F384693

General Info

Members Datasets Scaffolds Average Seq Length
282 188 275 219

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1000814|Ga0055524_100081410
Length 229
Sequence MQSVLFPLLAVVAGYLIGSLSFAVIVSRLMGLSDPRSYGSGNPGATNVLRSGNKAAAILTLVFDALKGYVPVLLVLKFGAPYGLEEGTAALVGLAAFIGHLWPVFFKFVGGKGVATAAGVLLALNPWLGLAVVFRYSSLASLSAAVAAPLLQMLVWDVGPELPAIALMSLLLVWRHAANIKKLMAGTESKLGQKAAPAAAAPAVKSHRHEQSREKRDHKSSHKPKQHSK

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2738541337 Pelomonas sp. BT06 Isolate Unclassified
5 2831864461 Roseateles noduli HZ7 Isolate Nodule
6 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
7 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
58 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
111 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
138 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
139 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
140 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
143 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
144 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
145 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
146 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
147 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
148 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
149 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
168 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
171 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
172 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
175 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
176 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
177 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
178 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
179 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
187 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0.35
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.21
Nodule 1.42
Rhizoplane 0.35
Rhizosphere 71.99
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001470 3300003215 Bacteria 14062
2 JGI25153J46596_10003347 3300003215 Bacteria 9000
3 rootH1_10085146 3300003316 Bacteria 3004
4 rootL2_10001692 3300003322 Bacteria 21923
5 rootH1_10039187 3300003323 Bacteria 2451
6 rootH1_10065520 3300003323 Bacteria 3632
7 rootH1_10102888 3300003323 Bacteria 5163
8 Ga0055526_1000906 3300003771 Bacteria 22039
9 Ga0055524_1000814 3300003775 Bacteria 20618
10 Ga0055524_1003915 3300003775 Bacteria 7054
11 Ga0055530_10025787 3300003791 Bacteria 1635
12 Ga0055531_10000168 3300003794 Bacteria 73798
13 Ga0055531_10001544 3300003794 Bacteria 16864
14 Ga0055531_10021052 3300003794 Bacteria 2547
15 Ga0055543_1005136 3300004625 Bacteria 3401
16 Ga0055543_1015394 3300004625 Bacteria 1473
17 Ga0065165_1000153 3300005262 Bacteria 120209
18 Ga0065165_1000569 3300005262 Bacteria 54781
19 Ga0070658_10092344 3300005327 Bacteria 2496
20 Ga0070670_100000939 3300005331 Bacteria 22858
21 Ga0070670_100013197 3300005331 Bacteria 7077
22 Ga0070670_100138578 3300005331 Bacteria 2103
23 Ga0070670_100155779 3300005331 Bacteria 1978
24 Ga0070670_100160020 3300005331 Bacteria 1951
25 Ga0070677_10010653 3300005333 Bacteria 3149
26 Ga0070682_100163667 3300005337 Bacteria 1539
27 Ga0070661_100171235 3300005344 Bacteria 1649
28 Ga0070669_100091062 3300005353 Bacteria 2287
29 Ga0070675_100022972 3300005354 Bacteria 4983
30 Ga0070675_100033069 3300005354 Bacteria 4190
31 Ga0070675_100360133 3300005354 Bacteria 1291
32 Ga0070671_100541039 3300005355 Bacteria 1004
33 Ga0070674_100218489 3300005356 Bacteria 1481
34 Ga0070673_100030704 3300005364 Bacteria 4026
35 Ga0070673_100035657 3300005364 Bacteria 3773
36 Ga0070659_100001171 3300005366 Bacteria 19137
37 Ga0070678_100075685 3300005456 Bacteria 2533
38 Ga0068867_100477425 3300005459 Bacteria 1067
39 Ga0068853_100091695 3300005539 Bacteria 2673
40 Ga0070672_100008536 3300005543 Bacteria 7018
41 Ga0070672_100095570 3300005543 Bacteria 2403
42 Ga0070672_100200747 3300005543 Bacteria 1668
43 Ga0070665_100021752 3300005548 Bacteria 6448
44 Ga0070665_100849293 3300005548 Bacteria 926
45 Ga0070664_100049271 3300005564 Bacteria 3562
46 Ga0070664_100408129 3300005564 Bacteria 1243
