F384711
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 179 | 282 | 69 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10270098|Ga0070676_102700981 |
| Length | 70 |
| Sequence | MKLSARNQLPATVRSVTQGAVMAEVVVTVDGGHEVVAAITAESARRLGLAVGTRVTVVIKSTEVMLATDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 75 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 116 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 129 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 130 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 131 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 132 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 133 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 134 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 135 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 136 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 137 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 170 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.71 |
| Nodule | 0 |
| Rhizoplane | 7.09 |
| Rhizosphere | 90.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10641984 | 3300005327 | Bacteria | 921 |
| 2 | Ga0070676_10270098 | 3300005328 | Bacteria | 1142 |
| 3 | Ga0070683_101068502 | 3300005329 | Bacteria | 775 |
| 4 | Ga0070677_10522744 | 3300005333 | Unclassified | 646 |
| 5 | Ga0070680_101664541 | 3300005336 | Bacteria | 553 |
| 6 | Ga0070682_101004869 | 3300005337 | Bacteria | 692 |
| 7 | Ga0068868_100574832 | 3300005338 | Bacteria | 996 |
| 8 | Ga0068868_101487185 | 3300005338 | Bacteria | 634 |
| 9 | Ga0070689_100081846 | 3300005340 | Bacteria | 2535 |
| 10 | Ga0070687_100411007 | 3300005343 | Bacteria | 890 |
| 11 | Ga0070661_100232910 | 3300005344 | Bacteria | 1416 |
| 12 | Ga0070661_101159600 | 3300005344 | Bacteria | 645 |
| 13 | Ga0070668_100149726 | 3300005347 | Bacteria | 1886 |
| 14 | Ga0070668_101775633 | 3300005347 | Bacteria | 567 |
| 15 | Ga0070669_100525789 | 3300005353 | Bacteria | 984 |
| 16 | Ga0070673_100975595 | 3300005364 | Bacteria | 788 |
| 17 | Ga0070688_100613334 | 3300005365 | Unclassified | 834 |
| 18 | Ga0070659_100538365 | 3300005366 | Bacteria | 999 |
| 19 | Ga0070667_102247880 | 3300005367 | Bacteria | 514 |
| 20 | Ga0070709_10194722 | 3300005434 | Bacteria | 1432 |
| 21 | Ga0070714_100105103 | 3300005435 | Bacteria | 2492 |
| 22 | Ga0070714_100763968 | 3300005435 | Bacteria | 935 |
| 23 | Ga0070713_100504128 | 3300005436 | Bacteria | 1142 |
| 24 | Ga0070713_100951931 | 3300005436 | Bacteria | 827 |
| 25 | Ga0070713_101657561 | 3300005436 | Bacteria | 621 |
| 26 | Ga0070711_100972198 | 3300005439 | Bacteria | 727 |
| 27 | Ga0070705_100230778 | 3300005440 | Bacteria | 1288 |
| 28 | Ga0070678_100694591 | 3300005456 | Bacteria | 916 |
| 29 | Ga0070662_100184641 | 3300005457 | Bacteria | 1646 |
| 30 | Ga0070662_101592594 | 3300005457 | Bacteria | 564 |
| 31 | Ga0070662_101687756 | 3300005457 | Unclassified | 547 |
| 32 | Ga0068867_101363445 | 3300005459 | Bacteria | 656 |
| 33 | Ga0068867_102367228 | 3300005459 | Bacteria | 505 |
| 34 | Ga0070685_10841174 | 3300005466 | Bacteria | 679 |
| 35 | Ga0070684_100109324 | 3300005535 | Bacteria | 2478 |
| 36 | Ga0070684_100398867 | 3300005535 | Bacteria | 1268 |
| 37 | Ga0070686_100621404 | 3300005544 | Unclassified | 854 |
| 38 | Ga0070686_101832387 | 3300005544 | Unclassified | 517 |
| 39 | Ga0070696_100256303 | 3300005546 | Bacteria | 1325 |
| 40 | Ga0070696_100918103 | 3300005546 | Unclassified | 727 |
| 41 | Ga0070693_100835605 | 3300005547 | Bacteria | 685 |
| 42 | Ga0070693_101197897 | 3300005547 | Bacteria | 583 |
| 43 | Ga0070664_102286656 | 3300005564 | Bacteria | 513 |
| 44 | Ga0068854_100467331 | 3300005578 | Bacteria | 1057 |
| 45 | Ga0068856_100544516 | 3300005614 | Bacteria | 1182 |
| 46 | Ga0070702_100782161 | 3300005615 | Bacteria | 736 |
| 47 | Ga0068852_100492841 | 3300005616 | Bacteria | 1219 |
| 48 | Ga0068852_102350305 | 3300005616 | Bacteria | 554 |
| 49 | Ga0068864_100162188 | 3300005618 | Bacteria | 2033 |
| 50 | Ga0068864_100616977 | 3300005618 | Bacteria | 1054 |
| 51 | Ga0068866_10364612 | 3300005718 | Bacteria | 922 |
| 52 | Ga0068861_101465267 | 3300005719 | Bacteria | 669 |
| 53 | Ga0068863_101901016 | 3300005841 | Bacteria | 605 |
| 54 | Ga0068858_102602114 | 3300005842 | Bacteria | 500 |
| 55 | Ga0068862_100916790 | 3300005844 | Bacteria | 862 |
| 56 | Ga0081538_10115704 | 3300005981 | Bacteria | 1303 |
| 57 | Ga0075365_10035119 | 3300006038 | Bacteria | 3242 |
| 58 | Ga0070712_100089621 | 3300006175 | Bacteria | 2250 |
| 59 | Ga0097621_100484698 | 3300006237 | Bacteria | 1118 |
| 60 | Ga0097621_101499337 | 3300006237 | Bacteria | 640 |
| 61 | Ga0068871_101355915 | 3300006358 | Bacteria | 670 |
| 62 | Ga0075428_101099020 | 3300006844 | Bacteria | 840 |
| 63 | Ga0075428_101210257 | 3300006844 | Bacteria | 796 |
| 64 | Ga0075431_101392836 | 3300006847 | Bacteria | 661 |
| 65 | Ga0075433_10200158 | 3300006852 | Bacteria | 1776 |
