F384693
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 188 | 275 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1000814|Ga0055524_100081410 |
| Length | 229 |
| Sequence | MQSVLFPLLAVVAGYLIGSLSFAVIVSRLMGLSDPRSYGSGNPGATNVLRSGNKAAAILTLVFDALKGYVPVLLVLKFGAPYGLEEGTAALVGLAAFIGHLWPVFFKFVGGKGVATAAGVLLALNPWLGLAVVFRYSSLASLSAAVAAPLLQMLVWDVGPELPAIALMSLLLVWRHAANIKKLMAGTESKLGQKAAPAAAAPAVKSHRHEQSREKRDHKSSHKPKQHSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 2 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 3 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 4 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 5 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 6 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 7 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 58 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 68 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 111 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 129 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 132 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 137 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 138 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 139 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 140 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 141 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 142 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 143 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 144 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 145 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 146 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 147 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 148 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 149 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 150 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 151 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 152 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 153 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 156 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 168 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 169 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 171 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 172 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 173 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 174 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 175 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 176 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 177 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 178 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 179 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 180 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 181 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 182 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 183 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 185 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 187 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 188 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.16 |
| Metatranscriptomes | 0.35 |
| Isolates | 2.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.21 |
| Nodule | 1.42 |
| Rhizoplane | 0.35 |
| Rhizosphere | 71.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10001470 | 3300003215 | Bacteria | 14062 |
| 2 | JGI25153J46596_10003347 | 3300003215 | Bacteria | 9000 |
| 3 | rootH1_10085146 | 3300003316 | Bacteria | 3004 |
| 4 | rootL2_10001692 | 3300003322 | Bacteria | 21923 |
| 5 | rootH1_10039187 | 3300003323 | Bacteria | 2451 |
| 6 | rootH1_10065520 | 3300003323 | Bacteria | 3632 |
| 7 | rootH1_10102888 | 3300003323 | Bacteria | 5163 |
| 8 | Ga0055526_1000906 | 3300003771 | Bacteria | 22039 |
| 9 | Ga0055524_1000814 | 3300003775 | Bacteria | 20618 |
| 10 | Ga0055524_1003915 | 3300003775 | Bacteria | 7054 |
| 11 | Ga0055530_10025787 | 3300003791 | Bacteria | 1635 |
| 12 | Ga0055531_10000168 | 3300003794 | Bacteria | 73798 |
| 13 | Ga0055531_10001544 | 3300003794 | Bacteria | 16864 |
| 14 | Ga0055531_10021052 | 3300003794 | Bacteria | 2547 |
| 15 | Ga0055543_1005136 | 3300004625 | Bacteria | 3401 |
| 16 | Ga0055543_1015394 | 3300004625 | Bacteria | 1473 |
| 17 | Ga0065165_1000153 | 3300005262 | Bacteria | 120209 |
| 18 | Ga0065165_1000569 | 3300005262 | Bacteria | 54781 |
| 19 | Ga0070658_10092344 | 3300005327 | Bacteria | 2496 |
| 20 | Ga0070670_100000939 | 3300005331 | Bacteria | 22858 |
| 21 | Ga0070670_100013197 | 3300005331 | Bacteria | 7077 |
| 22 | Ga0070670_100138578 | 3300005331 | Bacteria | 2103 |
| 23 | Ga0070670_100155779 | 3300005331 | Bacteria | 1978 |
| 24 | Ga0070670_100160020 | 3300005331 | Bacteria | 1951 |
| 25 | Ga0070677_10010653 | 3300005333 | Bacteria | 3149 |
| 26 | Ga0070682_100163667 | 3300005337 | Bacteria | 1539 |
| 27 | Ga0070661_100171235 | 3300005344 | Bacteria | 1649 |
| 28 | Ga0070669_100091062 | 3300005353 | Bacteria | 2287 |
| 29 | Ga0070675_100022972 | 3300005354 | Bacteria | 4983 |
| 30 | Ga0070675_100033069 | 3300005354 | Bacteria | 4190 |
| 31 | Ga0070675_100360133 | 3300005354 | Bacteria | 1291 |
| 32 | Ga0070671_100541039 | 3300005355 | Bacteria | 1004 |