47 Ga0068857_100136538 3300005577 Bacteria 2214
48 Ga0068859_100149091 3300005617 Bacteria 2415
49 Ga0068864_100001313 3300005618 Bacteria 20690
50 Ga0068870_10160177 3300005840 Bacteria 1334
51 Ga0068870_10185708 3300005840 Bacteria 1251
52 Ga0068863_100120827 3300005841 Bacteria 2498
53 Ga0068863_100145143 3300005841 Bacteria 2269
54 Ga0075368_10097952 3300006042 Bacteria 1203
55 Ga0075363_100023888 3300006048 Bacteria 3103
56 Ga0075363_100070542 3300006048 Bacteria 1898
57 Ga0075362_10004339 3300006177 Bacteria 5080
58 Ga0075367_10153795 3300006178 Bacteria 1428
59 Ga0075366_10002041 3300006195 Bacteria 10246
60 Ga0075366_10002708 3300006195 Bacteria 9145
61 Ga0075370_10001548 3300006353 Bacteria 10068
62 Ga0075370_10002794 3300006353 Bacteria 8184
63 Ga0075370_10029590 3300006353 Bacteria 3051
64 Ga0068871_100010518 3300006358 Bacteria 6758
65 Ga0068865_100005385 3300006881 Bacteria 7754
66 Ga0068865_100114648 3300006881 Bacteria 1994
67 Ga0097620_100149095 3300006931 Bacteria 2415
68 Ga0099823_1000031 3300006944 Bacteria 69036
69 Ga0105240_10003836 3300009093 Bacteria 23255
70 Ga0105240_10078978 3300009093 Bacteria 4051
71 Ga0105243_10148861 3300009148 Bacteria 2006
72 Ga0105243_10462746 3300009148 Bacteria 1193
73 Ga0105242_10049100 3300009176 Bacteria 3433
74 Ga0105248_10128535 3300009177 Bacteria 2858
75 Ga0105237_10001634 3300009545 Bacteria 29121
76 Ga0105237_10006422 3300009545 Bacteria 13044
77 Ga0105238_10014859 3300009551 Bacteria 7877
78 Ga0105238_10094218 3300009551 Bacteria 2982
79 Ga0105239_10002435 3300010375 Bacteria 23714
80 Ga0157317_1000308 3300012475 Bacteria 1901
81 Ga0157319_1000016 3300012497 Bacteria 127256
82 Ga0157374_10415011 3300013296 Bacteria 1344
83 Ga0157374_10485696 3300013296 Bacteria 1239
84 Ga0163162_10473449 3300013306 Bacteria 1384
85 Ga0157375_10110571 3300013308 Bacteria 2845
86 Ga0163163_10478903 3300014325 Bacteria 1306
87 Ga0163163_10563467 3300014325 Bacteria 1202
88 Ga0157380_10202231 3300014326 Bacteria 1763
89 Ga0157379_10009506 3300014968 Bacteria 8467
90 Ga0157379_10159173 3300014968 Bacteria 2038
91 Ga0157376_10022790 3300014969 Bacteria 4889
92 Ga0163161_10004685 3300017792 Bacteria 9509
93 Ga0163161_10066139 3300017792 Bacteria 2639
94 Ga0213872_10000058 3300021361 Bacteria 100531
95 Ga0213872_10000150 3300021361 Bacteria 63730
96 Ga0213872_10022852 3300021361 Bacteria 2877
97 Ga0209563_100013 3300025230 Bacteria 941463
98 Ga0207425_1000332 3300025245 Bacteria 33095
99 Ga0209129_1000012 3300025258 Bacteria 541516
100 Ga0209673_1016267 3300025273 Bacteria 2790
101 Ga0209564_1000008 3300025295 Bacteria 953227
102 Ga0209564_1000022 3300025295 Bacteria 555109
103 Ga0209758_1000233 3300025297 Bacteria 116640
104 Ga0209758_1000708 3300025297 Bacteria 49463
105 Ga0209050_1002766 3300025298 Bacteria 14090
106 Ga0209050_1004633 3300025298 Bacteria 9174
107 Ga0209256_1000579 3300025299 Bacteria 52079
108 Ga0209256_1001555 3300025299 Bacteria 22789
109 Ga0209051_1002778 3300025303 Bacteria 12067
110 Ga0209051_1003056 3300025303 Bacteria 11318
111 Ga0209257_1000021 3300025304 Bacteria 771986
112 Ga0209257_1000984 3300025304 Bacteria 38671
113 Ga0209257_1004760 3300025304 Bacteria 10135
114 Ga0209257_1012593 3300025304 Bacteria 3887
115 Ga0207682_10006107 3300025893 Bacteria 4869
116 Ga0207645_10078670 3300025907 Bacteria 2113
117 Ga0207643_10170029 3300025908 Bacteria 1315
118 Ga0207705_10155090 3300025909 Bacteria 1718
119 Ga0207695_10020987 3300025913 Bacteria 7463
120 Ga0207649_10183800 3300025920 Bacteria 1465
121 Ga0207694_10004971 3300025924 Bacteria 10292
122 Ga0207650_10002396 3300025925 Bacteria 13054
123 Ga0207650_10004068 3300025925 Bacteria 9996
124 Ga0207650_10099095 3300025925 Bacteria 2240
125 Ga0207659_10020272 3300025926 Bacteria 4393
126 Ga0207659_10517821 3300025926 Bacteria 1011
127 Ga0207659_10564444 3300025926 Bacteria 968
128 Ga0207644_10420893 3300025931 Bacteria 1094
129 Ga0207690_10002213 3300025932 Bacteria 11851
130 Ga0207706_10066961 3300025933 Bacteria 3160
131 Ga0207686_10045969 3300025934 Bacteria 2689
132 Ga0207709_10296717 3300025935 Bacteria 1200
133 Ga0207669_10407031 3300025937 Bacteria 1067
134 Ga0207704_10295010 3300025938 Bacteria 1239