| 66 | Ga0075434_100165331 | 3300006871 | Bacteria | 2233 |
| 67 | Ga0075434_100383556 | 3300006871 | Bacteria | 1426 |
| 68 | Ga0068865_100476947 | 3300006881 | Bacteria | 1036 |
| 69 | Ga0068865_100724876 | 3300006881 | Bacteria | 852 |
| 70 | Ga0068865_100802029 | 3300006881 | Unclassified | 812 |
| 71 | Ga0075435_100277317 | 3300007076 | Bacteria | 1431 |
| 72 | Ga0075435_101072429 | 3300007076 | Bacteria | 704 |
| 73 | Ga0075435_101577425 | 3300007076 | Bacteria | 576 |
| 74 | Ga0111539_10409906 | 3300009094 | Bacteria | 1578 |
| 75 | Ga0111539_10446675 | 3300009094 | Bacteria | 1506 |
| 76 | Ga0111539_11317506 | 3300009094 | Unclassified | 838 |
| 77 | Ga0105245_10228710 | 3300009098 | Bacteria | 1798 |
| 78 | Ga0105245_10277907 | 3300009098 | Bacteria | 1636 |
| 79 | Ga0105245_10321848 | 3300009098 | Bacteria | 1524 |
| 80 | Ga0105245_10339556 | 3300009098 | Unclassified | 1485 |
| 81 | Ga0105245_10672264 | 3300009098 | Bacteria | 1067 |
| 82 | Ga0105245_11167014 | 3300009098 | Bacteria | 817 |
| 83 | Ga0105245_11223310 | 3300009098 | Bacteria | 799 |
| 84 | Ga0105245_11418239 | 3300009098 | Unclassified | 745 |
| 85 | Ga0105245_13028660 | 3300009098 | Bacteria | 521 |
| 86 | Ga0114129_11069792 | 3300009147 | Bacteria | 1012 |
| 87 | Ga0114129_12522409 | 3300009147 | Unclassified | 614 |
| 88 | Ga0114129_12961292 | 3300009147 | Unclassified | 560 |
| 89 | Ga0114129_13032250 | 3300009147 | Unclassified | 551 |
| 90 | Ga0105243_10118662 | 3300009148 | Bacteria | 2226 |
| 91 | Ga0105243_11482368 | 3300009148 | Bacteria | 702 |
| 92 | Ga0105243_12879833 | 3300009148 | Bacteria | 521 |
| 93 | Ga0105241_11495785 | 3300009174 | Bacteria | 650 |
| 94 | Ga0105242_10426011 | 3300009176 | Bacteria | 1245 |
| 95 | Ga0105248_10548711 | 3300009177 | Bacteria | 1304 |
| 96 | Ga0105238_12037760 | 3300009551 | Unclassified | 608 |
| 97 | Ga0105249_10745970 | 3300009553 | Bacteria | 1041 |
| 98 | Ga0105249_10782220 | 3300009553 | Bacteria | 1018 |
| 99 | Ga0105249_11595926 | 3300009553 | Bacteria | 725 |
| 100 | Ga0105249_12057253 | 3300009553 | Unclassified | 644 |
| 101 | Ga0105249_12214551 | 3300009553 | Bacteria | 622 |
| 102 | Ga0105239_10120038 | 3300010375 | Bacteria | 2919 |
| 103 | Ga0105239_11269542 | 3300010375 | Bacteria | 849 |
| 104 | Ga0105239_11355608 | 3300010375 | Bacteria | 821 |
| 105 | Ga0105246_10187922 | 3300011119 | Bacteria | 1596 |
| 106 | Ga0105246_11334937 | 3300011119 | Bacteria | 666 |
| 107 | Ga0105246_11698039 | 3300011119 | Bacteria | 600 |
| 108 | Ga0105246_11977497 | 3300011119 | Unclassified | 562 |
| 109 | Ga0105246_12504603 | 3300011119 | Bacteria | 508 |
| 110 | Ga0157374_11329653 | 3300013296 | Bacteria | 741 |
| 111 | Ga0157378_10536399 | 3300013297 | Bacteria | 1174 |
| 112 | Ga0163162_11119919 | 3300013306 | Unclassified | 892 |
| 113 | Ga0163162_12021802 | 3300013306 | Bacteria | 660 |
| 114 | Ga0163162_12179901 | 3300013306 | Bacteria | 636 |
| 115 | Ga0157372_11841298 | 3300013307 | Bacteria | 696 |
| 116 | Ga0157372_12267019 | 3300013307 | Bacteria | 624 |
| 117 | Ga0157375_10429088 | 3300013308 | Bacteria | 1488 |
| 118 | Ga0157375_11428318 | 3300013308 | Bacteria | 815 |
| 119 | Ga0157375_11517082 | 3300013308 | Bacteria | 791 |
| 120 | Ga0163163_10147042 | 3300014325 | Bacteria | 2401 |
| 121 | Ga0163163_13084683 | 3300014325 | Bacteria | 520 |
| 122 | Ga0157380_11915895 | 3300014326 | Bacteria | 653 |
| 123 | Ga0157377_10833525 | 3300014745 | Bacteria | 683 |
| 124 | Ga0157379_10779868 | 3300014968 | Bacteria | 901 |
| 125 | Ga0157379_11957260 | 3300014968 | Bacteria | 578 |
| 126 | Ga0157376_12544797 | 3300014969 | Unclassified | 552 |
| 127 | Ga0163161_10614052 | 3300017792 | Bacteria | 898 |
| 128 | Ga0163161_11936349 | 3300017792 | Bacteria | 524 |
| 129 | Ga0213875_10081184 | 3300021388 | Unclassified | 1513 |
| 130 | Ga0207426_1054973 | 3300025302 | Unclassified | 1168 |
| 131 | Ga0207688_10273968 | 3300025901 | Bacteria | 1027 |
| 132 | Ga0207699_10224796 | 3300025906 | Bacteria | 1283 |
| 133 | Ga0207693_11108776 | 3300025915 | Bacteria | 601 |
| 134 | Ga0207660_11604621 | 3300025917 | Bacteria | 524 |
| 135 | Ga0207660_11720701 | 3300025917 | Unclassified | 504 |
| 136 | Ga0207649_10184993 | 3300025920 | Bacteria | 1461 |
| 137 | Ga0207659_11136587 | 3300025926 | Bacteria | 672 |
| 138 | Ga0207687_10321993 | 3300025927 | Bacteria | 1252 |
| 139 | Ga0207687_10649313 | 3300025927 | Bacteria | 892 |
| 140 | Ga0207687_10833978 | 3300025927 | Bacteria | 787 |
| 141 | Ga0207687_11341291 | 3300025927 | Bacteria | 615 |
| 142 | Ga0207700_10399631 | 3300025928 | Bacteria | 1204 |
| 143 | Ga0207664_10022885 | 3300025929 | Bacteria | 4674 |
| 144 | Ga0207664_10287673 | 3300025929 | Unclassified | 1444 |
| 145 | Ga0207690_11762853 | 3300025932 | Bacteria | 517 |
| 146 | Ga0207706_10143195 | 3300025933 | Bacteria | 2103 |
| 147 | Ga0207706_11554893 | 3300025933 | Unclassified | 537 |
| 148 | Ga0207686_10995871 | 3300025934 | Bacteria | 680 |