| 33 | Ga0070674_100218489 | 3300005356 | Bacteria | 1481 |
| 34 | Ga0070673_100030704 | 3300005364 | Bacteria | 4026 |
| 35 | Ga0070673_100035657 | 3300005364 | Bacteria | 3773 |
| 36 | Ga0070659_100001171 | 3300005366 | Bacteria | 19137 |
| 37 | Ga0070678_100075685 | 3300005456 | Bacteria | 2533 |
| 38 | Ga0068867_100477425 | 3300005459 | Bacteria | 1067 |
| 39 | Ga0068853_100091695 | 3300005539 | Bacteria | 2673 |
| 40 | Ga0070672_100008536 | 3300005543 | Bacteria | 7018 |
| 41 | Ga0070672_100095570 | 3300005543 | Bacteria | 2403 |
| 42 | Ga0070672_100200747 | 3300005543 | Bacteria | 1668 |
| 43 | Ga0070665_100021752 | 3300005548 | Bacteria | 6448 |
| 44 | Ga0070665_100849293 | 3300005548 | Bacteria | 926 |
| 45 | Ga0070664_100049271 | 3300005564 | Bacteria | 3562 |
| 46 | Ga0070664_100408129 | 3300005564 | Bacteria | 1243 |
| 47 | Ga0068857_100136538 | 3300005577 | Bacteria | 2214 |
| 48 | Ga0068859_100149091 | 3300005617 | Bacteria | 2415 |
| 49 | Ga0068864_100001313 | 3300005618 | Bacteria | 20690 |
| 50 | Ga0068870_10160177 | 3300005840 | Bacteria | 1334 |
| 51 | Ga0068870_10185708 | 3300005840 | Bacteria | 1251 |
| 52 | Ga0068863_100120827 | 3300005841 | Bacteria | 2498 |
| 53 | Ga0068863_100145143 | 3300005841 | Bacteria | 2269 |
| 54 | Ga0075368_10097952 | 3300006042 | Bacteria | 1203 |
| 55 | Ga0075363_100023888 | 3300006048 | Bacteria | 3103 |
| 56 | Ga0075363_100070542 | 3300006048 | Bacteria | 1898 |
| 57 | Ga0075362_10004339 | 3300006177 | Bacteria | 5080 |
| 58 | Ga0075367_10153795 | 3300006178 | Bacteria | 1428 |
| 59 | Ga0075366_10002041 | 3300006195 | Bacteria | 10246 |
| 60 | Ga0075366_10002708 | 3300006195 | Bacteria | 9145 |
| 61 | Ga0075370_10001548 | 3300006353 | Bacteria | 10068 |
| 62 | Ga0075370_10002794 | 3300006353 | Bacteria | 8184 |
| 63 | Ga0075370_10029590 | 3300006353 | Bacteria | 3051 |
| 64 | Ga0068871_100010518 | 3300006358 | Bacteria | 6758 |
| 65 | Ga0068865_100005385 | 3300006881 | Bacteria | 7754 |
| 66 | Ga0068865_100114648 | 3300006881 | Bacteria | 1994 |
| 67 | Ga0097620_100149095 | 3300006931 | Bacteria | 2415 |
| 68 | Ga0099823_1000031 | 3300006944 | Bacteria | 69036 |
| 69 | Ga0105240_10003836 | 3300009093 | Bacteria | 23255 |
| 70 | Ga0105240_10078978 | 3300009093 | Bacteria | 4051 |
| 71 | Ga0105243_10148861 | 3300009148 | Bacteria | 2006 |
| 72 | Ga0105243_10462746 | 3300009148 | Bacteria | 1193 |
| 73 | Ga0105242_10049100 | 3300009176 | Bacteria | 3433 |
| 74 | Ga0105248_10128535 | 3300009177 | Bacteria | 2858 |
| 75 | Ga0105237_10001634 | 3300009545 | Bacteria | 29121 |
| 76 | Ga0105237_10006422 | 3300009545 | Bacteria | 13044 |
| 77 | Ga0105238_10014859 | 3300009551 | Bacteria | 7877 |
| 78 | Ga0105238_10094218 | 3300009551 | Bacteria | 2982 |
| 79 | Ga0105239_10002435 | 3300010375 | Bacteria | 23714 |
| 80 | Ga0157317_1000308 | 3300012475 | Bacteria | 1901 |
| 81 | Ga0157319_1000016 | 3300012497 | Bacteria | 127256 |
| 82 | Ga0157374_10415011 | 3300013296 | Bacteria | 1344 |
| 83 | Ga0157374_10485696 | 3300013296 | Bacteria | 1239 |
| 84 | Ga0163162_10473449 | 3300013306 | Bacteria | 1384 |
| 85 | Ga0157375_10110571 | 3300013308 | Bacteria | 2845 |
| 86 | Ga0163163_10478903 | 3300014325 | Bacteria | 1306 |
| 87 | Ga0163163_10563467 | 3300014325 | Bacteria | 1202 |
| 88 | Ga0157380_10202231 | 3300014326 | Bacteria | 1763 |
| 89 | Ga0157379_10009506 | 3300014968 | Bacteria | 8467 |
| 90 | Ga0157379_10159173 | 3300014968 | Bacteria | 2038 |
| 91 | Ga0157376_10022790 | 3300014969 | Bacteria | 4889 |
| 92 | Ga0163161_10004685 | 3300017792 | Bacteria | 9509 |
| 93 | Ga0163161_10066139 | 3300017792 | Bacteria | 2639 |
| 94 | Ga0213872_10000058 | 3300021361 | Bacteria | 100531 |
| 95 | Ga0213872_10000150 | 3300021361 | Bacteria | 63730 |
| 96 | Ga0213872_10022852 | 3300021361 | Bacteria | 2877 |
| 97 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 98 | Ga0207425_1000332 | 3300025245 | Bacteria | 33095 |
| 99 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 100 | Ga0209673_1016267 | 3300025273 | Bacteria | 2790 |
| 101 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 102 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 103 | Ga0209758_1000233 | 3300025297 | Bacteria | 116640 |
| 104 | Ga0209758_1000708 | 3300025297 | Bacteria | 49463 |
| 105 | Ga0209050_1002766 | 3300025298 | Bacteria | 14090 |
| 106 | Ga0209050_1004633 | 3300025298 | Bacteria | 9174 |
| 107 | Ga0209256_1000579 | 3300025299 | Bacteria | 52079 |
| 108 | Ga0209256_1001555 | 3300025299 | Bacteria | 22789 |
| 109 | Ga0209051_1002778 | 3300025303 | Bacteria | 12067 |
| 110 | Ga0209051_1003056 | 3300025303 | Bacteria | 11318 |
| 111 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 112 | Ga0209257_1000984 | 3300025304 | Bacteria | 38671 |
| 113 | Ga0209257_1004760 | 3300025304 | Bacteria | 10135 |
| 114 | Ga0209257_1012593 | 3300025304 | Bacteria | 3887 |
| 115 | Ga0207682_10006107 | 3300025893 | Bacteria | 4869 |
| 116 | Ga0207645_10078670 | 3300025907 | Bacteria | 2113 |
| 117 | Ga0207643_10170029 | 3300025908 | Bacteria | 1315 |
| 118 | Ga0207705_10155090 | 3300025909 | Bacteria | 1718 |
| 119 | Ga0207695_10020987 | 3300025913 | Bacteria | 7463 |
| 120 | Ga0207649_10183800 | 3300025920 | Bacteria | 1465 |