135 Ga0207691_10009020 3300025940 Bacteria 9565
136 Ga0207691_10127287 3300025940 Bacteria 2252
137 Ga0207691_10133089 3300025940 Bacteria 2195
138 Ga0207691_10243451 3300025940 Bacteria 1554
139 Ga0207711_10026741 3300025941 Bacteria 4843
140 Ga0207689_10086097 3300025942 Bacteria 2583
141 Ga0207689_10659618 3300025942 Bacteria 882
142 Ga0207679_10033418 3300025945 Bacteria 3619
143 Ga0207679_10306737 3300025945 Bacteria 1370
144 Ga0207651_10041808 3300025960 Bacteria 3045
145 Ga0207651_10123618 3300025960 Bacteria 1967
146 Ga0207640_10216789 3300025981 Bacteria 1462
147 Ga0207658_10525989 3300025986 Bacteria 1056
148 Ga0207677_10255727 3300026023 Bacteria 1425
149 Ga0207703_10294336 3300026035 Bacteria 1478
150 Ga0207639_10073981 3300026041 Bacteria 2673
151 Ga0207678_10166846 3300026067 Bacteria 1880
152 Ga0207648_10118292 3300026089 Bacteria 2329
153 Ga0207676_10012947 3300026095 Bacteria 5991
154 Ga0207676_10022460 3300026095 Bacteria 4641
155 Ga0207676_10807750 3300026095 Bacteria 915
156 Ga0207674_10071549 3300026116 Bacteria 3485
157 Ga0207675_100106248 3300026118 Bacteria 2647
158 Ga0207683_10017159 3300026121 Bacteria 6164
159 Ga0207683_10058726 3300026121 Bacteria 3378
160 Ga0207683_10606339 3300026121 Bacteria 1013
161 Ga0209389_1006709 3300027296 Bacteria 10042
162 Ga0209371_1024836 3300027312 Bacteria 1387
163 Ga0209813_10063674 3300027866 Bacteria 1183
164 Ga0268266_10036691 3300028379 Bacteria 4174
165 Ga0268266_10105872 3300028379 Bacteria 2486
166 Ga0265324_10000340 3300029957 Bacteria 34285
167 Ga0268256_1028259 3300030500 Bacteria 1387
168 Ga0265332_10013560 3300031238 Bacteria 3611
169 Ga0265331_10011355 3300031250 Bacteria 4882
170 Ga0265327_10000328 3300031251 Bacteria 90489
171 Ga0265327_10008189 3300031251 Bacteria 7845
172 Ga0307509_10102432 3300031507 Bacteria 2895
173 Ga0307408_100000008 3300031548 Bacteria 456355
174 Ga0307408_100002197 3300031548 Bacteria 13950
175 Ga0316575_10000494 3300031665 Bacteria 11406
176 Ga0265314_10017040 3300031711 Bacteria 5712
177 Ga0265314_10048401 3300031711 Bacteria 2984
178 Ga0307516_10089625 3300031730 Bacteria 2906
179 Ga0307416_100708647 3300032002 Bacteria 1096
180 Ga0307414_10087682 3300032004 Bacteria 2301
181 Ga0307414_10635765 3300032004 Bacteria 961
182 Ga0307411_10000169 3300032005 Bacteria 20966
183 Ga0307415_100304481 3300032126 Bacteria 1322
184 Ga0373950_0013777 3300034818 Bacteria 1353
185 Ga0373959_0008736 3300034820 Bacteria 1732
186 Ga0373940_0024687 3300035088 Bacteria 1560
187 Ga0373939_0000033 3300035114 Bacteria 49449
188 Ga0373960_0001741 3300035121 Bacteria 4875
189 Ga0373931_0001499 3300035691 Bacteria 10052
190 Ga0373937_0157628 3300036401 Bacteria 2128
191 Ga0395905_0014100 3300037471 Bacteria 7640
192 Ga0395905_0029320 3300037471 Bacteria 5184
193 Ga0395905_0048798 3300037471 Bacteria 3966
194 Ga0436361_0018388 3300039447 Bacteria 44345
195 Ga0436361_0068556 3300039447 Bacteria 100895
196 Ga0436361_0152681 3300039447 Bacteria 12488
197 Ga0436361_0351372 3300039447 Bacteria 183069
198 Ga0436361_0390231 3300039447 Bacteria 2508
199 Ga0436361_0775466 3300039447 Bacteria 5078
200 Ga0436361_1020551 3300039447 Bacteria 6817
201 Ga0451835_0117327 3300041492 Bacteria 967
202 Ga0451845_0080066 3300041501 Bacteria 1012
203 Ga0451847_0617575 3300041503 Bacteria 896
204 Ga0451849_0043162 3300041505 Bacteria 941
205 Ga0451853_0437136 3300041512 Bacteria 1083
206 Ga0439457_081943 3300042014 Bacteria 742
207 Ga0450913_001263 3300042117 Bacteria 1353
208 Ga0450888_001074 3300042126 Bacteria 2585
209 Ga0450890_001514 3300042127 Bacteria 3339
210 Ga0450891_003572 3300042129 Bacteria 1490
211 Ga0450889_000464 3300042144 Bacteria 4496
212 Ga0439459_0000160 3300042438 Bacteria 7069
213 Ga0450893_0003664 3300042532 Bacteria 2427
214 Ga0451577_0001784 3300042876 Bacteria 27608
215 Ga0451577_0006011 3300042876 Bacteria 12221
216 Ga0451577_0013731 3300042876 Bacteria 7569
217 Ga0451577_0130371 3300042876 Bacteria 2255
218 Ga0451577_0314828 3300042876 Bacteria 1419
219 Ga0453683_0001495 3300044673 Bacteria 19992
220 Ga0466965_0045122 3300044683 Bacteria 2179
221 Ga0466966_0009504 3300044684 Bacteria 6438
222 Ga0466961_0025566 3300044693 Bacteria 3796