| 149 | Ga0207709_10238963 | 3300025935 | Bacteria | 1320 |
| 150 | Ga0207709_10395132 | 3300025935 | Unclassified | 1056 |
| 151 | Ga0207670_11089704 | 3300025936 | Bacteria | 674 |
| 152 | Ga0207704_10297170 | 3300025938 | Bacteria | 1235 |
| 153 | Ga0207704_10421344 | 3300025938 | Bacteria | 1058 |
| 154 | Ga0207691_10680676 | 3300025940 | Unclassified | 868 |
| 155 | Ga0207691_10867019 | 3300025940 | Bacteria | 757 |
| 156 | Ga0207689_11481447 | 3300025942 | Bacteria | 567 |
| 157 | Ga0207661_10546654 | 3300025944 | Bacteria | 1061 |
| 158 | Ga0207661_11714030 | 3300025944 | Bacteria | 574 |
| 159 | Ga0207679_11048335 | 3300025945 | Bacteria | 748 |
| 160 | Ga0207679_11510901 | 3300025945 | Bacteria | 616 |
| 161 | Ga0207679_11542290 | 3300025945 | Unclassified | 609 |
| 162 | Ga0207651_11788383 | 3300025960 | Bacteria | 553 |
| 163 | Ga0207712_10859521 | 3300025961 | Bacteria | 800 |
| 164 | Ga0207712_11326940 | 3300025961 | Bacteria | 643 |
| 165 | Ga0207712_11469310 | 3300025961 | Bacteria | 610 |
| 166 | Ga0207668_10321668 | 3300025972 | Unclassified | 1284 |
| 167 | Ga0207668_10601261 | 3300025972 | Bacteria | 958 |
| 168 | Ga0207677_10608073 | 3300026023 | Bacteria | 960 |
| 169 | Ga0207677_11891393 | 3300026023 | Bacteria | 554 |
| 170 | Ga0207677_12115113 | 3300026023 | Bacteria | 523 |
| 171 | Ga0207678_10433948 | 3300026067 | Bacteria | 1140 |
| 172 | Ga0207708_10106696 | 3300026075 | Bacteria | 2172 |
| 173 | Ga0207702_10119094 | 3300026078 | Bacteria | 2360 |
| 174 | Ga0207648_10145034 | 3300026089 | Bacteria | 2094 |
| 175 | Ga0207648_11267365 | 3300026089 | Bacteria | 693 |
| 176 | Ga0207648_11911068 | 3300026089 | Bacteria | 555 |
| 177 | Ga0207648_12010886 | 3300026089 | Unclassified | 539 |
| 178 | Ga0207676_10211476 | 3300026095 | Bacteria | 1721 |
| 179 | Ga0207676_10610495 | 3300026095 | Bacteria | 1049 |
| 180 | Ga0207675_100652142 | 3300026118 | Bacteria | 1059 |
| 181 | Ga0207675_101650383 | 3300026118 | Bacteria | 661 |
| 182 | Ga0207683_11329042 | 3300026121 | Bacteria | 665 |
| 183 | Ga0207683_11846749 | 3300026121 | Unclassified | 553 |
| 184 | Ga0207698_10373751 | 3300026142 | Bacteria | 1354 |
| 185 | Ga0209970_1035582 | 3300027614 | Bacteria | 875 |
| 186 | Ga0209983_1039484 | 3300027665 | Bacteria | 1020 |
| 187 | Ga0209974_10300482 | 3300027876 | Unclassified | 614 |
| 188 | Ga0207428_10744103 | 3300027907 | Bacteria | 699 |
| 189 | Ga0265326_10185401 | 3300028558 | Bacteria | 596 |
| 190 | Ga0265334_10266231 | 3300028573 | Bacteria | 589 |
| 191 | Ga0265323_10127157 | 3300028653 | Bacteria | 827 |
| 192 | Ga0265330_10058981 | 3300031235 | Bacteria | 1672 |
| 193 | Ga0265328_10226237 | 3300031239 | Unclassified | 713 |
| 194 | Ga0265320_10482135 | 3300031240 | Bacteria | 548 |
| 195 | Ga0265329_10040783 | 3300031242 | Bacteria | 1490 |
| 196 | Ga0265331_10184555 | 3300031250 | Bacteria | 942 |
| 197 | Ga0265316_10400511 | 3300031344 | Bacteria | 988 |
| 198 | Ga0265314_10475244 | 3300031711 | Unclassified | 662 |
| 199 | Ga0265342_10026471 | 3300031712 | Bacteria | 3634 |
| 200 | Ga0307410_11043191 | 3300031852 | Bacteria | 707 |
| 201 | Ga0307407_11648646 | 3300031903 | Bacteria | 510 |
| 202 | Ga0307409_101718953 | 3300031995 | Bacteria | 656 |
| 203 | Ga0307414_10330741 | 3300032004 | Bacteria | 1301 |
| 204 | Ga0307415_102092580 | 3300032126 | Bacteria | 552 |
| 205 | Ga0373931_0581700 | 3300035691 | Unclassified | 730 |
| 206 | Ga0436364_1308319 | 3300037853 | Bacteria | 2612 |
| 207 | Ga0436365_1598048 | 3300039437 | Bacteria | 1003 |
| 208 | Ga0439459_0039290 | 3300042438 | Bacteria | 999 |
| 209 | Ga0466963_0080225 | 3300044694 | Bacteria | 2209 |
| 210 | Ga0466963_0772879 | 3300044694 | Unclassified | 677 |
| 211 | Ga0466964_0106304 | 3300044706 | Bacteria | 1245 |
| 212 | Ga0466971_0595586 | 3300044719 | Unclassified | 551 |
| 213 | Ga0466957_0054816 | 3300044842 | Bacteria | 2435 |
| 214 | Ga0466960_0301525 | 3300044901 | Bacteria | 903 |
| 215 | Ga0466959_0097778 | 3300045049 | Bacteria | 2103 |
| 216 | Ga0466959_0131602 | 3300045049 | Bacteria | 1773 |
| 217 | Ga0466958_0098414 | 3300045836 | Bacteria | 1816 |
| 218 | Ga0466958_0261037 | 3300045836 | Unclassified | 1109 |
| 219 | Ga0466967_0328301 | 3300045976 | Bacteria | 1477 |
| 220 | Ga0466967_0597726 | 3300045976 | Bacteria | 1089 |
| 221 | Ga0466967_0636709 | 3300045976 | Bacteria | 1054 |
| 222 | Ga0466967_0979848 | 3300045976 | Bacteria | 842 |
| 223 | Ga0466967_1355670 | 3300045976 | Bacteria | 708 |
| 224 | Ga0466967_1778607 | 3300045976 | Bacteria | 613 |
| 225 | Ga0466967_2369132 | 3300045976 | Bacteria | 526 |
| 226 | Ga0495582_0421769 | 3300046473 | Bacteria | 770 |
| 227 | Ga0495662_0066504 | 3300046476 | Bacteria | 1744 |
| 228 | Ga0495596_0237190 | 3300046500 | Unclassified | 708 |
| 229 | Ga0495608_0121504 | 3300046511 | Bacteria | 1675 |
| 230 | Ga0495620_0078547 | 3300046515 | Archaea | 1338 |