| 121 | Ga0207694_10004971 | 3300025924 | Bacteria | 10292 |
| 122 | Ga0207650_10002396 | 3300025925 | Bacteria | 13054 |
| 123 | Ga0207650_10004068 | 3300025925 | Bacteria | 9996 |
| 124 | Ga0207650_10099095 | 3300025925 | Bacteria | 2240 |
| 125 | Ga0207659_10020272 | 3300025926 | Bacteria | 4393 |
| 126 | Ga0207659_10517821 | 3300025926 | Bacteria | 1011 |
| 127 | Ga0207659_10564444 | 3300025926 | Bacteria | 968 |
| 128 | Ga0207644_10420893 | 3300025931 | Bacteria | 1094 |
| 129 | Ga0207690_10002213 | 3300025932 | Bacteria | 11851 |
| 130 | Ga0207706_10066961 | 3300025933 | Bacteria | 3160 |
| 131 | Ga0207686_10045969 | 3300025934 | Bacteria | 2689 |
| 132 | Ga0207709_10296717 | 3300025935 | Bacteria | 1200 |
| 133 | Ga0207669_10407031 | 3300025937 | Bacteria | 1067 |
| 134 | Ga0207704_10295010 | 3300025938 | Bacteria | 1239 |
| 135 | Ga0207691_10009020 | 3300025940 | Bacteria | 9565 |
| 136 | Ga0207691_10127287 | 3300025940 | Bacteria | 2252 |
| 137 | Ga0207691_10133089 | 3300025940 | Bacteria | 2195 |
| 138 | Ga0207691_10243451 | 3300025940 | Bacteria | 1554 |
| 139 | Ga0207711_10026741 | 3300025941 | Bacteria | 4843 |
| 140 | Ga0207689_10086097 | 3300025942 | Bacteria | 2583 |
| 141 | Ga0207689_10659618 | 3300025942 | Bacteria | 882 |
| 142 | Ga0207679_10033418 | 3300025945 | Bacteria | 3619 |
| 143 | Ga0207679_10306737 | 3300025945 | Bacteria | 1370 |
| 144 | Ga0207651_10041808 | 3300025960 | Bacteria | 3045 |
| 145 | Ga0207651_10123618 | 3300025960 | Bacteria | 1967 |
| 146 | Ga0207640_10216789 | 3300025981 | Bacteria | 1462 |
| 147 | Ga0207658_10525989 | 3300025986 | Bacteria | 1056 |
| 148 | Ga0207677_10255727 | 3300026023 | Bacteria | 1425 |
| 149 | Ga0207703_10294336 | 3300026035 | Bacteria | 1478 |
| 150 | Ga0207639_10073981 | 3300026041 | Bacteria | 2673 |
| 151 | Ga0207678_10166846 | 3300026067 | Bacteria | 1880 |
| 152 | Ga0207648_10118292 | 3300026089 | Bacteria | 2329 |
| 153 | Ga0207676_10012947 | 3300026095 | Bacteria | 5991 |
| 154 | Ga0207676_10022460 | 3300026095 | Bacteria | 4641 |
| 155 | Ga0207676_10807750 | 3300026095 | Bacteria | 915 |
| 156 | Ga0207674_10071549 | 3300026116 | Bacteria | 3485 |
| 157 | Ga0207675_100106248 | 3300026118 | Bacteria | 2647 |
| 158 | Ga0207683_10017159 | 3300026121 | Bacteria | 6164 |
| 159 | Ga0207683_10058726 | 3300026121 | Bacteria | 3378 |
| 160 | Ga0207683_10606339 | 3300026121 | Bacteria | 1013 |
| 161 | Ga0209389_1006709 | 3300027296 | Bacteria | 10042 |
| 162 | Ga0209371_1024836 | 3300027312 | Bacteria | 1387 |
| 163 | Ga0209813_10063674 | 3300027866 | Bacteria | 1183 |
| 164 | Ga0268266_10036691 | 3300028379 | Bacteria | 4174 |
| 165 | Ga0268266_10105872 | 3300028379 | Bacteria | 2486 |
| 166 | Ga0265324_10000340 | 3300029957 | Bacteria | 34285 |
| 167 | Ga0268256_1028259 | 3300030500 | Bacteria | 1387 |
| 168 | Ga0265332_10013560 | 3300031238 | Bacteria | 3611 |
| 169 | Ga0265331_10011355 | 3300031250 | Bacteria | 4882 |
| 170 | Ga0265327_10000328 | 3300031251 | Bacteria | 90489 |
| 171 | Ga0265327_10008189 | 3300031251 | Bacteria | 7845 |
| 172 | Ga0307509_10102432 | 3300031507 | Bacteria | 2895 |
| 173 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 174 | Ga0307408_100002197 | 3300031548 | Bacteria | 13950 |
| 175 | Ga0316575_10000494 | 3300031665 | Bacteria | 11406 |
| 176 | Ga0265314_10017040 | 3300031711 | Bacteria | 5712 |
| 177 | Ga0265314_10048401 | 3300031711 | Bacteria | 2984 |
| 178 | Ga0307516_10089625 | 3300031730 | Bacteria | 2906 |
| 179 | Ga0307416_100708647 | 3300032002 | Bacteria | 1096 |
| 180 | Ga0307414_10087682 | 3300032004 | Bacteria | 2301 |
| 181 | Ga0307414_10635765 | 3300032004 | Bacteria | 961 |
| 182 | Ga0307411_10000169 | 3300032005 | Bacteria | 20966 |
| 183 | Ga0307415_100304481 | 3300032126 | Bacteria | 1322 |
| 184 | Ga0373950_0013777 | 3300034818 | Bacteria | 1353 |
| 185 | Ga0373959_0008736 | 3300034820 | Bacteria | 1732 |
| 186 | Ga0373940_0024687 | 3300035088 | Bacteria | 1560 |
| 187 | Ga0373939_0000033 | 3300035114 | Bacteria | 49449 |
| 188 | Ga0373960_0001741 | 3300035121 | Bacteria | 4875 |
| 189 | Ga0373931_0001499 | 3300035691 | Bacteria | 10052 |
| 190 | Ga0373937_0157628 | 3300036401 | Bacteria | 2128 |
| 191 | Ga0395905_0014100 | 3300037471 | Bacteria | 7640 |
| 192 | Ga0395905_0029320 | 3300037471 | Bacteria | 5184 |
| 193 | Ga0395905_0048798 | 3300037471 | Bacteria | 3966 |
| 194 | Ga0436361_0018388 | 3300039447 | Bacteria | 44345 |
| 195 | Ga0436361_0068556 | 3300039447 | Bacteria | 100895 |
| 196 | Ga0436361_0152681 | 3300039447 | Bacteria | 12488 |
| 197 | Ga0436361_0351372 | 3300039447 | Bacteria | 183069 |
| 198 | Ga0436361_0390231 | 3300039447 | Bacteria | 2508 |
| 199 | Ga0436361_0775466 | 3300039447 | Bacteria | 5078 |
| 200 | Ga0436361_1020551 | 3300039447 | Bacteria | 6817 |
| 201 | Ga0451835_0117327 | 3300041492 | Bacteria | 967 |
| 202 | Ga0451845_0080066 | 3300041501 | Bacteria | 1012 |
| 203 | Ga0451847_0617575 | 3300041503 | Bacteria | 896 |
| 204 | Ga0451849_0043162 | 3300041505 | Bacteria | 941 |
| 205 | Ga0451853_0437136 | 3300041512 | Bacteria | 1083 |
| 206 | Ga0439457_081943 | 3300042014 | Bacteria | 742 |
| 207 | Ga0450913_001263 | 3300042117 | Bacteria | 1353 |