223 Ga0453684_0004595 3300044712 Bacteria 28783
224 Ga0453684_0041033 3300044712 Bacteria 6268
225 Ga0453684_0051471 3300044712 Bacteria 5398
226 Ga0453684_0084533 3300044712 Bacteria 3945
227 Ga0453684_0228931 3300044712 Bacteria 2147
228 Ga0466970_0068273 3300044765 Bacteria 1910
229 Ga0466959_0190039 3300045049 Bacteria 1433
230 Ga0451576_0000006 3300045051 Bacteria 949698
231 Ga0451576_0002326 3300045051 Bacteria 28783
232 Ga0451576_0003496 3300045051 Bacteria 21499
233 Ga0451576_0012633 3300045051 Bacteria 9481
234 Ga0451576_0287539 3300045051 Bacteria 1719
235 Ga0451576_0410952 3300045051 Bacteria 1419
236 Ga0451576_0505860 3300045051 Bacteria 1269
237 Ga0466958_0332406 3300045836 Bacteria 977
238 Ga0495580_0083804 3300046472 Bacteria 2221
239 Ga0495633_0001129 3300046558 Bacteria 21463
240 Ga0495658_0219689 3300046683 Bacteria 1189
241 Ga0495686_0009098 3300047472 Bacteria 7198
242 Ga0496102_0032492 3300048905 Bacteria 4688
243 Ga0496121_0040685 3300048924 Bacteria 4073
244 Ga0501310_002888 3300049130 Bacteria 1656
245 Ga0501300_001359 3300049523 Bacteria 3681
246 Ga0501300_012756 3300049523 Bacteria 1225
247 Ga0501303_001338 3300049526 Bacteria 1839
248 Ga0501077_0155301 3300049593 Bacteria 1452
249 Ga0501198_000008 3300049649 Bacteria 129023
250 Ga0501211_000242 3300049658 Bacteria 4810
251 Ga0501222_000006 3300049662 Bacteria 129030
252 Ga0501222_004897 3300049662 Bacteria 1818
253 Ga0501222_024354 3300049662 Bacteria 818
254 Ga0501235_004216 3300049669 Bacteria 3115
255 Ga0501258_009157 3300049687 Bacteria 1030
256 Ga0501221_000379 3300049704 Bacteria 6823
257 Ga0501229_001910 3300049706 Bacteria 2443
258 Ga0501262_008879 3300049759 Bacteria 1235
259 Ga0501267_000037 3300049764 Bacteria 7315
260 Ga0501272_001063 3300049769 Bacteria 2529
261 nmdc:mga03683_41754_c1 3300050489 Bacteria 1885
262 nmdc:mga00v17_64153_c1 3300050491 Bacteria 2263
263 nmdc:mga0k408_1071_c1 3300050493 Bacteria 15060
264 nmdc:mga0k408_34376_c1 3300050493 Bacteria 2902
265 nmdc:mga06z11_127356_c1 3300050494 Bacteria 1426
266 nmdc:mga06z11_50999_c1 3300050494 Bacteria 2117
267 nmdc:mga04h51_78476_c1 3300050495 Bacteria 1167
268 nmdc:mga07m45_20550_c1 3300050496 Bacteria 3587
269 nmdc:mga07m45_25418_c1 3300050496 Bacteria 1460
270 nmdc:mga07m45_54822_c1 3300050496 Bacteria 2253
271 nmdc:mga07m45_75_c1 3300050496 Bacteria 29787
272 nmdc:mga07m45_79318_c1 3300050496 Bacteria 1874
273 Ga0500618_002679 3300053125 Bacteria 6522
274 Ga0500590_001540 3300053148 Bacteria 9564
275 Ga0500622_0001845 3300053156 Bacteria 16037

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034818 Ga0373950_0013777 Ga0373950_0013777_10_636 177
2 3300048905 Ga0496102_0032492 Ga0496102_0032492_3862_4560 179
3 3300003323 rootH1_10102888 rootH1_101028884 185
4 3300006881 Ga0068865_100005385 Ga0068865_1000053858 187
5 3300006195 Ga0075366_10002708 Ga0075366_100027086 191
6 3300050494 nmdc:mga06z11_127356_c1 nmdc:mga06z11_127356_c1_636_1313 191
7 3300003775 Ga0055524_1000814 Ga0055524_100081410 196
8 3300025299 Ga0209256_1000579 Ga0209256_100057937 196
9 3300027312 Ga0209371_1024836 Ga0209371_10248362 196
10 3300030500 Ga0268256_1028259 Ga0268256_10282592 196
11 3300031548 Ga0307408_100002197 Ga0307408_1000021977 196
12 3300042438 Ga0439459_0000160 Ga0439459_0000160_1702_2418 196
13 3300031665 Ga0316575_10000494 Ga0316575_100004945 197
14 3300046558 Ga0495633_0001129 Ga0495633_0001129_9867_10481 197
15 3300031250 Ga0265331_10011355 Ga0265331_100113554 198
16 3300031251 Ga0265327_10008189 Ga0265327_100081897 198
17 3300044712 Ga0453684_0041033 Ga0453684_0041033_4279_5004 200
18 3300053125 Ga0500618_002679 Ga0500618_002679_3948_4559 200
19 iso_pu_bacteria 2894023352 2894026061 200
20 3300004625 Ga0055543_1005136 Ga0055543_10051363 201
21 3300005262 Ga0065165_1000153 Ga0065165_100015369 201
22 3300014968 Ga0157379_10159173 Ga0157379_101591732 201
23 3300029957 Ga0265324_10000340 Ga0265324_1000034029 201
24 3300031238 Ga0265332_10013560 Ga0265332_100135602 201
25 3300031711 Ga0265314_10017040 Ga0265314_100170403 201
26 3300031711 Ga0265314_10048401 Ga0265314_100484014 201
27 3300042876 Ga0451577_0130371 Ga0451577_0130371_669_1292 201