| 231 | Ga0495630_0448781 | 3300046517 | Unclassified | 988 |
| 232 | Ga0495644_0137926 | 3300046523 | Bacteria | 931 |
| 233 | Ga0495663_0180370 | 3300046525 | Unclassified | 731 |
| 234 | Ga0495652_0584289 | 3300046529 | Bacteria | 764 |
| 235 | Ga0495640_0073254 | 3300046533 | Bacteria | 2293 |
| 236 | Ga0495587_0469902 | 3300046536 | Bacteria | 696 |
| 237 | Ga0495587_0521847 | 3300046536 | Bacteria | 656 |
| 238 | Ga0495656_0643984 | 3300046615 | Bacteria | 569 |
| 239 | Ga0495635_0120203 | 3300046663 | Bacteria | 1792 |
| 240 | Ga0495588_0384627 | 3300046674 | Unclassified | 737 |
| 241 | Ga0495599_0708390 | 3300046678 | Bacteria | 580 |
| 242 | Ga0495624_0444724 | 3300046690 | Unclassified | 777 |
| 243 | Ga0495604_0778681 | 3300047317 | Bacteria | 604 |
| 244 | Ga0495674_0245540 | 3300047319 | Bacteria | 1474 |
| 245 | Ga0495680_0123218 | 3300047322 | Bacteria | 1912 |
| 246 | Ga0496100_0754509 | 3300048903 | Unclassified | 761 |
| 247 | Ga0496100_1203601 | 3300048903 | Unclassified | 598 |
| 248 | Ga0496102_0199177 | 3300048905 | Bacteria | 1888 |
| 249 | Ga0496102_0576542 | 3300048905 | Bacteria | 1048 |
| 250 | Ga0496104_0805156 | 3300048907 | Bacteria | 846 |
| 251 | Ga0496104_1832979 | 3300048907 | Bacteria | 509 |
| 252 | Ga0496105_0216208 | 3300048908 | Bacteria | 1561 |
| 253 | Ga0496107_0651258 | 3300048910 | Bacteria | 777 |
| 254 | Ga0496108_1336665 | 3300048911 | Bacteria | 602 |
| 255 | Ga0496109_0034063 | 3300048912 | Bacteria | 4584 |
| 256 | Ga0496109_0352296 | 3300048912 | Bacteria | 1391 |
| 257 | Ga0496109_1826349 | 3300048912 | Bacteria | 541 |
| 258 | Ga0496110_0930544 | 3300048913 | Bacteria | 776 |
| 259 | Ga0496110_0995049 | 3300048913 | Unclassified | 746 |
| 260 | Ga0496110_1530204 | 3300048913 | Bacteria | 577 |
| 261 | Ga0496111_0350014 | 3300048914 | Bacteria | 1094 |
| 262 | Ga0496111_0366129 | 3300048914 | Bacteria | 1067 |
| 263 | Ga0496112_1016550 | 3300048915 | Bacteria | 749 |
| 264 | Ga0496112_1021448 | 3300048915 | Bacteria | 746 |
| 265 | Ga0496114_0716418 | 3300048917 | Bacteria | 877 |
| 266 | Ga0496126_0006909 | 3300048929 | Bacteria | 12569 |
| 267 | Ga0501076_0096071 | 3300049592 | Bacteria | 2387 |
| 268 | nmdc:mga05p37_1403006_c1 | 3300050507 | Unclassified | 703 |
| 269 | nmdc:mga05p37_1559938_c1 | 3300050507 | Bacteria | 653 |
| 270 | nmdc:mga06r32_1346111_c1 | 3300050510 | Bacteria | 657 |
| 271 | nmdc:mga08y16_239170_c1 | 3300050511 | Bacteria | 1877 |
| 272 | nmdc:mga08y16_479714_c1 | 3300050511 | Bacteria | 1265 |
| 273 | nmdc:mga0n895_323249_c2 | 3300050512 | Unclassified | 776 |
| 274 | nmdc:mga0n895_75733_c1 | 3300050512 | Bacteria | 3345 |
| 275 | nmdc:mga0rr50_1021907_c1 | 3300050513 | Bacteria | 704 |
| 276 | nmdc:mga0rr50_1769734_c1 | 3300050513 | Bacteria | 520 |
| 277 | nmdc:mga0a205_510158_c1 | 3300050515 | Unclassified | 1059 |
| 278 | Ga0495601_0060586 | 3300053077 | Bacteria | 2401 |
| 279 | Ga0495619_0219958 | 3300053085 | Bacteria | 1315 |
| 280 | Ga0495619_1096429 | 3300053085 | Bacteria | 530 |
| 281 | Ga0466962_0140902 | 3300061719 | Unclassified | 1168 |
| 282 | Ga0466962_0345716 | 3300061719 | Bacteria | 740 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_11355608 | Ga0105239_113556081 | 57 |
| 2 | 3300032004 | Ga0307414_10330741 | Ga0307414_103307412 | 57 |
| 3 | 3300005618 | Ga0068864_100616977 | Ga0068864_1006169771 | 58 |
| 4 | 3300026095 | Ga0207676_10610495 | Ga0207676_106104952 | 58 |
| 5 | 3300048912 | Ga0496109_0034063 | Ga0496109_0034063_2081_2293 | 58 |
| 6 | 3300025917 | Ga0207660_11720701 | Ga0207660_117207012 | 64 |
| 7 | 3300005336 | Ga0070680_101664541 | Ga0070680_1016645412 | 68 |
| 8 | 3300005435 | Ga0070714_100763968 | Ga0070714_1007639682 | 68 |
| 9 | 3300005436 | Ga0070713_101657561 | Ga0070713_1016575612 | 68 |
| 10 | 3300006038 | Ga0075365_10035119 | Ga0075365_100351193 | 68 |
| 11 | 3300021388 | Ga0213875_10081184 | Ga0213875_100811842 | 68 |
| 12 | 3300025929 | Ga0207664_10287673 | Ga0207664_102876732 | 68 |
| 13 | 3300031995 | Ga0307409_101718953 | Ga0307409_1017189532 | 68 |
| 14 | 3300032126 | Ga0307415_102092580 | Ga0307415_1020925802 | 68 |
| 15 | 3300037853 | Ga0436364_1308319 | Ga0436364_1308319_230_436 | 68 |
| 16 | 3300039437 | Ga0436365_1598048 | Ga0436365_1598048_269_475 | 68 |
| 17 | 3300044842 | Ga0466957_0054816 | Ga0466957_0054816_685_891 | 68 |
| 18 | 3300045049 | Ga0466959_0131602 | Ga0466959_0131602_192_398 | 68 |
| 19 | 3300045836 | Ga0466958_0098414 | Ga0466958_0098414_898_1104 | 68 |
| 20 | 3300045976 | Ga0466967_1355670 | Ga0466967_1355670_160_366 | 68 |
| 21 | 3300046523 | Ga0495644_0137926 | Ga0495644_0137926_93_299 | 68 |
| 22 | 3300046525 | Ga0495663_0180370 | Ga0495663_0180370_355_561 | 68 |
| 23 | 3300046615 | Ga0495656_0643984 | Ga0495656_0643984_114_320 | 68 |
| 24 | 3300053085 | Ga0495619_1096429 | Ga0495619_1096429_301_510 | 68 |
| 25 | 3300061719 | Ga0466962_0345716 | Ga0466962_0345716_318_524 | 68 |
| 26 | 3300005327 | Ga0070658_10641984 | Ga0070658_106419842 | 69 |