| 208 | Ga0450888_001074 | 3300042126 | Bacteria | 2585 |
| 209 | Ga0450890_001514 | 3300042127 | Bacteria | 3339 |
| 210 | Ga0450891_003572 | 3300042129 | Bacteria | 1490 |
| 211 | Ga0450889_000464 | 3300042144 | Bacteria | 4496 |
| 212 | Ga0439459_0000160 | 3300042438 | Bacteria | 7069 |
| 213 | Ga0450893_0003664 | 3300042532 | Bacteria | 2427 |
| 214 | Ga0451577_0001784 | 3300042876 | Bacteria | 27608 |
| 215 | Ga0451577_0006011 | 3300042876 | Bacteria | 12221 |
| 216 | Ga0451577_0013731 | 3300042876 | Bacteria | 7569 |
| 217 | Ga0451577_0130371 | 3300042876 | Bacteria | 2255 |
| 218 | Ga0451577_0314828 | 3300042876 | Bacteria | 1419 |
| 219 | Ga0453683_0001495 | 3300044673 | Bacteria | 19992 |
| 220 | Ga0466965_0045122 | 3300044683 | Bacteria | 2179 |
| 221 | Ga0466966_0009504 | 3300044684 | Bacteria | 6438 |
| 222 | Ga0466961_0025566 | 3300044693 | Bacteria | 3796 |
| 223 | Ga0453684_0004595 | 3300044712 | Bacteria | 28783 |
| 224 | Ga0453684_0041033 | 3300044712 | Bacteria | 6268 |
| 225 | Ga0453684_0051471 | 3300044712 | Bacteria | 5398 |
| 226 | Ga0453684_0084533 | 3300044712 | Bacteria | 3945 |
| 227 | Ga0453684_0228931 | 3300044712 | Bacteria | 2147 |
| 228 | Ga0466970_0068273 | 3300044765 | Bacteria | 1910 |
| 229 | Ga0466959_0190039 | 3300045049 | Bacteria | 1433 |
| 230 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 231 | Ga0451576_0002326 | 3300045051 | Bacteria | 28783 |
| 232 | Ga0451576_0003496 | 3300045051 | Bacteria | 21499 |
| 233 | Ga0451576_0012633 | 3300045051 | Bacteria | 9481 |
| 234 | Ga0451576_0287539 | 3300045051 | Bacteria | 1719 |
| 235 | Ga0451576_0410952 | 3300045051 | Bacteria | 1419 |
| 236 | Ga0451576_0505860 | 3300045051 | Bacteria | 1269 |
| 237 | Ga0466958_0332406 | 3300045836 | Bacteria | 977 |
| 238 | Ga0495580_0083804 | 3300046472 | Bacteria | 2221 |
| 239 | Ga0495633_0001129 | 3300046558 | Bacteria | 21463 |
| 240 | Ga0495658_0219689 | 3300046683 | Bacteria | 1189 |
| 241 | Ga0495686_0009098 | 3300047472 | Bacteria | 7198 |
| 242 | Ga0496102_0032492 | 3300048905 | Bacteria | 4688 |
| 243 | Ga0496121_0040685 | 3300048924 | Bacteria | 4073 |
| 244 | Ga0501310_002888 | 3300049130 | Bacteria | 1656 |
| 245 | Ga0501300_001359 | 3300049523 | Bacteria | 3681 |
| 246 | Ga0501300_012756 | 3300049523 | Bacteria | 1225 |
| 247 | Ga0501303_001338 | 3300049526 | Bacteria | 1839 |
| 248 | Ga0501077_0155301 | 3300049593 | Bacteria | 1452 |
| 249 | Ga0501198_000008 | 3300049649 | Bacteria | 129023 |
| 250 | Ga0501211_000242 | 3300049658 | Bacteria | 4810 |
| 251 | Ga0501222_000006 | 3300049662 | Bacteria | 129030 |
| 252 | Ga0501222_004897 | 3300049662 | Bacteria | 1818 |
| 253 | Ga0501222_024354 | 3300049662 | Bacteria | 818 |
| 254 | Ga0501235_004216 | 3300049669 | Bacteria | 3115 |
| 255 | Ga0501258_009157 | 3300049687 | Bacteria | 1030 |
| 256 | Ga0501221_000379 | 3300049704 | Bacteria | 6823 |
| 257 | Ga0501229_001910 | 3300049706 | Bacteria | 2443 |
| 258 | Ga0501262_008879 | 3300049759 | Bacteria | 1235 |
| 259 | Ga0501267_000037 | 3300049764 | Bacteria | 7315 |
| 260 | Ga0501272_001063 | 3300049769 | Bacteria | 2529 |
| 261 | nmdc:mga03683_41754_c1 | 3300050489 | Bacteria | 1885 |
| 262 | nmdc:mga00v17_64153_c1 | 3300050491 | Bacteria | 2263 |
| 263 | nmdc:mga0k408_1071_c1 | 3300050493 | Bacteria | 15060 |
| 264 | nmdc:mga0k408_34376_c1 | 3300050493 | Bacteria | 2902 |
| 265 | nmdc:mga06z11_127356_c1 | 3300050494 | Bacteria | 1426 |
| 266 | nmdc:mga06z11_50999_c1 | 3300050494 | Bacteria | 2117 |
| 267 | nmdc:mga04h51_78476_c1 | 3300050495 | Bacteria | 1167 |
| 268 | nmdc:mga07m45_20550_c1 | 3300050496 | Bacteria | 3587 |
| 269 | nmdc:mga07m45_25418_c1 | 3300050496 | Bacteria | 1460 |
| 270 | nmdc:mga07m45_54822_c1 | 3300050496 | Bacteria | 2253 |
| 271 | nmdc:mga07m45_75_c1 | 3300050496 | Bacteria | 29787 |
| 272 | nmdc:mga07m45_79318_c1 | 3300050496 | Bacteria | 1874 |
| 273 | Ga0500618_002679 | 3300053125 | Bacteria | 6522 |
| 274 | Ga0500590_001540 | 3300053148 | Bacteria | 9564 |
| 275 | Ga0500622_0001845 | 3300053156 | Bacteria | 16037 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300034818 | Ga0373950_0013777 | Ga0373950_0013777_10_636 | 177 |
| 2 | 3300048905 | Ga0496102_0032492 | Ga0496102_0032492_3862_4560 | 179 |
| 3 | 3300003323 | rootH1_10102888 | rootH1_101028884 | 185 |
| 4 | 3300006881 | Ga0068865_100005385 | Ga0068865_1000053858 | 187 |
| 5 | 3300006195 | Ga0075366_10002708 | Ga0075366_100027086 | 191 |
| 6 | 3300050494 | nmdc:mga06z11_127356_c1 | nmdc:mga06z11_127356_c1_636_1313 | 191 |
| 7 | 3300003775 | Ga0055524_1000814 | Ga0055524_100081410 | 196 |
| 8 | 3300025299 | Ga0209256_1000579 | Ga0209256_100057937 | 196 |
| 9 | 3300027312 | Ga0209371_1024836 | Ga0209371_10248362 | 196 |
| 10 | 3300030500 | Ga0268256_1028259 | Ga0268256_10282592 | 196 |
| 11 | 3300031548 | Ga0307408_100002197 | Ga0307408_1000021977 | 196 |
| 12 | 3300042438 | Ga0439459_0000160 | Ga0439459_0000160_1702_2418 | 196 |
| 13 | 3300031665 | Ga0316575_10000494 | Ga0316575_100004945 | 197 |
| 14 | 3300046558 | Ga0495633_0001129 | Ga0495633_0001129_9867_10481 | 197 |
| 15 | 3300031250 | Ga0265331_10011355 | Ga0265331_100113554 | 198 |
| 16 | 3300031251 | Ga0265327_10008189 | Ga0265327_100081897 | 198 |