28 3300044712 Ga0453684_0084533 Ga0453684_0084533_1953_2573 201
29 3300045051 Ga0451576_0000006 Ga0451576_0000006_947681_948292 201
30 3300045051 Ga0451576_0012633 Ga0451576_0012633_1702_2322 201
31 iso_pu_bacteria 2643221544 2643742862 201
32 iso_pu_bacteria 2643221639 2644217502 201
33 iso_pu_bacteria 2643221646 2644258767 201
34 iso_pu_bacteria 2738541337 2739055526 201
35 3300003323 rootH1_10065520 rootH1_100655204 202
36 3300039447 Ga0436361_1020551 Ga0436361_1020551_3020_3646 202
37 3300042876 Ga0451577_0013731 Ga0451577_0013731_1667_2314 202
38 3300042876 Ga0451577_0314828 Ga0451577_0314828_318_938 202
39 3300045051 Ga0451576_0287539 Ga0451576_0287539_93_740 202
40 3300049593 Ga0501077_0155301 Ga0501077_0155301_350_967 202
41 iso_pu_bacteria 2831864461 2831865528 202
42 iso_pu_bacteria 2886848708 2886851170 202
43 3300003771 Ga0055526_1000906 Ga0055526_100090622 203
44 3300014969 Ga0157376_10022790 Ga0157376_100227907 203
45 3300025295 Ga0209564_1000008 Ga0209564_1000008809 203
46 3300025942 Ga0207689_10086097 Ga0207689_100860972 203
47 3300032004 Ga0307414_10635765 Ga0307414_106357652 203
48 3300041503 Ga0451847_0617575 Ga0451847_0617575_59_712 203
49 3300041505 Ga0451849_0043162 Ga0451849_0043162_166_822 203
50 3300046683 Ga0495658_0219689 Ga0495658_0219689_463_1128 203
51 3300049662 Ga0501222_024354 Ga0501222_024354_84_755 203
52 3300005539 Ga0068853_100091695 Ga0068853_1000916953 204
53 3300009093 Ga0105240_10003836 Ga0105240_100038362 204
54 3300009545 Ga0105237_10001634 Ga0105237_1000163423 204
55 3300009551 Ga0105238_10014859 Ga0105238_100148595 204
56 3300010375 Ga0105239_10002435 Ga0105239_1000243518 204
57 3300025913 Ga0207695_10020987 Ga0207695_100209872 204
58 3300025924 Ga0207694_10004971 Ga0207694_100049714 204
59 3300026041 Ga0207639_10073981 Ga0207639_100739813 204
60 3300031251 Ga0265327_10000328 Ga0265327_1000032864 204
61 3300039447 Ga0436361_0775466 Ga0436361_0775466_1813_2529 204
62 3300044673 Ga0453683_0001495 Ga0453683_0001495_1258_1965 204
63 3300044712 Ga0453684_0004595 Ga0453684_0004595_1258_1965 204
64 3300045051 Ga0451576_0002326 Ga0451576_0002326_26819_27526 204
65 3300003215 JGI25153J46596_10001470 JGI25153J46596_100014703 205
66 3300003215 JGI25153J46596_10003347 JGI25153J46596_100033477 205
67 3300003316 rootH1_10085146 rootH1_100851463 205
68 3300003322 rootL2_10001692 rootL2_100016927 205
69 3300003323 rootH1_10039187 rootH1_100391872 205
70 3300003775 Ga0055524_1003915 Ga0055524_10039156 205
71 3300003791 Ga0055530_10025787 Ga0055530_100257873 205
72 3300003794 Ga0055531_10000168 Ga0055531_1000016837 205
73 3300003794 Ga0055531_10001544 Ga0055531_100015446 205
74 3300003794 Ga0055531_10021052 Ga0055531_100210523 205
75 3300004625 Ga0055543_1015394 Ga0055543_10153943 205
76 3300005262 Ga0065165_1000569 Ga0065165_100056932 205
77 3300005327 Ga0070658_10092344 Ga0070658_100923445 205
78 3300005331 Ga0070670_100000939 Ga0070670_1000009399 205
79 3300005331 Ga0070670_100013197 Ga0070670_1000131976 205
80 3300005331 Ga0070670_100138578 Ga0070670_1001385782 205
81 3300005331 Ga0070670_100155779 Ga0070670_1001557792 205
82 3300005331 Ga0070670_100160020 Ga0070670_1001600202 205
83 3300005333 Ga0070677_10010653 Ga0070677_100106532 205
84 3300005337 Ga0070682_100163667 Ga0070682_1001636671 205
85 3300005344 Ga0070661_100171235 Ga0070661_1001712352 205
86 3300005353 Ga0070669_100091062 Ga0070669_1000910621 205
87 3300005354 Ga0070675_100022972 Ga0070675_1000229722 205
88 3300005354 Ga0070675_100033069 Ga0070675_1000330692 205
89 3300005354 Ga0070675_100360133 Ga0070675_1003601331 205
90 3300005355 Ga0070671_100541039 Ga0070671_1005410392 205
91 3300005356 Ga0070674_100218489 Ga0070674_1002184891 205
92 3300005364 Ga0070673_100030704 Ga0070673_1000307042 205
93 3300005364 Ga0070673_100035657 Ga0070673_1000356573 205
94 3300005366 Ga0070659_100001171 Ga0070659_1000011719 205
95 3300005456 Ga0070678_100075685 Ga0070678_1000756853 205
96 3300005459 Ga0068867_100477425 Ga0068867_1004774252 205
97 3300005543 Ga0070672_100008536 Ga0070672_1000085364 205
98 3300005543 Ga0070672_100095570 Ga0070672_1000955702 205
99 3300005543 Ga0070672_100200747 Ga0070672_1002007472 205
100 3300005548 Ga0070665_100021752 Ga0070665_1000217524 205
101 3300005548 Ga0070665_100849293 Ga0070665_1008492932 205
102 3300005564 Ga0070664_100049271 Ga0070664_1000492714 205
103 3300005564 Ga0070664_100408129 Ga0070664_1004081292 205
104 3300005577 Ga0068857_100136538 Ga0068857_1001365383 205
105 3300005617 Ga0068859_100149091 Ga0068859_1001490914 205
106 3300005618 Ga0068864_100001313 Ga0068864_10000131313 205
107 3300005840 Ga0068870_10160177 Ga0068870_101601772 205
108 3300005840 Ga0068870_10185708 Ga0068870_101857081 205
109 3300005841 Ga0068863_100120827 Ga0068863_1001208272 205
110 3300005841 Ga0068863_100145143 Ga0068863_1001451432 205
111 3300006042 Ga0075368_10097952 Ga0075368_100979521 205
112 3300006048 Ga0075363_100023888 Ga0075363_1000238883 205
113 3300006048 Ga0075363_100070542 Ga0075363_1000705421 205
114 3300006177 Ga0075362_10004339 Ga0075362_100043394 205
115 3300006178 Ga0075367_10153795 Ga0075367_101537952 205
116 3300006195 Ga0075366_10002041 Ga0075366_100020417 205
117 3300006353 Ga0075370_10001548 Ga0075370_100015486 205
118 3300006353 Ga0075370_10002794 Ga0075370_100027943 205
119 3300006353 Ga0075370_10029590 Ga0075370_100295905 205
120 3300006358 Ga0068871_100010518 Ga0068871_1000105185 205
121 3300006881 Ga0068865_100114648 Ga0068865_1001146482 205
122 3300006931 Ga0097620_100149095 Ga0097620_1001490954 205
123 3300006944 Ga0099823_1000031 Ga0099823_100003131 205
124 3300009093 Ga0105240_10078978 Ga0105240_100789784 205
125 3300009148 Ga0105243_10148861 Ga0105243_101488614 205
126 3300009148 Ga0105243_10462746 Ga0105243_104627462 205
127 3300009176 Ga0105242_10049100 Ga0105242_100491002 205
128 3300009177 Ga0105248_10128535 Ga0105248_101285351 205
129 3300009545 Ga0105237_10006422 Ga0105237_1000642214 205
130 3300009551 Ga0105238_10094218 Ga0105238_100942185 205
131 3300012475 Ga0157317_1000308 Ga0157317_10003083 205
132 3300012497 Ga0157319_1000016 Ga0157319_100001648 205
133 3300013296 Ga0157374_10415011 Ga0157374_104150112 205
134 3300013296 Ga0157374_10485696 Ga0157374_104856962 205
135 3300013306 Ga0163162_10473449 Ga0163162_104734492 205
136 3300013308 Ga0157375_10110571 Ga0157375_101105714 205
137 3300014325 Ga0163163_10478903 Ga0163163_104789032 205
138 3300014325 Ga0163163_10563467 Ga0163163_105634672 205
139 3300014326 Ga0157380_10202231 Ga0157380_102022312 205
140 3300014968 Ga0157379_10009506 Ga0157379_100095062 205
141 3300017792 Ga0163161_10004685 Ga0163161_100046853 205
142 3300017792 Ga0163161_10066139 Ga0163161_100661392 205
143 3300021361 Ga0213872_10000058 Ga0213872_1000005880 205
144 3300021361 Ga0213872_10000150 Ga0213872_1000015030 205
145 3300021361 Ga0213872_10022852 Ga0213872_100228522 205
146 3300025230 Ga0209563_100013 Ga0209563_100013669 205
147 3300025245 Ga0207425_1000332 Ga0207425_10003323 205
148 3300025258 Ga0209129_1000012 Ga0209129_1000012475 205
149 3300025273 Ga0209673_1016267 Ga0209673_10162672 205
150 3300025295 Ga0209564_1000022 Ga0209564_100002239 205
151 3300025297 Ga0209758_1000233 Ga0209758_100023336 205
152 3300025297 Ga0209758_1000708 Ga0209758_100070839 205
153 3300025298 Ga0209050_1002766 Ga0209050_100276617 205
154 3300025298 Ga0209050_1004633 Ga0209050_10046338 205
155 3300025299 Ga0209256_1001555 Ga0209256_100155512 205
156 3300025303 Ga0209051_1002778 Ga0209051_10027785 205
157 3300025303 Ga0209051_1003056 Ga0209051_100305610 205
158 3300025304 Ga0209257_1000021 Ga0209257_1000021265 205
159 3300025304 Ga0209257_1000984 Ga0209257_100098415 205
160 3300025304 Ga0209257_1004760 Ga0209257_10047602 205
161 3300025304 Ga0209257_1012593 Ga0209257_10125933 205
162 3300025893 Ga0207682_10006107 Ga0207682_100061074 205
163 3300025907 Ga0207645_10078670 Ga0207645_100786702 205
164 3300025908 Ga0207643_10170029 Ga0207643_101700292 205
165 3300025909 Ga0207705_10155090 Ga0207705_101550902 205
166 3300025920 Ga0207649_10183800 Ga0207649_101838002 205
167 3300025925 Ga0207650_10002396 Ga0207650_1000239612 205
168 3300025925 Ga0207650_10004068 Ga0207650_100040689 205
169 3300025925 Ga0207650_10099095 Ga0207650_100990952 205
170 3300025926 Ga0207659_10020272 Ga0207659_100202722 205
171 3300025926 Ga0207659_10517821 Ga0207659_105178212 205
172 3300025926 Ga0207659_10564444 Ga0207659_105644442 205
173 3300025931 Ga0207644_10420893 Ga0207644_104208932 205
174 3300025932 Ga0207690_10002213 Ga0207690_1000221310 205
175 3300025933 Ga0207706_10066961 Ga0207706_100669613 205
176 3300025934 Ga0207686_10045969 Ga0207686_100459692 205
177 3300025935 Ga0207709_10296717 Ga0207709_102967172 205
178 3300025937 Ga0207669_10407031 Ga0207669_104070312 205
179 3300025938 Ga0207704_10295010 Ga0207704_102950101 205
180 3300025940 Ga0207691_10009020 Ga0207691_100090207 205
181 3300025940 Ga0207691_10127287 Ga0207691_101272872 205
182 3300025940 Ga0207691_10133089 Ga0207691_101330892 205
183 3300025940 Ga0207691_10243451 Ga0207691_102434513 205
184 3300025941 Ga0207711_10026741 Ga0207711_100267414 205
185 3300025942 Ga0207689_10659618 Ga0207689_106596181 205
186 3300025945 Ga0207679_10033418 Ga0207679_100334184 205
187 3300025945 Ga0207679_10306737 Ga0207679_103067372 205
188 3300025960 Ga0207651_10041808 Ga0207651_100418083 205
189 3300025960 Ga0207651_10123618 Ga0207651_101236182 205
190 3300025981 Ga0207640_10216789 Ga0207640_102167893 205
191 3300025986 Ga0207658_10525989 Ga0207658_105259891 205
192 3300026023 Ga0207677_10255727 Ga0207677_102557273 205
193 3300026035 Ga0207703_10294336 Ga0207703_102943361 205
194 3300026067 Ga0207678_10166846 Ga0207678_101668463 205
195 3300026089 Ga0207648_10118292 Ga0207648_101182922 205
196 3300026095 Ga0207676_10012947 Ga0207676_100129476 205
197 3300026095 Ga0207676_10022460 Ga0207676_100224602 205
198 3300026095 Ga0207676_10807750 Ga0207676_108077501 205
199 3300026116 Ga0207674_10071549 Ga0207674_100715493 205
200 3300026118 Ga0207675_100106248 Ga0207675_1001062482 205
201 3300026121 Ga0207683_10017159 Ga0207683_100171594 205
202 3300026121 Ga0207683_10058726 Ga0207683_100587264 205
203 3300026121 Ga0207683_10606339 Ga0207683_106063392 205
204 3300027296 Ga0209389_1006709 Ga0209389_10067099 205
205 3300027866 Ga0209813_10063674 Ga0209813_100636741 205
206 3300028379 Ga0268266_10036691 Ga0268266_100366914 205
207 3300028379 Ga0268266_10105872 Ga0268266_101058722 205
208 3300031507 Ga0307509_10102432 Ga0307509_101024323 205
209 3300031548 Ga0307408_100000008 Ga0307408_10000000824 205
210 3300031730 Ga0307516_10089625 Ga0307516_100896253 205
211 3300032002 Ga0307416_100708647 Ga0307416_1007086471 205
212 3300032004 Ga0307414_10087682 Ga0307414_100876822 205
213 3300032005 Ga0307411_10000169 Ga0307411_1000016917 205
214 3300032126 Ga0307415_100304481 Ga0307415_1003044812 205
215 3300034820 Ga0373959_0008736 Ga0373959_0008736_364_1068 205
216 3300035088 Ga0373940_0024687 Ga0373940_0024687_449_1171 205
217 3300035114 Ga0373939_0000033 Ga0373939_0000033_522_1244 205
218 3300035121 Ga0373960_0001741 Ga0373960_0001741_1746_2468 205
219 3300035691 Ga0373931_0001499 Ga0373931_0001499_2045_2767 205
220 3300036401 Ga0373937_0157628 Ga0373937_0157628_141_821 205
221 3300037471 Ga0395905_0014100 Ga0395905_0014100_395_1054 205
222 3300037471 Ga0395905_0029320 Ga0395905_0029320_3491_4162 205
223 3300037471 Ga0395905_0048798 Ga0395905_0048798_2206_2898 205
224 3300039447 Ga0436361_0018388 Ga0436361_0018388_29545_30225 205
225 3300039447 Ga0436361_0068556 Ga0436361_0068556_36310_36978 205
226 3300039447 Ga0436361_0152681 Ga0436361_0152681_6810_7487 205
227 3300039447 Ga0436361_0351372 Ga0436361_0351372_137992_138678 205
228 3300039447 Ga0436361_0390231 Ga0436361_0390231_872_1570 205
229 3300041492 Ga0451835_0117327 Ga0451835_0117327_208_879 205
230 3300041501 Ga0451845_0080066 Ga0451845_0080066_269_973 205
231 3300041512 Ga0451853_0437136 Ga0451853_0437136_113_766 205
232 3300042014 Ga0439457_081943 Ga0439457_081943_32_715 205
233 3300042117 Ga0450913_001263 Ga0450913_001263_651_1331 205
234 3300042126 Ga0450888_001074 Ga0450888_001074_324_1001 205
235 3300042127 Ga0450890_001514 Ga0450890_001514_2314_2991 205
236 3300042129 Ga0450891_003572 Ga0450891_003572_324_1001 205
237 3300042144 Ga0450889_000464 Ga0450889_000464_1462_2139 205
238 3300042532 Ga0450893_0003664 Ga0450893_0003664_1555_2232 205
239 3300042876 Ga0451577_0001784 Ga0451577_0001784_6572_7204 205
240 3300042876 Ga0451577_0006011 Ga0451577_0006011_9203_9838 205
241 3300044683 Ga0466965_0045122 Ga0466965_0045122_132_848 205
242 3300044684 Ga0466966_0009504 Ga0466966_0009504_3594_4310 205
243 3300044693 Ga0466961_0025566 Ga0466961_0025566_2015_2731 205
244 3300044712 Ga0453684_0051471 Ga0453684_0051471_1341_2042 205
245 3300044712 Ga0453684_0228931 Ga0453684_0228931_1418_2053 205
246 3300044765 Ga0466970_0068273 Ga0466970_0068273_1142_1858 205
247 3300045049 Ga0466959_0190039 Ga0466959_0190039_545_1261 205
248 3300045051 Ga0451576_0003496 Ga0451576_0003496_8249_8881 205
249 3300045051 Ga0451576_0410952 Ga0451576_0410952_705_1373 205
250 3300045051 Ga0451576_0505860 Ga0451576_0505860_486_1187 205
251 3300045836 Ga0466958_0332406 Ga0466958_0332406_138_854 205
252 3300046472 Ga0495580_0083804 Ga0495580_0083804_566_1225 205
253 3300047472 Ga0495686_0009098 Ga0495686_0009098_5861_6538 205
254 3300048924 Ga0496121_0040685 Ga0496121_0040685_3227_3871 205
255 3300049130 Ga0501310_002888 Ga0501310_002888_343_1008 205
256 3300049523 Ga0501300_001359 Ga0501300_001359_1837_2502 205
257 3300049523 Ga0501300_012756 Ga0501300_012756_12_716 205
258 3300049526 Ga0501303_001338 Ga0501303_001338_195_899 205
259 3300049649 Ga0501198_000008 Ga0501198_000008_94002_94709 205
260 3300049658 Ga0501211_000242 Ga0501211_000242_3219_3884 205
261 3300049662 Ga0501222_000006 Ga0501222_000006_34335_35042 205
262 3300049662 Ga0501222_004897 Ga0501222_004897_394_1059 205
263 3300049669 Ga0501235_004216 Ga0501235_004216_1792_2469 205
264 3300049687 Ga0501258_009157 Ga0501258_009157_100_777 205
265 3300049704 Ga0501221_000379 Ga0501221_000379_1594_2259 205
266 3300049706 Ga0501229_001910 Ga0501229_001910_16_681 205
267 3300049759 Ga0501262_008879 Ga0501262_008879_341_1006 205
268 3300049764 Ga0501267_000037 Ga0501267_000037_3748_4413 205
269 3300049769 Ga0501272_001063 Ga0501272_001063_937_1602 205
270 3300050489 nmdc:mga03683_41754_c1 nmdc:mga03683_41754_c1_942_1619 205
271 3300050491 nmdc:mga00v17_64153_c1 nmdc:mga00v17_64153_c1_539_1216 205
272 3300050493 nmdc:mga0k408_1071_c1 nmdc:mga0k408_1071_c1_9743_10423 205
273 3300050493 nmdc:mga0k408_34376_c1 nmdc:mga0k408_34376_c1_1999_2676 205
274 3300050494 nmdc:mga06z11_50999_c1 nmdc:mga06z11_50999_c1_911_1588 205
275 3300050495 nmdc:mga04h51_78476_c1 nmdc:mga04h51_78476_c1_62_742 205
276 3300050496 nmdc:mga07m45_20550_c1 nmdc:mga07m45_20550_c1_478_1191 205
277 3300050496 nmdc:mga07m45_25418_c1 nmdc:mga07m45_25418_c1_344_1060 205
278 3300050496 nmdc:mga07m45_54822_c1 nmdc:mga07m45_54822_c1_41_718 205
279 3300050496 nmdc:mga07m45_75_c1 nmdc:mga07m45_75_c1_7563_8243 205
280 3300050496 nmdc:mga07m45_79318_c1 nmdc:mga07m45_79318_c1_132_812 205
281 3300053148 Ga0500590_001540 Ga0500590_001540_5424_6095 205
282 3300053156 Ga0500622_0001845 Ga0500622_0001845_7760_8539 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

13

183

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.9197 5 200
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.91 5 202
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.884 5 202
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8797 5 200
7cfg-assembly1.cif.gz_A-2 structure of the transmembrane domain of the bacterial cnnm/corc family mg2+ transporter in complex with mg2+ 0.2865 6 199
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8863 13 190 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8723 13 190 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8624 13 190 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8364 13 190 1.10.1760.20
af_Q4DMF5_143_245_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5617 123 194 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A3A0E6M6-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9668 1 188 GO:0005886
GO:0008654
GO:0043772
AF-A0A3D3PR66-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9642 63 204 GO:0005886
GO:0008654
GO:0043772
AF-A0A011P9M5-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9617 2 203 GO:0005886
GO:0008654
GO:0043772
AF-A0A5C8P548-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9588 1 202 GO:0005886
GO:0008654
GO:0043772
AF-E6MXG3-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9579 63 203 GO:0005886
GO:0008654
GO:0043772

Feature Viewer

pLDDT pTM Quality
94.93 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map