| 27 | 3300005328 | Ga0070676_10270098 | Ga0070676_102700981 | 69 |
| 28 | 3300005329 | Ga0070683_101068502 | Ga0070683_1010685021 | 69 |
| 29 | 3300005333 | Ga0070677_10522744 | Ga0070677_105227442 | 69 |
| 30 | 3300005337 | Ga0070682_101004869 | Ga0070682_1010048691 | 69 |
| 31 | 3300005338 | Ga0068868_100574832 | Ga0068868_1005748321 | 69 |
| 32 | 3300005338 | Ga0068868_101487185 | Ga0068868_1014871852 | 69 |
| 33 | 3300005340 | Ga0070689_100081846 | Ga0070689_1000818463 | 69 |
| 34 | 3300005343 | Ga0070687_100411007 | Ga0070687_1004110072 | 69 |
| 35 | 3300005344 | Ga0070661_100232910 | Ga0070661_1002329102 | 69 |
| 36 | 3300005344 | Ga0070661_101159600 | Ga0070661_1011596002 | 69 |
| 37 | 3300005347 | Ga0070668_100149726 | Ga0070668_1001497263 | 69 |
| 38 | 3300005347 | Ga0070668_101775633 | Ga0070668_1017756331 | 69 |
| 39 | 3300005353 | Ga0070669_100525789 | Ga0070669_1005257892 | 69 |
| 40 | 3300005364 | Ga0070673_100975595 | Ga0070673_1009755952 | 69 |
| 41 | 3300005365 | Ga0070688_100613334 | Ga0070688_1006133342 | 69 |
| 42 | 3300005366 | Ga0070659_100538365 | Ga0070659_1005383652 | 69 |
| 43 | 3300005367 | Ga0070667_102247880 | Ga0070667_1022478801 | 69 |
| 44 | 3300005434 | Ga0070709_10194722 | Ga0070709_101947222 | 69 |
| 45 | 3300005435 | Ga0070714_100105103 | Ga0070714_1001051032 | 69 |
| 46 | 3300005436 | Ga0070713_100504128 | Ga0070713_1005041282 | 69 |
| 47 | 3300005436 | Ga0070713_100951931 | Ga0070713_1009519312 | 69 |
| 48 | 3300005439 | Ga0070711_100972198 | Ga0070711_1009721981 | 69 |
| 49 | 3300005440 | Ga0070705_100230778 | Ga0070705_1002307782 | 69 |
| 50 | 3300005456 | Ga0070678_100694591 | Ga0070678_1006945912 | 69 |
| 51 | 3300005457 | Ga0070662_100184641 | Ga0070662_1001846413 | 69 |
| 52 | 3300005457 | Ga0070662_101592594 | Ga0070662_1015925941 | 69 |
| 53 | 3300005457 | Ga0070662_101687756 | Ga0070662_1016877562 | 69 |
| 54 | 3300005459 | Ga0068867_101363445 | Ga0068867_1013634452 | 69 |
| 55 | 3300005459 | Ga0068867_102367228 | Ga0068867_1023672282 | 69 |
| 56 | 3300005466 | Ga0070685_10841174 | Ga0070685_108411742 | 69 |
| 57 | 3300005535 | Ga0070684_100109324 | Ga0070684_1001093243 | 69 |
| 58 | 3300005535 | Ga0070684_100398867 | Ga0070684_1003988672 | 69 |
| 59 | 3300005544 | Ga0070686_100621404 | Ga0070686_1006214042 | 69 |
| 60 | 3300005544 | Ga0070686_101832387 | Ga0070686_1018323872 | 69 |
| 61 | 3300005546 | Ga0070696_100256303 | Ga0070696_1002563033 | 69 |
| 62 | 3300005546 | Ga0070696_100918103 | Ga0070696_1009181032 | 69 |
| 63 | 3300005547 | Ga0070693_100835605 | Ga0070693_1008356052 | 69 |
| 64 | 3300005547 | Ga0070693_101197897 | Ga0070693_1011978972 | 69 |
| 65 | 3300005564 | Ga0070664_102286656 | Ga0070664_1022866562 | 69 |
| 66 | 3300005578 | Ga0068854_100467331 | Ga0068854_1004673312 | 69 |
| 67 | 3300005614 | Ga0068856_100544516 | Ga0068856_1005445162 | 69 |
| 68 | 3300005615 | Ga0070702_100782161 | Ga0070702_1007821611 | 69 |
| 69 | 3300005616 | Ga0068852_100492841 | Ga0068852_1004928412 | 69 |
| 70 | 3300005616 | Ga0068852_102350305 | Ga0068852_1023503052 | 69 |
| 71 | 3300005618 | Ga0068864_100162188 | Ga0068864_1001621882 | 69 |
| 72 | 3300005718 | Ga0068866_10364612 | Ga0068866_103646122 | 69 |
| 73 | 3300005719 | Ga0068861_101465267 | Ga0068861_1014652672 | 69 |
| 74 | 3300005841 | Ga0068863_101901016 | Ga0068863_1019010162 | 69 |
| 75 | 3300005842 | Ga0068858_102602114 | Ga0068858_1026021141 | 69 |
| 76 | 3300005844 | Ga0068862_100916790 | Ga0068862_1009167902 | 69 |
| 77 | 3300005981 | Ga0081538_10115704 | Ga0081538_101157042 | 69 |
| 78 | 3300006175 | Ga0070712_100089621 | Ga0070712_1000896213 | 69 |
| 79 | 3300006237 | Ga0097621_100484698 | Ga0097621_1004846982 | 69 |
| 80 | 3300006237 | Ga0097621_101499337 | Ga0097621_1014993372 | 69 |
| 81 | 3300006358 | Ga0068871_101355915 | Ga0068871_1013559151 | 69 |
| 82 | 3300006844 | Ga0075428_101099020 | Ga0075428_1010990202 | 69 |
| 83 | 3300006844 | Ga0075428_101210257 | Ga0075428_1012102572 | 69 |
| 84 | 3300006847 | Ga0075431_101392836 | Ga0075431_1013928362 | 69 |
| 85 | 3300006852 | Ga0075433_10200158 | Ga0075433_102001583 | 69 |
| 86 | 3300006871 | Ga0075434_100165331 | Ga0075434_1001653313 | 69 |
| 87 | 3300006871 | Ga0075434_100383556 | Ga0075434_1003835562 | 69 |
| 88 | 3300006881 | Ga0068865_100476947 | Ga0068865_1004769472 | 69 |
| 89 | 3300006881 | Ga0068865_100724876 | Ga0068865_1007248763 | 69 |
| 90 | 3300006881 | Ga0068865_100802029 | Ga0068865_1008020292 | 69 |
| 91 | 3300007076 | Ga0075435_100277317 | Ga0075435_1002773171 | 69 |
| 92 | 3300007076 | Ga0075435_101072429 | Ga0075435_1010724292 | 69 |
| 93 | 3300007076 | Ga0075435_101577425 | Ga0075435_1015774252 | 69 |
| 94 | 3300009094 | Ga0111539_10409906 | Ga0111539_104099061 | 69 |
| 95 | 3300009094 | Ga0111539_10446675 | Ga0111539_104466753 | 69 |
| 96 | 3300009094 | Ga0111539_11317506 | Ga0111539_113175062 | 69 |
| 97 | 3300009098 | Ga0105245_10228710 | Ga0105245_102287104 | 69 |
| 98 | 3300009098 | Ga0105245_10277907 | Ga0105245_102779072 | 69 |
| 99 | 3300009098 | Ga0105245_10321848 | Ga0105245_103218482 | 69 |
| 100 | 3300009098 | Ga0105245_10339556 | Ga0105245_103395563 | 69 |
| 101 | 3300009098 | Ga0105245_10672264 | Ga0105245_106722642 | 69 |
| 102 | 3300009098 | Ga0105245_11167014 | Ga0105245_111670142 | 69 |
| 103 | 3300009098 | Ga0105245_11223310 | Ga0105245_112233102 | 69 |
| 104 | 3300009098 | Ga0105245_11418239 | Ga0105245_114182391 | 69 |
| 105 | 3300009098 | Ga0105245_13028660 | Ga0105245_130286602 | 69 |
| 106 | 3300009147 | Ga0114129_11069792 | Ga0114129_110697922 | 69 |
| 107 | 3300009147 | Ga0114129_12522409 | Ga0114129_125224092 | 69 |
| 108 | 3300009147 | Ga0114129_12961292 | Ga0114129_129612922 | 69 |
| 109 | 3300009147 | Ga0114129_13032250 | Ga0114129_130322502 | 69 |
| 110 | 3300009148 | Ga0105243_10118662 | Ga0105243_101186622 | 69 |
| 111 | 3300009148 | Ga0105243_11482368 | Ga0105243_114823682 | 69 |
| 112 | 3300009148 | Ga0105243_12879833 | Ga0105243_128798332 | 69 |
| 113 | 3300009174 | Ga0105241_11495785 | Ga0105241_114957851 | 69 |
| 114 | 3300009176 | Ga0105242_10426011 | Ga0105242_104260111 | 69 |
| 115 | 3300009177 | Ga0105248_10548711 | Ga0105248_105487112 | 69 |
| 116 | 3300009551 | Ga0105238_12037760 | Ga0105238_120377601 | 69 |
| 117 | 3300009553 | Ga0105249_10745970 | Ga0105249_107459702 | 69 |
| 118 | 3300009553 | Ga0105249_10782220 | Ga0105249_107822202 | 69 |
| 119 | 3300009553 | Ga0105249_11595926 | Ga0105249_115959262 | 69 |
| 120 | 3300009553 | Ga0105249_12057253 | Ga0105249_120572532 | 69 |
| 121 | 3300009553 | Ga0105249_12214551 | Ga0105249_122145512 | 69 |
| 122 | 3300010375 | Ga0105239_10120038 | Ga0105239_101200382 | 69 |
| 123 | 3300010375 | Ga0105239_11269542 | Ga0105239_112695422 | 69 |
| 124 | 3300011119 | Ga0105246_10187922 | Ga0105246_101879223 | 69 |
| 125 | 3300011119 | Ga0105246_11334937 | Ga0105246_113349372 | 69 |
| 126 | 3300011119 | Ga0105246_11698039 | Ga0105246_116980392 | 69 |
| 127 | 3300011119 | Ga0105246_11977497 | Ga0105246_119774972 | 69 |
| 128 | 3300011119 | Ga0105246_12504603 | Ga0105246_125046031 | 69 |
| 129 | 3300013296 | Ga0157374_11329653 | Ga0157374_113296532 | 69 |
| 130 | 3300013297 | Ga0157378_10536399 | Ga0157378_105363992 | 69 |
| 131 | 3300013306 | Ga0163162_11119919 | Ga0163162_111199192 | 69 |
| 132 | 3300013306 | Ga0163162_12021802 | Ga0163162_120218021 | 69 |
| 133 | 3300013306 | Ga0163162_12179901 | Ga0163162_121799012 | 69 |
| 134 | 3300013307 | Ga0157372_11841298 | Ga0157372_118412982 | 69 |
| 135 | 3300013307 | Ga0157372_12267019 | Ga0157372_122670192 | 69 |
| 136 | 3300013308 | Ga0157375_10429088 | Ga0157375_104290882 | 69 |
| 137 | 3300013308 | Ga0157375_11428318 | Ga0157375_114283181 | 69 |
| 138 | 3300013308 | Ga0157375_11517082 | Ga0157375_115170822 | 69 |
| 139 | 3300014325 | Ga0163163_10147042 | Ga0163163_101470423 | 69 |
| 140 | 3300014325 | Ga0163163_13084683 | Ga0163163_130846831 | 69 |
| 141 | 3300014326 | Ga0157380_11915895 | Ga0157380_119158952 | 69 |
| 142 | 3300014745 | Ga0157377_10833525 | Ga0157377_108335251 | 69 |
| 143 | 3300014968 | Ga0157379_10779868 | Ga0157379_107798682 | 69 |
| 144 | 3300014968 | Ga0157379_11957260 | Ga0157379_119572602 | 69 |
| 145 | 3300014969 | Ga0157376_12544797 | Ga0157376_125447972 | 69 |
| 146 | 3300017792 | Ga0163161_10614052 | Ga0163161_106140522 | 69 |
| 147 | 3300017792 | Ga0163161_11936349 | Ga0163161_119363492 | 69 |
| 148 | 3300025302 | Ga0207426_1054973 | Ga0207426_10549732 | 69 |
| 149 | 3300025901 | Ga0207688_10273968 | Ga0207688_102739682 | 69 |
| 150 | 3300025906 | Ga0207699_10224796 | Ga0207699_102247962 | 69 |
| 151 | 3300025915 | Ga0207693_11108776 | Ga0207693_111087762 | 69 |
| 152 | 3300025917 | Ga0207660_11604621 | Ga0207660_116046212 | 69 |
| 153 | 3300025920 | Ga0207649_10184993 | Ga0207649_101849932 | 69 |
| 154 | 3300025926 | Ga0207659_11136587 | Ga0207659_111365871 | 69 |
| 155 | 3300025927 | Ga0207687_10321993 | Ga0207687_103219932 | 69 |
| 156 | 3300025927 | Ga0207687_10649313 | Ga0207687_106493132 | 69 |
| 157 | 3300025927 | Ga0207687_10833978 | Ga0207687_108339781 | 69 |
| 158 | 3300025927 | Ga0207687_11341291 | Ga0207687_113412911 | 69 |
| 159 | 3300025928 | Ga0207700_10399631 | Ga0207700_103996312 | 69 |
| 160 | 3300025929 | Ga0207664_10022885 | Ga0207664_100228856 | 69 |
| 161 | 3300025932 | Ga0207690_11762853 | Ga0207690_117628532 | 69 |
| 162 | 3300025933 | Ga0207706_10143195 | Ga0207706_101431952 | 69 |
| 163 | 3300025933 | Ga0207706_11554893 | Ga0207706_115548931 | 69 |
| 164 | 3300025934 | Ga0207686_10995871 | Ga0207686_109958712 | 69 |
| 165 | 3300025935 | Ga0207709_10238963 | Ga0207709_102389632 | 69 |
| 166 | 3300025935 | Ga0207709_10395132 | Ga0207709_103951323 | 69 |
| 167 | 3300025936 | Ga0207670_11089704 | Ga0207670_110897042 | 69 |
| 168 | 3300025938 | Ga0207704_10297170 | Ga0207704_102971702 | 69 |
| 169 | 3300025938 | Ga0207704_10421344 | Ga0207704_104213442 | 69 |