| 17 | 3300044712 | Ga0453684_0041033 | Ga0453684_0041033_4279_5004 | 200 |
| 18 | 3300053125 | Ga0500618_002679 | Ga0500618_002679_3948_4559 | 200 |
| 19 | iso_pu_bacteria | 2894023352 | 2894026061 | 200 |
| 20 | 3300004625 | Ga0055543_1005136 | Ga0055543_10051363 | 201 |
| 21 | 3300005262 | Ga0065165_1000153 | Ga0065165_100015369 | 201 |
| 22 | 3300014968 | Ga0157379_10159173 | Ga0157379_101591732 | 201 |
| 23 | 3300029957 | Ga0265324_10000340 | Ga0265324_1000034029 | 201 |
| 24 | 3300031238 | Ga0265332_10013560 | Ga0265332_100135602 | 201 |
| 25 | 3300031711 | Ga0265314_10017040 | Ga0265314_100170403 | 201 |
| 26 | 3300031711 | Ga0265314_10048401 | Ga0265314_100484014 | 201 |
| 27 | 3300042876 | Ga0451577_0130371 | Ga0451577_0130371_669_1292 | 201 |
| 28 | 3300044712 | Ga0453684_0084533 | Ga0453684_0084533_1953_2573 | 201 |
| 29 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_947681_948292 | 201 |
| 30 | 3300045051 | Ga0451576_0012633 | Ga0451576_0012633_1702_2322 | 201 |
| 31 | iso_pu_bacteria | 2643221544 | 2643742862 | 201 |
| 32 | iso_pu_bacteria | 2643221639 | 2644217502 | 201 |
| 33 | iso_pu_bacteria | 2643221646 | 2644258767 | 201 |
| 34 | iso_pu_bacteria | 2738541337 | 2739055526 | 201 |
| 35 | 3300003323 | rootH1_10065520 | rootH1_100655204 | 202 |
| 36 | 3300039447 | Ga0436361_1020551 | Ga0436361_1020551_3020_3646 | 202 |
| 37 | 3300042876 | Ga0451577_0013731 | Ga0451577_0013731_1667_2314 | 202 |
| 38 | 3300042876 | Ga0451577_0314828 | Ga0451577_0314828_318_938 | 202 |
| 39 | 3300045051 | Ga0451576_0287539 | Ga0451576_0287539_93_740 | 202 |
| 40 | 3300049593 | Ga0501077_0155301 | Ga0501077_0155301_350_967 | 202 |
| 41 | iso_pu_bacteria | 2831864461 | 2831865528 | 202 |
| 42 | iso_pu_bacteria | 2886848708 | 2886851170 | 202 |
| 43 | 3300003771 | Ga0055526_1000906 | Ga0055526_100090622 | 203 |
| 44 | 3300014969 | Ga0157376_10022790 | Ga0157376_100227907 | 203 |
| 45 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008809 | 203 |
| 46 | 3300025942 | Ga0207689_10086097 | Ga0207689_100860972 | 203 |
| 47 | 3300032004 | Ga0307414_10635765 | Ga0307414_106357652 | 203 |
| 48 | 3300041503 | Ga0451847_0617575 | Ga0451847_0617575_59_712 | 203 |
| 49 | 3300041505 | Ga0451849_0043162 | Ga0451849_0043162_166_822 | 203 |
| 50 | 3300046683 | Ga0495658_0219689 | Ga0495658_0219689_463_1128 | 203 |
| 51 | 3300049662 | Ga0501222_024354 | Ga0501222_024354_84_755 | 203 |
| 52 | 3300005539 | Ga0068853_100091695 | Ga0068853_1000916953 | 204 |
| 53 | 3300009093 | Ga0105240_10003836 | Ga0105240_100038362 | 204 |
| 54 | 3300009545 | Ga0105237_10001634 | Ga0105237_1000163423 | 204 |
| 55 | 3300009551 | Ga0105238_10014859 | Ga0105238_100148595 | 204 |
| 56 | 3300010375 | Ga0105239_10002435 | Ga0105239_1000243518 | 204 |
| 57 | 3300025913 | Ga0207695_10020987 | Ga0207695_100209872 | 204 |
| 58 | 3300025924 | Ga0207694_10004971 | Ga0207694_100049714 | 204 |
| 59 | 3300026041 | Ga0207639_10073981 | Ga0207639_100739813 | 204 |
| 60 | 3300031251 | Ga0265327_10000328 | Ga0265327_1000032864 | 204 |
| 61 | 3300039447 | Ga0436361_0775466 | Ga0436361_0775466_1813_2529 | 204 |
| 62 | 3300044673 | Ga0453683_0001495 | Ga0453683_0001495_1258_1965 | 204 |
| 63 | 3300044712 | Ga0453684_0004595 | Ga0453684_0004595_1258_1965 | 204 |
| 64 | 3300045051 | Ga0451576_0002326 | Ga0451576_0002326_26819_27526 | 204 |
| 65 | 3300003215 | JGI25153J46596_10001470 | JGI25153J46596_100014703 | 205 |
| 66 | 3300003215 | JGI25153J46596_10003347 | JGI25153J46596_100033477 | 205 |
| 67 | 3300003316 | rootH1_10085146 | rootH1_100851463 | 205 |
| 68 | 3300003322 | rootL2_10001692 | rootL2_100016927 | 205 |
| 69 | 3300003323 | rootH1_10039187 | rootH1_100391872 | 205 |
| 70 | 3300003775 | Ga0055524_1003915 | Ga0055524_10039156 | 205 |
| 71 | 3300003791 | Ga0055530_10025787 | Ga0055530_100257873 | 205 |
| 72 | 3300003794 | Ga0055531_10000168 | Ga0055531_1000016837 | 205 |
| 73 | 3300003794 | Ga0055531_10001544 | Ga0055531_100015446 | 205 |
| 74 | 3300003794 | Ga0055531_10021052 | Ga0055531_100210523 | 205 |
| 75 | 3300004625 | Ga0055543_1015394 | Ga0055543_10153943 | 205 |
| 76 | 3300005262 | Ga0065165_1000569 | Ga0065165_100056932 | 205 |
| 77 | 3300005327 | Ga0070658_10092344 | Ga0070658_100923445 | 205 |
| 78 | 3300005331 | Ga0070670_100000939 | Ga0070670_1000009399 | 205 |
| 79 | 3300005331 | Ga0070670_100013197 | Ga0070670_1000131976 | 205 |
| 80 | 3300005331 | Ga0070670_100138578 | Ga0070670_1001385782 | 205 |
| 81 | 3300005331 | Ga0070670_100155779 | Ga0070670_1001557792 | 205 |
| 82 | 3300005331 | Ga0070670_100160020 | Ga0070670_1001600202 | 205 |
| 83 | 3300005333 | Ga0070677_10010653 | Ga0070677_100106532 | 205 |
| 84 | 3300005337 | Ga0070682_100163667 | Ga0070682_1001636671 | 205 |
| 85 | 3300005344 | Ga0070661_100171235 | Ga0070661_1001712352 | 205 |
| 86 | 3300005353 | Ga0070669_100091062 | Ga0070669_1000910621 | 205 |
| 87 | 3300005354 | Ga0070675_100022972 | Ga0070675_1000229722 | 205 |
| 88 | 3300005354 | Ga0070675_100033069 | Ga0070675_1000330692 | 205 |
| 89 | 3300005354 | Ga0070675_100360133 | Ga0070675_1003601331 | 205 |
| 90 | 3300005355 | Ga0070671_100541039 | Ga0070671_1005410392 | 205 |
| 91 | 3300005356 | Ga0070674_100218489 | Ga0070674_1002184891 | 205 |
| 92 | 3300005364 | Ga0070673_100030704 | Ga0070673_1000307042 | 205 |
| 93 | 3300005364 | Ga0070673_100035657 | Ga0070673_1000356573 | 205 |
| 94 | 3300005366 | Ga0070659_100001171 | Ga0070659_1000011719 | 205 |
| 95 | 3300005456 | Ga0070678_100075685 | Ga0070678_1000756853 | 205 |
| 96 | 3300005459 | Ga0068867_100477425 | Ga0068867_1004774252 | 205 |
| 97 | 3300005543 | Ga0070672_100008536 | Ga0070672_1000085364 | 205 |
| 98 | 3300005543 | Ga0070672_100095570 | Ga0070672_1000955702 | 205 |
| 99 | 3300005543 | Ga0070672_100200747 | Ga0070672_1002007472 | 205 |
| 100 | 3300005548 | Ga0070665_100021752 | Ga0070665_1000217524 | 205 |
| 101 | 3300005548 | Ga0070665_100849293 | Ga0070665_1008492932 | 205 |
| 102 | 3300005564 | Ga0070664_100049271 | Ga0070664_1000492714 | 205 |
| 103 | 3300005564 | Ga0070664_100408129 | Ga0070664_1004081292 | 205 |
| 104 | 3300005577 | Ga0068857_100136538 | Ga0068857_1001365383 | 205 |
| 105 | 3300005617 | Ga0068859_100149091 | Ga0068859_1001490914 | 205 |
| 106 | 3300005618 | Ga0068864_100001313 | Ga0068864_10000131313 | 205 |
| 107 | 3300005840 | Ga0068870_10160177 | Ga0068870_101601772 | 205 |
| 108 | 3300005840 | Ga0068870_10185708 | Ga0068870_101857081 | 205 |
| 109 | 3300005841 | Ga0068863_100120827 | Ga0068863_1001208272 | 205 |
| 110 | 3300005841 | Ga0068863_100145143 | Ga0068863_1001451432 | 205 |
| 111 | 3300006042 | Ga0075368_10097952 | Ga0075368_100979521 | 205 |
| 112 | 3300006048 | Ga0075363_100023888 | Ga0075363_1000238883 | 205 |
| 113 | 3300006048 | Ga0075363_100070542 | Ga0075363_1000705421 | 205 |
| 114 | 3300006177 | Ga0075362_10004339 | Ga0075362_100043394 | 205 |
| 115 | 3300006178 | Ga0075367_10153795 | Ga0075367_101537952 | 205 |
| 116 | 3300006195 | Ga0075366_10002041 | Ga0075366_100020417 | 205 |
| 117 | 3300006353 | Ga0075370_10001548 | Ga0075370_100015486 | 205 |
| 118 | 3300006353 | Ga0075370_10002794 | Ga0075370_100027943 | 205 |
| 119 | 3300006353 | Ga0075370_10029590 | Ga0075370_100295905 | 205 |
| 120 | 3300006358 | Ga0068871_100010518 | Ga0068871_1000105185 | 205 |
| 121 | 3300006881 | Ga0068865_100114648 | Ga0068865_1001146482 | 205 |
| 122 | 3300006931 | Ga0097620_100149095 | Ga0097620_1001490954 | 205 |
| 123 | 3300006944 | Ga0099823_1000031 | Ga0099823_100003131 | 205 |
| 124 | 3300009093 | Ga0105240_10078978 | Ga0105240_100789784 | 205 |
| 125 | 3300009148 | Ga0105243_10148861 | Ga0105243_101488614 | 205 |
| 126 | 3300009148 | Ga0105243_10462746 | Ga0105243_104627462 | 205 |
| 127 | 3300009176 | Ga0105242_10049100 | Ga0105242_100491002 | 205 |
| 128 | 3300009177 | Ga0105248_10128535 | Ga0105248_101285351 | 205 |
| 129 | 3300009545 | Ga0105237_10006422 | Ga0105237_1000642214 | 205 |
| 130 | 3300009551 | Ga0105238_10094218 | Ga0105238_100942185 | 205 |
| 131 | 3300012475 | Ga0157317_1000308 | Ga0157317_10003083 | 205 |
| 132 | 3300012497 | Ga0157319_1000016 | Ga0157319_100001648 | 205 |
| 133 | 3300013296 | Ga0157374_10415011 | Ga0157374_104150112 | 205 |
| 134 | 3300013296 | Ga0157374_10485696 | Ga0157374_104856962 | 205 |
| 135 | 3300013306 | Ga0163162_10473449 | Ga0163162_104734492 | 205 |
| 136 | 3300013308 | Ga0157375_10110571 | Ga0157375_101105714 | 205 |
| 137 | 3300014325 | Ga0163163_10478903 | Ga0163163_104789032 | 205 |
| 138 | 3300014325 | Ga0163163_10563467 | Ga0163163_105634672 | 205 |
| 139 | 3300014326 | Ga0157380_10202231 | Ga0157380_102022312 | 205 |
| 140 | 3300014968 | Ga0157379_10009506 | Ga0157379_100095062 | 205 |
| 141 | 3300017792 | Ga0163161_10004685 | Ga0163161_100046853 | 205 |
| 142 | 3300017792 | Ga0163161_10066139 | Ga0163161_100661392 | 205 |
| 143 | 3300021361 | Ga0213872_10000058 | Ga0213872_1000005880 | 205 |
| 144 | 3300021361 | Ga0213872_10000150 | Ga0213872_1000015030 | 205 |
| 145 | 3300021361 | Ga0213872_10022852 | Ga0213872_100228522 | 205 |
| 146 | 3300025230 | Ga0209563_100013 | Ga0209563_100013669 | 205 |
| 147 | 3300025245 | Ga0207425_1000332 | Ga0207425_10003323 | 205 |
| 148 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012475 | 205 |
| 149 | 3300025273 | Ga0209673_1016267 | Ga0209673_10162672 | 205 |
| 150 | 3300025295 | Ga0209564_1000022 | Ga0209564_100002239 | 205 |
| 151 | 3300025297 | Ga0209758_1000233 | Ga0209758_100023336 | 205 |
| 152 | 3300025297 | Ga0209758_1000708 | Ga0209758_100070839 | 205 |
| 153 | 3300025298 | Ga0209050_1002766 | Ga0209050_100276617 | 205 |
| 154 | 3300025298 | Ga0209050_1004633 | Ga0209050_10046338 | 205 |
| 155 | 3300025299 | Ga0209256_1001555 | Ga0209256_100155512 | 205 |
| 156 | 3300025303 | Ga0209051_1002778 | Ga0209051_10027785 | 205 |
| 157 | 3300025303 | Ga0209051_1003056 | Ga0209051_100305610 | 205 |
| 158 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021265 | 205 |
| 159 | 3300025304 | Ga0209257_1000984 | Ga0209257_100098415 | 205 |
| 160 | 3300025304 | Ga0209257_1004760 | Ga0209257_10047602 | 205 |
| 161 | 3300025304 | Ga0209257_1012593 | Ga0209257_10125933 | 205 |
| 162 | 3300025893 | Ga0207682_10006107 | Ga0207682_100061074 | 205 |
| 163 | 3300025907 | Ga0207645_10078670 | Ga0207645_100786702 | 205 |
| 164 | 3300025908 | Ga0207643_10170029 | Ga0207643_101700292 | 205 |
| 165 | 3300025909 | Ga0207705_10155090 | Ga0207705_101550902 | 205 |
| 166 | 3300025920 | Ga0207649_10183800 | Ga0207649_101838002 | 205 |
| 167 | 3300025925 | Ga0207650_10002396 | Ga0207650_1000239612 | 205 |
| 168 | 3300025925 | Ga0207650_10004068 | Ga0207650_100040689 | 205 |
| 169 | 3300025925 | Ga0207650_10099095 | Ga0207650_100990952 | 205 |
| 170 | 3300025926 | Ga0207659_10020272 | Ga0207659_100202722 | 205 |
| 171 | 3300025926 | Ga0207659_10517821 | Ga0207659_105178212 | 205 |
| 172 | 3300025926 | Ga0207659_10564444 | Ga0207659_105644442 | 205 |
| 173 | 3300025931 | Ga0207644_10420893 | Ga0207644_104208932 | 205 |
| 174 | 3300025932 | Ga0207690_10002213 | Ga0207690_1000221310 | 205 |
| 175 | 3300025933 | Ga0207706_10066961 | Ga0207706_100669613 | 205 |
| 176 | 3300025934 | Ga0207686_10045969 | Ga0207686_100459692 | 205 |
| 177 | 3300025935 | Ga0207709_10296717 | Ga0207709_102967172 | 205 |
| 178 | 3300025937 | Ga0207669_10407031 | Ga0207669_104070312 | 205 |
| 179 | 3300025938 | Ga0207704_10295010 | Ga0207704_102950101 | 205 |
| 180 | 3300025940 | Ga0207691_10009020 | Ga0207691_100090207 | 205 |
| 181 | 3300025940 | Ga0207691_10127287 | Ga0207691_101272872 | 205 |
| 182 | 3300025940 | Ga0207691_10133089 | Ga0207691_101330892 | 205 |
| 183 | 3300025940 | Ga0207691_10243451 | Ga0207691_102434513 | 205 |
| 184 | 3300025941 | Ga0207711_10026741 | Ga0207711_100267414 | 205 |
| 185 | 3300025942 | Ga0207689_10659618 | Ga0207689_106596181 | 205 |
| 186 | 3300025945 | Ga0207679_10033418 | Ga0207679_100334184 | 205 |
| 187 | 3300025945 | Ga0207679_10306737 | Ga0207679_103067372 | 205 |
| 188 | 3300025960 | Ga0207651_10041808 | Ga0207651_100418083 | 205 |
| 189 | 3300025960 | Ga0207651_10123618 | Ga0207651_101236182 | 205 |
| 190 | 3300025981 | Ga0207640_10216789 | Ga0207640_102167893 | 205 |
| 191 | 3300025986 | Ga0207658_10525989 | Ga0207658_105259891 | 205 |
| 192 | 3300026023 | Ga0207677_10255727 | Ga0207677_102557273 | 205 |
| 193 | 3300026035 | Ga0207703_10294336 | Ga0207703_102943361 | 205 |
| 194 | 3300026067 | Ga0207678_10166846 | Ga0207678_101668463 | 205 |
| 195 | 3300026089 | Ga0207648_10118292 | Ga0207648_101182922 | 205 |
| 196 | 3300026095 | Ga0207676_10012947 | Ga0207676_100129476 | 205 |
| 197 | 3300026095 | Ga0207676_10022460 | Ga0207676_100224602 | 205 |
| 198 | 3300026095 | Ga0207676_10807750 | Ga0207676_108077501 | 205 |
| 199 | 3300026116 | Ga0207674_10071549 | Ga0207674_100715493 | 205 |
| 200 | 3300026118 | Ga0207675_100106248 | Ga0207675_1001062482 | 205 |
| 201 | 3300026121 | Ga0207683_10017159 | Ga0207683_100171594 | 205 |
| 202 | 3300026121 | Ga0207683_10058726 | Ga0207683_100587264 | 205 |
| 203 | 3300026121 | Ga0207683_10606339 | Ga0207683_106063392 | 205 |
| 204 | 3300027296 | Ga0209389_1006709 | Ga0209389_10067099 | 205 |
| 205 | 3300027866 | Ga0209813_10063674 | Ga0209813_100636741 | 205 |
| 206 | 3300028379 | Ga0268266_10036691 | Ga0268266_100366914 | 205 |
| 207 | 3300028379 | Ga0268266_10105872 | Ga0268266_101058722 | 205 |
| 208 | 3300031507 | Ga0307509_10102432 | Ga0307509_101024323 | 205 |
| 209 | 3300031548 | Ga0307408_100000008 | Ga0307408_10000000824 | 205 |
| 210 | 3300031730 | Ga0307516_10089625 | Ga0307516_100896253 | 205 |
| 211 | 3300032002 | Ga0307416_100708647 | Ga0307416_1007086471 | 205 |
| 212 | 3300032004 | Ga0307414_10087682 | Ga0307414_100876822 | 205 |
| 213 | 3300032005 | Ga0307411_10000169 | Ga0307411_1000016917 | 205 |
| 214 | 3300032126 | Ga0307415_100304481 | Ga0307415_1003044812 | 205 |
| 215 | 3300034820 | Ga0373959_0008736 | Ga0373959_0008736_364_1068 | 205 |
| 216 | 3300035088 | Ga0373940_0024687 | Ga0373940_0024687_449_1171 | 205 |
| 217 | 3300035114 | Ga0373939_0000033 | Ga0373939_0000033_522_1244 | 205 |
| 218 | 3300035121 | Ga0373960_0001741 | Ga0373960_0001741_1746_2468 | 205 |
| 219 | 3300035691 | Ga0373931_0001499 | Ga0373931_0001499_2045_2767 | 205 |
| 220 | 3300036401 | Ga0373937_0157628 | Ga0373937_0157628_141_821 | 205 |
| 221 | 3300037471 | Ga0395905_0014100 | Ga0395905_0014100_395_1054 | 205 |
| 222 | 3300037471 | Ga0395905_0029320 | Ga0395905_0029320_3491_4162 | 205 |
| 223 | 3300037471 | Ga0395905_0048798 | Ga0395905_0048798_2206_2898 | 205 |
| 224 | 3300039447 | Ga0436361_0018388 | Ga0436361_0018388_29545_30225 | 205 |
| 225 | 3300039447 | Ga0436361_0068556 | Ga0436361_0068556_36310_36978 | 205 |
| 226 | 3300039447 | Ga0436361_0152681 | Ga0436361_0152681_6810_7487 | 205 |
| 227 | 3300039447 | Ga0436361_0351372 | Ga0436361_0351372_137992_138678 | 205 |
| 228 | 3300039447 | Ga0436361_0390231 | Ga0436361_0390231_872_1570 | 205 |
| 229 | 3300041492 | Ga0451835_0117327 | Ga0451835_0117327_208_879 | 205 |
| 230 | 3300041501 | Ga0451845_0080066 | Ga0451845_0080066_269_973 | 205 |
| 231 | 3300041512 | Ga0451853_0437136 | Ga0451853_0437136_113_766 | 205 |
| 232 | 3300042014 | Ga0439457_081943 | Ga0439457_081943_32_715 | 205 |
| 233 | 3300042117 | Ga0450913_001263 | Ga0450913_001263_651_1331 | 205 |
| 234 | 3300042126 | Ga0450888_001074 | Ga0450888_001074_324_1001 | 205 |
| 235 | 3300042127 | Ga0450890_001514 | Ga0450890_001514_2314_2991 | 205 |
| 236 | 3300042129 | Ga0450891_003572 | Ga0450891_003572_324_1001 | 205 |
| 237 | 3300042144 | Ga0450889_000464 | Ga0450889_000464_1462_2139 | 205 |
| 238 | 3300042532 | Ga0450893_0003664 | Ga0450893_0003664_1555_2232 | 205 |
| 239 | 3300042876 | Ga0451577_0001784 | Ga0451577_0001784_6572_7204 | 205 |
| 240 | 3300042876 | Ga0451577_0006011 | Ga0451577_0006011_9203_9838 | 205 |
| 241 | 3300044683 | Ga0466965_0045122 | Ga0466965_0045122_132_848 | 205 |
| 242 | 3300044684 | Ga0466966_0009504 | Ga0466966_0009504_3594_4310 | 205 |
| 243 | 3300044693 | Ga0466961_0025566 | Ga0466961_0025566_2015_2731 | 205 |
| 244 | 3300044712 | Ga0453684_0051471 | Ga0453684_0051471_1341_2042 | 205 |
| 245 | 3300044712 | Ga0453684_0228931 | Ga0453684_0228931_1418_2053 | 205 |
| 246 | 3300044765 | Ga0466970_0068273 | Ga0466970_0068273_1142_1858 | 205 |
| 247 | 3300045049 | Ga0466959_0190039 | Ga0466959_0190039_545_1261 | 205 |
| 248 | 3300045051 | Ga0451576_0003496 | Ga0451576_0003496_8249_8881 | 205 |
| 249 | 3300045051 | Ga0451576_0410952 | Ga0451576_0410952_705_1373 | 205 |
| 250 | 3300045051 | Ga0451576_0505860 | Ga0451576_0505860_486_1187 | 205 |
| 251 | 3300045836 | Ga0466958_0332406 | Ga0466958_0332406_138_854 | 205 |
| 252 | 3300046472 | Ga0495580_0083804 | Ga0495580_0083804_566_1225 | 205 |
| 253 | 3300047472 | Ga0495686_0009098 | Ga0495686_0009098_5861_6538 | 205 |
| 254 | 3300048924 | Ga0496121_0040685 | Ga0496121_0040685_3227_3871 | 205 |
| 255 | 3300049130 | Ga0501310_002888 | Ga0501310_002888_343_1008 | 205 |
| 256 | 3300049523 | Ga0501300_001359 | Ga0501300_001359_1837_2502 | 205 |
| 257 | 3300049523 | Ga0501300_012756 | Ga0501300_012756_12_716 | 205 |
| 258 | 3300049526 | Ga0501303_001338 | Ga0501303_001338_195_899 | 205 |
| 259 | 3300049649 | Ga0501198_000008 | Ga0501198_000008_94002_94709 | 205 |
| 260 | 3300049658 | Ga0501211_000242 | Ga0501211_000242_3219_3884 | 205 |
| 261 | 3300049662 | Ga0501222_000006 | Ga0501222_000006_34335_35042 | 205 |
| 262 | 3300049662 | Ga0501222_004897 | Ga0501222_004897_394_1059 | 205 |
| 263 | 3300049669 | Ga0501235_004216 | Ga0501235_004216_1792_2469 | 205 |
| 264 | 3300049687 | Ga0501258_009157 | Ga0501258_009157_100_777 | 205 |
| 265 | 3300049704 | Ga0501221_000379 | Ga0501221_000379_1594_2259 | 205 |
| 266 | 3300049706 | Ga0501229_001910 | Ga0501229_001910_16_681 | 205 |
| 267 | 3300049759 | Ga0501262_008879 | Ga0501262_008879_341_1006 | 205 |
| 268 | 3300049764 | Ga0501267_000037 | Ga0501267_000037_3748_4413 | 205 |
| 269 | 3300049769 | Ga0501272_001063 | Ga0501272_001063_937_1602 | 205 |
| 270 | 3300050489 | nmdc:mga03683_41754_c1 | nmdc:mga03683_41754_c1_942_1619 | 205 |
| 271 | 3300050491 | nmdc:mga00v17_64153_c1 | nmdc:mga00v17_64153_c1_539_1216 | 205 |
| 272 | 3300050493 | nmdc:mga0k408_1071_c1 | nmdc:mga0k408_1071_c1_9743_10423 | 205 |
| 273 | 3300050493 | nmdc:mga0k408_34376_c1 | nmdc:mga0k408_34376_c1_1999_2676 | 205 |
| 274 | 3300050494 | nmdc:mga06z11_50999_c1 | nmdc:mga06z11_50999_c1_911_1588 | 205 |
| 275 | 3300050495 | nmdc:mga04h51_78476_c1 | nmdc:mga04h51_78476_c1_62_742 | 205 |
| 276 | 3300050496 | nmdc:mga07m45_20550_c1 | nmdc:mga07m45_20550_c1_478_1191 | 205 |
| 277 | 3300050496 | nmdc:mga07m45_25418_c1 | nmdc:mga07m45_25418_c1_344_1060 | 205 |
| 278 | 3300050496 | nmdc:mga07m45_54822_c1 | nmdc:mga07m45_54822_c1_41_718 | 205 |
| 279 | 3300050496 | nmdc:mga07m45_75_c1 | nmdc:mga07m45_75_c1_7563_8243 | 205 |
| 280 | 3300050496 | nmdc:mga07m45_79318_c1 | nmdc:mga07m45_79318_c1_132_812 | 205 |
| 281 | 3300053148 | Ga0500590_001540 | Ga0500590_001540_5424_6095 | 205 |
| 282 | 3300053156 | Ga0500622_0001845 | Ga0500622_0001845_7760_8539 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xj8-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form | 0.9197 | 5 | 200 |
| 5xj5-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form | 0.91 | 5 | 202 |
| 5xj5-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form | 0.884 | 5 | 202 |
| 5xj8-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form | 0.8797 | 5 | 200 |
| 7cfg-assembly1.cif.gz_A-2 | structure of the transmembrane domain of the bacterial cnnm/corc family mg2+ transporter in complex with mg2+ | 0.2865 | 6 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60782_11_184_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8863 | 13 | 190 | 1.10.1760.20 |
| af_P60782_11_184_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8723 | 13 | 190 | 1.10.1760.20 |
| af_Q2FYS6_9_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8624 | 13 | 190 | 1.10.1760.20 |
| af_Q2FYS6_9_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8364 | 13 | 190 | 1.10.1760.20 |
| af_Q4DMF5_143_245_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5617 | 123 | 194 | 1.20.1280.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A0E6M6-F1-model_v4 | Glycerol-3-phosphate acyltransferase | 0.9668 | 1 | 188 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A3D3PR66-F1-model_v4 | Glycerol-3-phosphate acyltransferase | 0.9642 | 63 | 204 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A011P9M5-F1-model_v4 | Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) | 0.9617 | 2 | 203 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A5C8P548-F1-model_v4 | Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) | 0.9588 | 1 | 202 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-E6MXG3-F1-model_v4 | Glycerol-3-phosphate acyltransferase | 0.9579 | 63 | 203 |
GO:0005886
GO:0008654 GO:0043772 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar