69
98 3300009098 Ga0105245_10277907 Ga0105245_102779072 69
99 3300009098 Ga0105245_10321848 Ga0105245_103218482 69
100 3300009098 Ga0105245_10339556 Ga0105245_103395563 69
101 3300009098 Ga0105245_10672264 Ga0105245_106722642 69
102 3300009098 Ga0105245_11167014 Ga0105245_111670142 69
103 3300009098 Ga0105245_11223310 Ga0105245_112233102 69
104 3300009098 Ga0105245_11418239 Ga0105245_114182391 69
105 3300009098 Ga0105245_13028660 Ga0105245_130286602 69
106 3300009147 Ga0114129_11069792 Ga0114129_110697922 69
107 3300009147 Ga0114129_12522409 Ga0114129_125224092 69
108 3300009147 Ga0114129_12961292 Ga0114129_129612922 69
109 3300009147 Ga0114129_13032250 Ga0114129_130322502 69
110 3300009148 Ga0105243_10118662 Ga0105243_101186622 69
111 3300009148 Ga0105243_11482368 Ga0105243_114823682 69
112 3300009148 Ga0105243_12879833 Ga0105243_128798332 69
113 3300009174 Ga0105241_11495785 Ga0105241_114957851 69
114 3300009176 Ga0105242_10426011 Ga0105242_104260111 69
115 3300009177 Ga0105248_10548711 Ga0105248_105487112 69
116 3300009551 Ga0105238_12037760 Ga0105238_120377601 69
117 3300009553 Ga0105249_10745970 Ga0105249_107459702 69
118 3300009553 Ga0105249_10782220 Ga0105249_107822202 69
119 3300009553 Ga0105249_11595926 Ga0105249_115959262 69
120 3300009553 Ga0105249_12057253 Ga0105249_120572532 69
121 3300009553 Ga0105249_12214551 Ga0105249_122145512 69
122 3300010375 Ga0105239_10120038 Ga0105239_101200382 69
123 3300010375 Ga0105239_11269542 Ga0105239_112695422 69
124 3300011119 Ga0105246_10187922 Ga0105246_101879223 69
125 3300011119 Ga0105246_11334937 Ga0105246_113349372 69
126 3300011119 Ga0105246_11698039 Ga0105246_116980392 69
127 3300011119 Ga0105246_11977497 Ga0105246_119774972 69
128 3300011119 Ga0105246_12504603 Ga0105246_125046031 69
129 3300013296 Ga0157374_11329653 Ga0157374_113296532 69
130 3300013297 Ga0157378_10536399 Ga0157378_105363992 69
131 3300013306 Ga0163162_11119919 Ga0163162_111199192 69
132 3300013306 Ga0163162_12021802 Ga0163162_120218021 69
133 3300013306 Ga0163162_12179901 Ga0163162_121799012 69
134 3300013307 Ga0157372_11841298 Ga0157372_118412982 69
135 3300013307 Ga0157372_12267019 Ga0157372_122670192 69
136 3300013308 Ga0157375_10429088 Ga0157375_104290882 69
137 3300013308 Ga0157375_11428318 Ga0157375_114283181 69
138 3300013308 Ga0157375_11517082 Ga0157375_115170822 69
139 3300014325 Ga0163163_10147042 Ga0163163_101470423 69
140 3300014325 Ga0163163_13084683 Ga0163163_130846831 69
141 3300014326 Ga0157380_11915895 Ga0157380_119158952 69
142 3300014745 Ga0157377_10833525 Ga0157377_108335251 69
143 3300014968 Ga0157379_10779868 Ga0157379_107798682 69
144 3300014968 Ga0157379_11957260 Ga0157379_119572602 69
145 3300014969 Ga0157376_12544797 Ga0157376_125447972 69
146 3300017792 Ga0163161_10614052 Ga0163161_106140522 69
147 3300017792 Ga0163161_11936349 Ga0163161_119363492 69
148 3300025302 Ga0207426_1054973 Ga0207426_10549732 69
149 3300025901 Ga0207688_10273968 Ga0207688_102739682 69
150 3300025906 Ga0207699_10224796 Ga0207699_102247962 69
151 3300025915 Ga0207693_11108776 Ga0207693_111087762 69
152 3300025917 Ga0207660_11604621 Ga0207660_116046212 69
153 3300025920 Ga0207649_10184993 Ga0207649_101849932 69
154 3300025926 Ga0207659_11136587 Ga0207659_111365871 69
155 3300025927 Ga0207687_10321993 Ga0207687_103219932 69
156 3300025927 Ga0207687_10649313 Ga0207687_106493132 69
157 3300025927 Ga0207687_10833978 Ga0207687_108339781 69
158 3300025927 Ga0207687_11341291 Ga0207687_113412911 69
159 3300025928 Ga0207700_10399631 Ga0207700_103996312 69
160 3300025929 Ga0207664_10022885 Ga0207664_100228856 69
161 3300025932 Ga0207690_11762853 Ga0207690_117628532 69
162 3300025933 Ga0207706_10143195 Ga0207706_101431952 69
163 3300025933 Ga0207706_11554893 Ga0207706_115548931 69
164 3300025934 Ga0207686_10995871 Ga0207686_109958712 69
165 3300025935 Ga0207709_10238963 Ga0207709_102389632 69
166 3300025935 Ga0207709_10395132 Ga0207709_103951323 69
167 3300025936 Ga0207670_11089704 Ga0207670_110897042 69
168 3300025938 Ga0207704_10297170 Ga0207704_102971702 69
169 3300025938 Ga0207704_10421344 Ga0207704_104213442 69
170 3300025940 Ga0207691_10680676 Ga0207691_106806762 69
171 3300025940 Ga0207691_10867019 Ga0207691_108670192 69
172 3300025942 Ga0207689_11481447 Ga0207689_114814472 69
173 3300025944 Ga0207661_10546654 Ga0207661_105466542 69
174 3300025944 Ga0207661_11714030 Ga0207661_117140302 69
175 3300025945 Ga0207679_11048335 Ga0207679_110483352 69
176 3300025945 Ga0207679_11510901 Ga0207679_115109012 69
177 3300025945 Ga0207679_11542290 Ga0207679_115422902 69
178 3300025960 Ga0207651_11788383 Ga0207651_117883832 69
179 3300025961 Ga0207712_10859521 Ga0207712_108595212 69
180 3300025961 Ga0207712_11326940 Ga0207712_113269401 69
181 3300025961 Ga0207712_11469310 Ga0207712_114693101 69
182 3300025972 Ga0207668_10321668 Ga0207668_103216682 69
183 3300025972 Ga0207668_10601261 Ga0207668_106012612 69
184 3300026023 Ga0207677_10608073 Ga0207677_106080732 69
185 3300026023 Ga0207677_11891393 Ga0207677_118913932 69
186 3300026023 Ga0207677_12115113 Ga0207677_121151132 69
187 3300026067 Ga0207678_10433948 Ga0207678_104339482 69
188 3300026075 Ga0207708_10106696 Ga0207708_101066963 69
189 3300026078 Ga0207702_10119094 Ga0207702_101190943 69
190 3300026089 Ga0207648_10145034 Ga0207648_101450342 69
191 3300026089 Ga0207648_11267365 Ga0207648_112673652 69
192 3300026089 Ga0207648_11911068 Ga0207648_119110681 69
193 3300026089 Ga0207648_12010886 Ga0207648_120108862 69
194 3300026095 Ga0207676_10211476 Ga0207676_102114763 69
195 3300026118 Ga0207675_100652142 Ga0207675_1006521423 69
196 3300026118 Ga0207675_101650383 Ga0207675_1016503831 69
197 3300026121 Ga0207683_11329042 Ga0207683_113290421 69
198 3300026121 Ga0207683_11846749 Ga0207683_118467492 69
199 3300026142 Ga0207698_10373751 Ga0207698_103737513 69
200 3300027614 Ga0209970_1035582 Ga0209970_10355822 69
201 3300027665 Ga0209983_1039484 Ga0209983_10394842 69
202 3300027876 Ga0209974_10300482 Ga0209974_103004821 69
203 3300027907 Ga0207428_10744103 Ga0207428_107441032 69
204 3300028558 Ga0265326_10185401 Ga0265326_101854012 69
205 3300028573 Ga0265334_10266231 Ga0265334_102662311 69
206 3300028653 Ga0265323_10127157 Ga0265323_101271572 69
207 3300031235 Ga0265330_10058981 Ga0265330_100589812 69
208 3300031239 Ga0265328_10226237 Ga0265328_102262372 69
209 3300031240 Ga0265320_10482135 Ga0265320_104821351 69
210 3300031242 Ga0265329_10040783 Ga0265329_100407832 69
211 3300031250 Ga0265331_10184555 Ga0265331_101845552 69
212 3300031344 Ga0265316_10400511 Ga0265316_104005112 69
213 3300031711 Ga0265314_10475244 Ga0265314_104752442 69
214 3300031712 Ga0265342_10026471 Ga0265342_100264712 69
215 3300031852 Ga0307410_11043191 Ga0307410_110431912 69
216 3300031903 Ga0307407_11648646 Ga0307407_116486462 69
217 3300035691 Ga0373931_0581700 Ga0373931_0581700_284_496 69
218 3300042438 Ga0439459_0039290 Ga0439459_0039290_110_319 69
219 3300044694 Ga0466963_0080225 Ga0466963_0080225_983_1192 69
220 3300044694 Ga0466963_0772879 Ga0466963_0772879_50_259 69
221 3300044706 Ga0466964_0106304 Ga0466964_0106304_563_772 69
222 3300044719 Ga0466971_0595586 Ga0466971_0595586_46_255 69
223 3300044901 Ga0466960_0301525 Ga0466960_0301525_632_841 69
224 3300045049 Ga0466959_0097778 Ga0466959_0097778_1684_1893 69
225 3300045836 Ga0466958_0261037 Ga0466958_0261037_546_755 69
226 3300045976 Ga0466967_0328301 Ga0466967_0328301_279_488 69
227 3300045976 Ga0466967_0597726 Ga0466967_0597726_557_766 69
228 3300045976 Ga0466967_0636709 Ga0466967_0636709_224_433 69
229 3300045976 Ga0466967_0979848 Ga0466967_0979848_444_653 69
230 3300045976 Ga0466967_1778607 Ga0466967_1778607_182_391 69
231 3300045976 Ga0466967_2369132 Ga0466967_2369132_245_454 69
232 3300046473 Ga0495582_0421769 Ga0495582_0421769_511_723 69
233 3300046476 Ga0495662_0066504 Ga0495662_0066504_633_845 69
234 3300046500 Ga0495596_0237190 Ga0495596_0237190_81_290 69
235 3300046511 Ga0495608_0121504 Ga0495608_0121504_962_1174 69
236 3300046515 Ga0495620_0078547 Ga0495620_0078547_117_326 69
237 3300046517 Ga0495630_0448781 Ga0495630_0448781_744_956 69
238 3300046529 Ga0495652_0584289 Ga0495652_0584289_56_268 69
239 3300046533 Ga0495640_0073254 Ga0495640_0073254_1704_1916 69
240 3300046536 Ga0495587_0469902 Ga0495587_0469902_304_516 69
241 3300046536 Ga0495587_0521847 Ga0495587_0521847_420_632 69
242 3300046663 Ga0495635_0120203 Ga0495635_0120203_520_732 69
243 3300046674 Ga0495588_0384627 Ga0495588_0384627_416_628 69
244 3300046678 Ga0495599_0708390 Ga0495599_0708390_235_447 69
245 3300046690 Ga0495624_0444724 Ga0495624_0444724_158_370 69
246 3300047317 Ga0495604_0778681 Ga0495604_0778681_141_353 69
247 3300047319 Ga0495674_0245540 Ga0495674_0245540_901_1113 69
248 3300047322 Ga0495680_0123218 Ga0495680_0123218_102_314 69
249 3300048903 Ga0496100_0754509 Ga0496100_0754509_318_530 69
250 3300048903 Ga0496100_1203601 Ga0496100_1203601_11_223 69
251 3300048905 Ga0496102_0199177 Ga0496102_0199177_14_226 69
252 3300048905 Ga0496102_0576542 Ga0496102_0576542_597_809 69
253 3300048907 Ga0496104_0805156 Ga0496104_0805156_224_436 69
254 3300048907 Ga0496104_1832979 Ga0496104_1832979_182_394 69
255 3300048908 Ga0496105_0216208 Ga0496105_0216208_440_652 69
256 3300048910 Ga0496107_0651258 Ga0496107_0651258_555_767 69
257 3300048911 Ga0496108_1336665 Ga0496108_1336665_251_463 69
258 3300048912 Ga0496109_0352296 Ga0496109_0352296_816_1025 69
259 3300048912 Ga0496109_1826349 Ga0496109_1826349_189_401 69
260 3300048913 Ga0496110_0930544 Ga0496110_0930544_506_718 69
261 3300048913 Ga0496110_0995049 Ga0496110_0995049_261_470 69
262 3300048913 Ga0496110_1530204 Ga0496110_1530204_209_421 69
263 3300048914 Ga0496111_0350014 Ga0496111_0350014_169_378 69
264 3300048914 Ga0496111_0366129 Ga0496111_0366129_491_703 69
265 3300048915 Ga0496112_1016550 Ga0496112_1016550_457_669 69
266 3300048915 Ga0496112_1021448 Ga0496112_1021448_445_654 69
267 3300048917 Ga0496114_0716418 Ga0496114_0716418_258_470 69
268 3300048929 Ga0496126_0006909 Ga0496126_0006909_5768_5977 69
269 3300049592 Ga0501076_0096071 Ga0501076_0096071_1578_1787 69
270 3300050507 nmdc:mga05p37_1403006_c1 nmdc:mga05p37_1403006_c1_343_555 69
271 3300050507 nmdc:mga05p37_1559938_c1 nmdc:mga05p37_1559938_c1_50_262 69
272 3300050510 nmdc:mga06r32_1346111_c1 nmdc:mga06r32_1346111_c1_109_321 69
273 3300050511 nmdc:mga08y16_239170_c1 nmdc:mga08y16_239170_c1_419_631 69
274 3300050511 nmdc:mga08y16_479714_c1 nmdc:mga08y16_479714_c1_487_699 69
275 3300050512 nmdc:mga0n895_323249_c2 nmdc:mga0n895_323249_c2_168_377 69
276 3300050512 nmdc:mga0n895_75733_c1 nmdc:mga0n895_75733_c1_407_619 69
277 3300050513 nmdc:mga0rr50_1021907_c1 nmdc:mga0rr50_1021907_c1_46_258 69
278 3300050513 nmdc:mga0rr50_1769734_c1 nmdc:mga0rr50_1769734_c1_288_500 69
279 3300050515 nmdc:mga0a205_510158_c1 nmdc:mga0a205_510158_c1_163_375 69
280 3300053077 Ga0495601_0060586 Ga0495601_0060586_757_969 69
281 3300053085 Ga0495619_0219958 Ga0495619_0219958_449_661 69
282 3300061719 Ga0466962_0140902 Ga0466962_0140902_474_683 69

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03459

TOBE

TOBE domain

3

66

0.98

PF08402

TOBE_2

TOBE domain

1

66

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h9s-assembly1.cif.gz_B molybdate bound complex of dimop domain of mode from e.coli 0.964 2 55
1o7l-assembly1.cif.gz_B molybdate-activated form of mode from escherichia coli 0.9607 1 55
1o7l-assembly2.cif.gz_D molybdate-activated form of mode from escherichia coli 0.9581 1 55
1o7l-assembly1.cif.gz_A molybdate-activated form of mode from escherichia coli 0.9553 1 55
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.9535 1 59
ID Description Score Start End Superfamily
af_A0A1P8AW81_110_466_2.130.10.120 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.9698 13 39 2.130.10.120
af_Q2G1F0_304_346_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9673 11 41 2.40.50.140
1h9rA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9601 1 55 2.40.50.100
1o7lA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9553 1 55 2.40.50.100
af_A0A0P0VNU6_285_398_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9546 22 39 2.30.42.10
ID Description Score Start End GO Terms
AF-C0QSN2-F1-model_v4 Putative tobe domain protein 0.9777 7 55
AF-D7BF97-F1-model_v4 TOBE domain protein 0.9733 1 59 GO:0015689
AF-A0A7M1B9T7-F1-model_v4 Mop domain-containing protein 0.9696 1 58 GO:0015689
AF-A0A1W1EKG4-F1-model_v4 TOBE 0.9677 1 55 GO:0015689
AF-A0A7Y4VVK9-F1-model_v4 ABC transporter ATP-binding protein 0.9675 1 55 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
90.96 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map