| 170 | 3300025940 | Ga0207691_10680676 | Ga0207691_106806762 | 69 |
| 171 | 3300025940 | Ga0207691_10867019 | Ga0207691_108670192 | 69 |
| 172 | 3300025942 | Ga0207689_11481447 | Ga0207689_114814472 | 69 |
| 173 | 3300025944 | Ga0207661_10546654 | Ga0207661_105466542 | 69 |
| 174 | 3300025944 | Ga0207661_11714030 | Ga0207661_117140302 | 69 |
| 175 | 3300025945 | Ga0207679_11048335 | Ga0207679_110483352 | 69 |
| 176 | 3300025945 | Ga0207679_11510901 | Ga0207679_115109012 | 69 |
| 177 | 3300025945 | Ga0207679_11542290 | Ga0207679_115422902 | 69 |
| 178 | 3300025960 | Ga0207651_11788383 | Ga0207651_117883832 | 69 |
| 179 | 3300025961 | Ga0207712_10859521 | Ga0207712_108595212 | 69 |
| 180 | 3300025961 | Ga0207712_11326940 | Ga0207712_113269401 | 69 |
| 181 | 3300025961 | Ga0207712_11469310 | Ga0207712_114693101 | 69 |
| 182 | 3300025972 | Ga0207668_10321668 | Ga0207668_103216682 | 69 |
| 183 | 3300025972 | Ga0207668_10601261 | Ga0207668_106012612 | 69 |
| 184 | 3300026023 | Ga0207677_10608073 | Ga0207677_106080732 | 69 |
| 185 | 3300026023 | Ga0207677_11891393 | Ga0207677_118913932 | 69 |
| 186 | 3300026023 | Ga0207677_12115113 | Ga0207677_121151132 | 69 |
| 187 | 3300026067 | Ga0207678_10433948 | Ga0207678_104339482 | 69 |
| 188 | 3300026075 | Ga0207708_10106696 | Ga0207708_101066963 | 69 |
| 189 | 3300026078 | Ga0207702_10119094 | Ga0207702_101190943 | 69 |
| 190 | 3300026089 | Ga0207648_10145034 | Ga0207648_101450342 | 69 |
| 191 | 3300026089 | Ga0207648_11267365 | Ga0207648_112673652 | 69 |
| 192 | 3300026089 | Ga0207648_11911068 | Ga0207648_119110681 | 69 |
| 193 | 3300026089 | Ga0207648_12010886 | Ga0207648_120108862 | 69 |
| 194 | 3300026095 | Ga0207676_10211476 | Ga0207676_102114763 | 69 |
| 195 | 3300026118 | Ga0207675_100652142 | Ga0207675_1006521423 | 69 |
| 196 | 3300026118 | Ga0207675_101650383 | Ga0207675_1016503831 | 69 |
| 197 | 3300026121 | Ga0207683_11329042 | Ga0207683_113290421 | 69 |
| 198 | 3300026121 | Ga0207683_11846749 | Ga0207683_118467492 | 69 |
| 199 | 3300026142 | Ga0207698_10373751 | Ga0207698_103737513 | 69 |
| 200 | 3300027614 | Ga0209970_1035582 | Ga0209970_10355822 | 69 |
| 201 | 3300027665 | Ga0209983_1039484 | Ga0209983_10394842 | 69 |
| 202 | 3300027876 | Ga0209974_10300482 | Ga0209974_103004821 | 69 |
| 203 | 3300027907 | Ga0207428_10744103 | Ga0207428_107441032 | 69 |
| 204 | 3300028558 | Ga0265326_10185401 | Ga0265326_101854012 | 69 |
| 205 | 3300028573 | Ga0265334_10266231 | Ga0265334_102662311 | 69 |
| 206 | 3300028653 | Ga0265323_10127157 | Ga0265323_101271572 | 69 |
| 207 | 3300031235 | Ga0265330_10058981 | Ga0265330_100589812 | 69 |
| 208 | 3300031239 | Ga0265328_10226237 | Ga0265328_102262372 | 69 |
| 209 | 3300031240 | Ga0265320_10482135 | Ga0265320_104821351 | 69 |
| 210 | 3300031242 | Ga0265329_10040783 | Ga0265329_100407832 | 69 |
| 211 | 3300031250 | Ga0265331_10184555 | Ga0265331_101845552 | 69 |
| 212 | 3300031344 | Ga0265316_10400511 | Ga0265316_104005112 | 69 |
| 213 | 3300031711 | Ga0265314_10475244 | Ga0265314_104752442 | 69 |
| 214 | 3300031712 | Ga0265342_10026471 | Ga0265342_100264712 | 69 |
| 215 | 3300031852 | Ga0307410_11043191 | Ga0307410_110431912 | 69 |
| 216 | 3300031903 | Ga0307407_11648646 | Ga0307407_116486462 | 69 |
| 217 | 3300035691 | Ga0373931_0581700 | Ga0373931_0581700_284_496 | 69 |
| 218 | 3300042438 | Ga0439459_0039290 | Ga0439459_0039290_110_319 | 69 |
| 219 | 3300044694 | Ga0466963_0080225 | Ga0466963_0080225_983_1192 | 69 |
| 220 | 3300044694 | Ga0466963_0772879 | Ga0466963_0772879_50_259 | 69 |
| 221 | 3300044706 | Ga0466964_0106304 | Ga0466964_0106304_563_772 | 69 |
| 222 | 3300044719 | Ga0466971_0595586 | Ga0466971_0595586_46_255 | 69 |
| 223 | 3300044901 | Ga0466960_0301525 | Ga0466960_0301525_632_841 | 69 |
| 224 | 3300045049 | Ga0466959_0097778 | Ga0466959_0097778_1684_1893 | 69 |
| 225 | 3300045836 | Ga0466958_0261037 | Ga0466958_0261037_546_755 | 69 |
| 226 | 3300045976 | Ga0466967_0328301 | Ga0466967_0328301_279_488 | 69 |
| 227 | 3300045976 | Ga0466967_0597726 | Ga0466967_0597726_557_766 | 69 |
| 228 | 3300045976 | Ga0466967_0636709 | Ga0466967_0636709_224_433 | 69 |
| 229 | 3300045976 | Ga0466967_0979848 | Ga0466967_0979848_444_653 | 69 |
| 230 | 3300045976 | Ga0466967_1778607 | Ga0466967_1778607_182_391 | 69 |
| 231 | 3300045976 | Ga0466967_2369132 | Ga0466967_2369132_245_454 | 69 |
| 232 | 3300046473 | Ga0495582_0421769 | Ga0495582_0421769_511_723 | 69 |
| 233 | 3300046476 | Ga0495662_0066504 | Ga0495662_0066504_633_845 | 69 |
| 234 | 3300046500 | Ga0495596_0237190 | Ga0495596_0237190_81_290 | 69 |
| 235 | 3300046511 | Ga0495608_0121504 | Ga0495608_0121504_962_1174 | 69 |
| 236 | 3300046515 | Ga0495620_0078547 | Ga0495620_0078547_117_326 | 69 |
| 237 | 3300046517 | Ga0495630_0448781 | Ga0495630_0448781_744_956 | 69 |
| 238 | 3300046529 | Ga0495652_0584289 | Ga0495652_0584289_56_268 | 69 |
| 239 | 3300046533 | Ga0495640_0073254 | Ga0495640_0073254_1704_1916 | 69 |
| 240 | 3300046536 | Ga0495587_0469902 | Ga0495587_0469902_304_516 | 69 |
| 241 | 3300046536 | Ga0495587_0521847 | Ga0495587_0521847_420_632 | 69 |
| 242 | 3300046663 | Ga0495635_0120203 | Ga0495635_0120203_520_732 | 69 |
| 243 | 3300046674 | Ga0495588_0384627 | Ga0495588_0384627_416_628 | 69 |
| 244 | 3300046678 | Ga0495599_0708390 | Ga0495599_0708390_235_447 | 69 |
| 245 | 3300046690 | Ga0495624_0444724 | Ga0495624_0444724_158_370 | 69 |
| 246 | 3300047317 | Ga0495604_0778681 | Ga0495604_0778681_141_353 | 69 |
| 247 | 3300047319 | Ga0495674_0245540 | Ga0495674_0245540_901_1113 | 69 |
| 248 | 3300047322 | Ga0495680_0123218 | Ga0495680_0123218_102_314 | 69 |
| 249 | 3300048903 | Ga0496100_0754509 | Ga0496100_0754509_318_530 | 69 |
| 250 | 3300048903 | Ga0496100_1203601 | Ga0496100_1203601_11_223 | 69 |
| 251 | 3300048905 | Ga0496102_0199177 | Ga0496102_0199177_14_226 | 69 |
| 252 | 3300048905 | Ga0496102_0576542 | Ga0496102_0576542_597_809 | 69 |
| 253 | 3300048907 | Ga0496104_0805156 | Ga0496104_0805156_224_436 | 69 |
| 254 | 3300048907 | Ga0496104_1832979 | Ga0496104_1832979_182_394 | 69 |
| 255 | 3300048908 | Ga0496105_0216208 | Ga0496105_0216208_440_652 | 69 |
| 256 | 3300048910 | Ga0496107_0651258 | Ga0496107_0651258_555_767 | 69 |
| 257 | 3300048911 | Ga0496108_1336665 | Ga0496108_1336665_251_463 | 69 |
| 258 | 3300048912 | Ga0496109_0352296 | Ga0496109_0352296_816_1025 | 69 |
| 259 | 3300048912 | Ga0496109_1826349 | Ga0496109_1826349_189_401 | 69 |
| 260 | 3300048913 | Ga0496110_0930544 | Ga0496110_0930544_506_718 | 69 |
| 261 | 3300048913 | Ga0496110_0995049 | Ga0496110_0995049_261_470 | 69 |
| 262 | 3300048913 | Ga0496110_1530204 | Ga0496110_1530204_209_421 | 69 |
| 263 | 3300048914 | Ga0496111_0350014 | Ga0496111_0350014_169_378 | 69 |
| 264 | 3300048914 | Ga0496111_0366129 | Ga0496111_0366129_491_703 | 69 |
| 265 | 3300048915 | Ga0496112_1016550 | Ga0496112_1016550_457_669 | 69 |
| 266 | 3300048915 | Ga0496112_1021448 | Ga0496112_1021448_445_654 | 69 |
| 267 | 3300048917 | Ga0496114_0716418 | Ga0496114_0716418_258_470 | 69 |
| 268 | 3300048929 | Ga0496126_0006909 | Ga0496126_0006909_5768_5977 | 69 |
| 269 | 3300049592 | Ga0501076_0096071 | Ga0501076_0096071_1578_1787 | 69 |
| 270 | 3300050507 | nmdc:mga05p37_1403006_c1 | nmdc:mga05p37_1403006_c1_343_555 | 69 |
| 271 | 3300050507 | nmdc:mga05p37_1559938_c1 | nmdc:mga05p37_1559938_c1_50_262 | 69 |
| 272 | 3300050510 | nmdc:mga06r32_1346111_c1 | nmdc:mga06r32_1346111_c1_109_321 | 69 |
| 273 | 3300050511 | nmdc:mga08y16_239170_c1 | nmdc:mga08y16_239170_c1_419_631 | 69 |
| 274 | 3300050511 | nmdc:mga08y16_479714_c1 | nmdc:mga08y16_479714_c1_487_699 | 69 |
| 275 | 3300050512 | nmdc:mga0n895_323249_c2 | nmdc:mga0n895_323249_c2_168_377 | 69 |
| 276 | 3300050512 | nmdc:mga0n895_75733_c1 | nmdc:mga0n895_75733_c1_407_619 | 69 |
| 277 | 3300050513 | nmdc:mga0rr50_1021907_c1 | nmdc:mga0rr50_1021907_c1_46_258 | 69 |
| 278 | 3300050513 | nmdc:mga0rr50_1769734_c1 | nmdc:mga0rr50_1769734_c1_288_500 | 69 |
| 279 | 3300050515 | nmdc:mga0a205_510158_c1 | nmdc:mga0a205_510158_c1_163_375 | 69 |
| 280 | 3300053077 | Ga0495601_0060586 | Ga0495601_0060586_757_969 | 69 |
| 281 | 3300053085 | Ga0495619_0219958 | Ga0495619_0219958_449_661 | 69 |
| 282 | 3300061719 | Ga0466962_0140902 | Ga0466962_0140902_474_683 | 69 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h9s-assembly1.cif.gz_B | molybdate bound complex of dimop domain of mode from e.coli | 0.964 | 2 | 55 |
| 1o7l-assembly1.cif.gz_B | molybdate-activated form of mode from escherichia coli | 0.9607 | 1 | 55 |
| 1o7l-assembly2.cif.gz_D | molybdate-activated form of mode from escherichia coli | 0.9581 | 1 | 55 |
| 1o7l-assembly1.cif.gz_A | molybdate-activated form of mode from escherichia coli | 0.9553 | 1 | 55 |
| 1h9m-assembly1.cif.gz_A | two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound | 0.9535 | 1 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1P8AW81_110_466_2.130.10.120 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain | 0.9698 | 13 | 39 | 2.130.10.120 |
| af_Q2G1F0_304_346_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9673 | 11 | 41 | 2.40.50.140 |
| 1h9rA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9601 | 1 | 55 | 2.40.50.100 |
| 1o7lA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9553 | 1 | 55 | 2.40.50.100 |
| af_A0A0P0VNU6_285_398_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9546 | 22 | 39 | 2.30.42.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C0QSN2-F1-model_v4 | Putative tobe domain protein | 0.9777 | 7 | 55 |
|
| AF-D7BF97-F1-model_v4 | TOBE domain protein | 0.9733 | 1 | 59 |
GO:0015689
|
| AF-A0A7M1B9T7-F1-model_v4 | Mop domain-containing protein | 0.9696 | 1 | 58 |
GO:0015689
|
| AF-A0A1W1EKG4-F1-model_v4 | TOBE | 0.9677 | 1 | 55 |
GO:0015689
|
| AF-A0A7Y4VVK9-F1-model_v4 | ABC transporter ATP-binding protein | 0.9675 | 1 | 55 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar