F384621

General Info

Members Datasets Scaffolds Average Seq Length
281 190 562 168

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0032770|Ga0501082_0032770_2284_2772
Length 162
Sequence MIRPILRYGEAPLHQAASDVTSFGADLQRLVDDLVETMYAAPGIGLAATQVGIPLRVFVVDLSVGRDPGGLITMVNPSFLEREGCLSVPGFTATVVRPARAVLTGADRHGQTQTIEAKGLLARAFQHEMDHLDGVVFVDRLRGIKRDLIVRRIQKLKRGGKW

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.96
Nodule 0
Rhizoplane 3.2
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0032770 3300060353 Bacteria 4482
2 Ga0065714_10369155 3300005288 Bacteria 617
3 Ga0065712_10110606 3300005290 Bacteria 1833
4 Ga0065712_10141460 3300005290 Bacteria 1446
5 Ga0065712_10142075 3300005290 Bacteria 1441
6 Ga0065715_10121401 3300005293 Bacteria 2231
7 Ga0065715_10460088 3300005293 Bacteria 817
8 Ga0065707_10012846 3300005295 Bacteria 1959
9 Ga0070676_10054119 3300005328 Bacteria 2365
10 Ga0070683_100021936 3300005329 Bacteria 5701
11 Ga0070683_101423689 3300005329 Bacteria 666
12 Ga0070690_100224578 3300005330 Bacteria 1317
13 Ga0070670_100066578 3300005331 Bacteria 3091
14 Ga0068869_101143118 3300005334 Bacteria 682
15 Ga0070680_100424010 3300005336 Bacteria 1135
16 Ga0070682_100758252 3300005337 Bacteria 784
17 Ga0068868_100109174 3300005338 Bacteria 2247
18 Ga0070691_10422876 3300005341 Bacteria 755
19 Ga0070687_100039984 3300005343 Bacteria 2360
20 Ga0070669_100604347 3300005353 Bacteria 919
21 Ga0070675_100221736 3300005354 Bacteria 1647
22 Ga0070675_100239812 3300005354 Bacteria 1584
23 Ga0070675_100620728 3300005354 Bacteria 981
24 Ga0070671_100741645 3300005355 Bacteria 853
25 Ga0070674_100095328 3300005356 Bacteria 2157
26 Ga0070674_100524768 3300005356 Bacteria 990
27 Ga0070674_100667741 3300005356 Bacteria 885
28 Ga0070674_100789328 3300005356 Bacteria 819
29 Ga0070673_100076669 3300005364 Bacteria 2700
30 Ga0070673_100288180 3300005364 Bacteria 1442
31 Ga0070688_100094969 3300005365 Bacteria 1956
32 Ga0070659_100319429 3300005366 Bacteria 1298
33 Ga0070659_100465563 3300005366 Bacteria 1074
34 Ga0070667_100329131 3300005367 Bacteria 1380
35 Ga0070701_10692553 3300005438 Bacteria 685
36 Ga0070700_100021809 3300005441 Bacteria 3727
37 Ga0070694_100168306 3300005444 Bacteria 1613
38 Ga0070663_100650934 3300005455 Bacteria 891
39 Ga0070678_100193966 3300005456 Bacteria 1672
40 Ga0070699_100641747 3300005518 Bacteria 969
41 Ga0070684_100816697 3300005535 Bacteria 872
42 Ga0070684_101215124 3300005535 Bacteria 709
43 Ga0070672_100243981 3300005543 Bacteria 1511
44 Ga0070693_100053687 3300005547 Bacteria 2315
45 Ga0070693_100178932 3300005547 Bacteria 1364
46 Ga0070704_100559955 3300005549 Bacteria 1000
47 Ga0070664_100382467 3300005564 Bacteria 1285
48 Ga0068854_100176369 3300005578 Bacteria 1666
49 Ga0068854_100532044 3300005578 Bacteria 994
50 Ga0070702_100223493 3300005615 Bacteria 1260
51 Ga0068864_100191688 3300005618 Bacteria 1874
52 Ga0068870_10440125 3300005840 Bacteria 857
53 Ga0068858_100579382 3300005842 Bacteria 1087
54 Ga0068860_100145339 3300005843 Bacteria 2281
55 Ga0068862_100316026 3300005844 Bacteria 1440
56 Ga0081455_10381169 3300005937 Bacteria 985
57 Ga0081538_10049177 3300005981 Bacteria 2560
58 Ga0075365_10045242 3300006038 Bacteria 2887
59 Ga0075363_100065771 3300006048 Bacteria 1961
60 Ga0075364_10041870 3300006051 Bacteria 2975
61 Ga0075364_10044382 3300006051 Bacteria 2891
62 Ga0075364_10072419 3300006051 Bacteria 2271
63 Ga0075364_10139490 3300006051 Bacteria 1630
64 Ga0075362_10002808 3300006177 Bacteria 5943
65 Ga0075367_10004610 3300006178 Bacteria 6748
66 Ga0075367_10038797 3300006178 Bacteria 2774
67 Ga0075369_10486185 3300006186 Bacteria 586
68 Ga0075366_10010852 3300006195 Bacteria 5127
69 Ga0075370_10020676 3300006353 Bacteria 3601
70 Ga0068871_100798190 3300006358 Bacteria 870
71 Ga0075428_100078542 3300006844 Bacteria 3603
72 Ga0075428_100257924 3300006844 Bacteria 1878
73 Ga0075430_100012703 3300006846 Bacteria 7176
74 Ga0075430_100014917 3300006846 Bacteria 6616
75 Ga0075430_100112055 3300006846 Bacteria 2274
76 Ga0075431_100020423 3300006847 Bacteria 6768
77 Ga0075431_100028420 3300006847 Bacteria 5746
78 Ga0075431_100302682 3300006847 Bacteria 1615
79 Ga0075433_10057002 3300006852 Bacteria 3414
80 Ga0075434_100096242 3300006871 Bacteria 2966
81 Ga0075429_100072464 3300006880 Bacteria 3000
82 Ga0075429_100278049 3300006880 Bacteria 1466
83 Ga0068865_100610763 3300006881 Bacteria 923
84 Ga0075436_100075788 3300006914 Bacteria 2329
85 Ga0075436_100603312 3300006914 Bacteria 809
86 Ga0075435_100007313 3300007076 Bacteria 7863
87 Ga0105240_10022685 3300009093 Bacteria 8317
88 Ga0105240_10116810 3300009093 Bacteria 3218
89 Ga0111539_10101868 3300009094 Bacteria 3371
90 Ga0111539_11783708 3300009094 Bacteria 714
91 Ga0105245_10344320 3300009098 Bacteria 1475
92 Ga0105247_10257196 3300009101 Bacteria 1196
93 Ga0114129_10001646 3300009147 Bacteria 30357
94 Ga0114129_10002811 3300009147 Bacteria 24277
95 Ga0114129_10012275 3300009147 Bacteria 12189
96 Ga0114129_10048587 3300009147 Bacteria 5962
97 Ga0114129_10657500 3300009147 Bacteria 1352
98 Ga0114129_12497214 3300009147 Bacteria 618
99 Ga0105243_10171875 3300009148 Bacteria 1878
100 Ga0105241_10175958 3300009174 Bacteria 1771
101 Ga0105242_10345462 3300009176 Bacteria 1373
102 Ga0105248_10133009 3300009177 Bacteria 2806
103 Ga0105248_10928924 3300009177 Bacteria 983
104 Ga0105249_10097466 3300009553 Bacteria 2760
105 Ga0105249_10396684 3300009553 Bacteria 1409
106 Ga0105239_12043999 3300010375 Bacteria 665
107 Ga0105246_11658083 3300011119 Bacteria 606
108 Ga0157370_10101184 3300013104 Bacteria 2699
109 Ga0157370_10873734 3300013104 Bacteria 816
110 Ga0157369_10538634 3300013105 Bacteria 1207
111 Ga0157378_10384349 3300013297 Bacteria 1379
112 Ga0157375_10260928 3300013308 Bacteria 1894
113 Ga0163163_11046642 3300014325 Bacteria 879
114 Ga0157377_10355153 3300014745 Bacteria 985
115 Ga0157376_10083598 3300014969 Bacteria 2746
116 Ga0207697_10000488 3300025315 Bacteria 22401
117 Ga0207697_10238345 3300025315 Bacteria 804
118 Ga0207688_10212391 3300025901 Bacteria 1163
119 Ga0207684_10652591 3300025910 Bacteria 896
120 Ga0207707_10141188 3300025912 Bacteria 2106
121 Ga0207707_10649289 3300025912 Bacteria 889
122 Ga0207695_10085667 3300025913 Bacteria 3179
123 Ga0207695_10171375 3300025913 Bacteria 2096
124 Ga0207662_10004273 3300025918 Bacteria 7499
125 Ga0207649_10128594 3300025920 Bacteria 1717
126 Ga0207681_10088214 3300025923 Bacteria 2209
127 Ga0207650_10082298 3300025925 Bacteria 2443
128 Ga0207659_10111002 3300025926 Bacteria 2085
129 Ga0207659_10621310 3300025926 Bacteria 922
130 Ga0207690_10082723 3300025932 Bacteria 2246
131 Ga0207690_10487703 3300025932 Bacteria 995
132 Ga0207706_10055875 3300025933 Bacteria 3481
133 Ga0207709_10082688 3300025935 Bacteria 2074
134 Ga0207670_10025191 3300025936 Bacteria 3730
135 Ga0207669_10055511 3300025937 Bacteria 2399
136 Ga0207669_10089629 3300025937 Bacteria 1998
137 Ga0207669_10332127 3300025937 Bacteria 1167
138 Ga0207669_10528309 3300025937 Bacteria 948
139 Ga0207704_10090863 3300025938 Bacteria 2005
140 Ga0207691_10014688 3300025940 Bacteria 7464
141 Ga0207691_10182493 3300025940 Bacteria 1833
142 Ga0207711_10021474 3300025941 Bacteria 5393
143 Ga0207661_10005260 3300025944 Bacteria 9105
144 Ga0207679_10571197 3300025945 Bacteria 1016
145 Ga0207667_10216890 3300025949 Bacteria 1961
146 Ga0207651_10079694 3300025960 Bacteria 2353
147 Ga0207712_10908377 3300025961 Bacteria 778
148 Ga0207677_10287153 3300026023 Bacteria 1353
149 Ga0207703_10144159 3300026035 Bacteria 2070
150 Ga0207708_10002827 3300026075 Bacteria 12765
151 Ga0207648_10310999 3300026089 Bacteria 1414
152 Ga0207676_10456603 3300026095 Bacteria 1205
153 Ga0207676_11317559 3300026095 Bacteria 717
154 Ga0207675_100490374 3300026118 Bacteria 1222
155 Ga0207683_10326596 3300026121 Bacteria 1406
156 Ga0207683_11199455 3300026121 Bacteria 703
157 Ga0207698_10012418 3300026142 Bacteria 5572
158 Ga0209998_10106593 3300027717 Bacteria 698
159 Ga0209813_10012889 3300027866 Bacteria 2221
160 Ga0268266_11281531 3300028379 Bacteria 708
161 Ga0268264_10315669 3300028381 Bacteria 1476
162 Ga0307408_100360861 3300031548 Bacteria 1236
163 Ga0307405_10257407 3300031731 Bacteria 1302
164 Ga0307406_11110018 3300031901 Bacteria 683
165 Ga0307416_100049718 3300032002 Bacteria 3336
166 Ga0307416_100539194 3300032002 Bacteria 1238
167 Ga0307416_100800698 3300032002 Bacteria 1038
168 Ga0307411_10326178 3300032005 Bacteria 1242
169 Ga0307411_10540480 3300032005 Bacteria 992
170 Ga0373949_0078983 3300035090 Bacteria 874
171 Ga0373943_0260042 3300035170 Bacteria 977
172 Ga0373961_0068748 3300035241 Bacteria 1091
173 Ga0373962_0150322 3300035242 Bacteria 762
174 Ga0373933_0096034 3300035724 Unclassified 1834
175 Ga0373937_0095539 3300036401 Bacteria 2756
176 Ga0373937_0133794 3300036401 Bacteria 2317
177 Ga0373925_0062305 3300037068 Bacteria 2804
178 Ga0439435_0002168 3300042436 Bacteria 3833
179 Ga0439444_0008219 3300042437 Bacteria 1623
180 Ga0495603_0051779 3300046455 Bacteria 2439
181 Ga0495629_0168221 3300046459 Bacteria 1522
182 Ga0495653_0126962 3300046463 Bacteria 1810
183 Ga0495662_0340527 3300046476 Bacteria 737
184 Ga0495596_0095589 3300046500 Bacteria 1154
185 Ga0495634_0077543 3300046642 Bacteria 2179
186 Ga0495635_0044888 3300046663 Bacteria 3049
187 Ga0495658_0242500 3300046683 Bacteria 1132
188 Ga0495658_0373634 3300046683 Bacteria 907
189 Ga0495600_0164206 3300046809 Bacteria 1435
190 Ga0495674_0468342 3300047319 Bacteria 1011
191 Ga0495676_0218503 3300047321 Bacteria 1315
192 Ga0495684_0379219 3300047471 Bacteria 998
193 Ga0496102_0438599 3300048905 Bacteria 1226
194 Ga0496102_1758806 3300048905 Bacteria 537
195 Ga0496103_0828519 3300048906 Bacteria 582
196 Ga0496106_0048805 3300048909 Bacteria 3189
197 Ga0496108_0154676 3300048911 Bacteria 1980
198 Ga0496109_0178780 3300048912 Bacteria 1992
199 Ga0496109_0337018 3300048912 Bacteria 1424
200 Ga0496112_0889664 3300048915 Bacteria 813
201 Ga0496113_0133045 3300048916 Bacteria 1953
202 Ga0501031_0044202 3300049568 Bacteria 2907
203 Ga0501031_0543231 3300049568 Bacteria 749
204 Ga0501034_0035471 3300049571 Bacteria 5056
205 Ga0501036_0261643 3300049572 Bacteria 1449
206 Ga0501036_0269206 3300049572 Bacteria 1426
207 Ga0501038_0095309 3300049574 Bacteria 2486
208 Ga0501038_0983288 3300049574 Bacteria 620
209 Ga0501040_0659068 3300049576 Bacteria 756
210 Ga0501041_0012727 3300049577 Bacteria 4985
211 Ga0501042_0032267 3300049578 Bacteria 3708
212 Ga0501042_0082279 3300049578 Bacteria 2308
213 Ga0501042_0228982 3300049578 Bacteria 1341
214 Ga0501048_0028444 3300049582 Bacteria 4057
215 Ga0501048_0062993 3300049582 Bacteria 2624
216 Ga0501048_0080527 3300049582 Bacteria 2298
217 Ga0501067_0709850 3300049583 Bacteria 565
218 Ga0501068_0149404 3300049584 Bacteria 1468
219 Ga0501069_0720013 3300049585 Bacteria 603
220 Ga0501071_0031804 3300049587 Bacteria 3744
221 Ga0501071_0034631 3300049587 Bacteria 3595
222 Ga0501071_0250134 3300049587 Bacteria 1338
223 Ga0501072_0024228 3300049588 Bacteria 4720
224 Ga0501072_0108308 3300049588 Bacteria 2211
225 Ga0501072_0136653 3300049588 Bacteria 1954
226 Ga0501073_0078461 3300049589 Bacteria 2298
227 Ga0501073_0154054 3300049589 Bacteria 1593
228 Ga0501074_0603680 3300049590 Bacteria 776
229 Ga0501075_0013198 3300049591 Bacteria 5892
230 Ga0501075_0630376 3300049591 Bacteria 818
231 Ga0501076_0006163 3300049592 Bacteria 8678
232 Ga0501076_0034957 3300049592 Bacteria 3931
233 Ga0501077_0347113 3300049593 Bacteria 947
234 Ga0501079_0059725 3300049741 Bacteria 2941
235 Ga0501079_0101495 3300049741 Bacteria 2231
236 Ga0501081_0148419 3300049743 Bacteria 1683
237 Ga0501081_0160399 3300049743 Bacteria 1620
238 Ga0501083_0154034 3300049744 Bacteria 1505
239 Ga0501083_0218441 3300049744 Bacteria 1242
240 Ga0501083_0328677 3300049744 Bacteria 994
241 Ga0501045_0024558 3300049824 Bacteria 4328
242 Ga0501045_0395133 3300049824 Bacteria 1029
243 nmdc:mga03683_47302_c1 3300050489 Bacteria 1638
244 nmdc:mga03n38_40762_c1 3300050490 Bacteria 2019
245 nmdc:mga00v17_119117_c1 3300050491 Bacteria 1680
246 nmdc:mga00v17_61690_c1 3300050491 Bacteria 2305
247 nmdc:mga00v17_61709_c1 3300050491 Bacteria 2305
248 nmdc:mga0yw44_37184_c1 3300050492 Bacteria 2873
249 nmdc:mga0yw44_75883_c1 3300050492 Bacteria 2097
250 nmdc:mga0k408_459228_c1 3300050493 Bacteria 756
251 nmdc:mga0k408_91000_c1 3300050493 Bacteria 1792
252 nmdc:mga06z11_13089_c1 3300050494 Bacteria 3631
253 nmdc:mga06z11_18849_c1 3300050494 Bacteria 3161
254 nmdc:mga06z11_439736_c1 3300050494 Bacteria 787
255 nmdc:mga04h51_14781_c1 3300050495 Bacteria 2238
256 nmdc:mga04h51_195563_c1 3300050495 Bacteria 793
257 nmdc:mga07m45_104322_c1 3300050496 Bacteria 1630
258 nmdc:mga05p37_137482_c1 3300050507 Bacteria 2995
259 nmdc:mga05p37_3592_c1 3300050507 Bacteria 18118
260 nmdc:mga05p37_41744_c1 3300050507 Bacteria 5633
261 nmdc:mga05p37_4994_c1 3300050507 Bacteria 15546
262 nmdc:mga05p37_614548_c1 3300050507 Bacteria 1224
263 nmdc:mga05p37_946543_c1 3300050507 Bacteria 922
264 nmdc:mga09592_932371_c1 3300050508 Unclassified 729
265 nmdc:mga09592_995332_c1 3300050508 Bacteria 701
266 nmdc:mga0qj67_9188_c1 3300050509 Bacteria 7342
267 nmdc:mga06r32_217214_c1 3300050510 Bacteria 1900
268 nmdc:mga06r32_263632_c1 3300050510 Bacteria 1711
269 nmdc:mga06r32_290343_c1 3300050510 Bacteria 1622
270 nmdc:mga06r32_395585_c1 3300050510 Bacteria 1364
271 nmdc:mga06r32_68056_c1 3300050510 Bacteria 3439
272 nmdc:mga06r32_6888_c1 3300050510 Bacteria 10216
273 nmdc:mga08y16_1247730_c1 3300050511 Bacteria 712
274 nmdc:mga0n895_192044_c1 3300050512 Bacteria 2073
275 nmdc:mga0rr50_11766_c1 3300050513 Bacteria 5617
276 nmdc:mga08x19_502902_c1 3300050514 Bacteria 856
277 nmdc:mga0a205_138079_c1 3300050515 Bacteria 2338
278 Ga0501084_0071401 3300054114 Bacteria 2907
279 Ga0501084_1397151 3300054114 Bacteria 586
280 Ga0590071_045151 3300059421 Bacteria 1063
281 Ga0530510_0215963 3300061734 Bacteria 1425
282 Ga0501082_0032770
283 Ga0065714_10369155
284 Ga0065712_10110606
285 Ga0065712_10141460
286 Ga0065712_10142075
287 Ga0065715_10121401
288 Ga0065715_10460088
289 Ga0065707_10012846
290 Ga0070676_10054119
291 Ga0070683_100021936
292 Ga0070683_101423689
293 Ga0070690_100224578
294 Ga0070670_100066578
295 Ga0068869_101143118
296 Ga0070680_100424010
297 Ga0070682_100758252
298 Ga0068868_100109174
299 Ga0070691_10422876
300 Ga0070687_100039984
301 Ga0070669_100604347
302 Ga0070675_100221736
303 Ga0070675_100239812
304 Ga0070675_100620728
305 Ga0070671_100741645
306 Ga0070674_100095328
307 Ga0070674_100524768
308 Ga0070674_100667741
309 Ga0070674_100789328
310 Ga0070673_100076669
311 Ga0070673_100288180
312 Ga0070688_100094969
313 Ga0070659_100319429
314 Ga0070659_100465563
315 Ga0070667_100329131
316 Ga0070701_10692553
317 Ga0070700_100021809
318 Ga0070694_100168306
319 Ga0070663_100650934
320 Ga0070678_100193966
321 Ga0070699_100641747
322 Ga0070684_100816697
323 Ga0070684_101215124
324 Ga0070672_100243981
325 Ga0070693_100053687
326 Ga0070693_100178932
327 Ga0070704_100559955
328 Ga0070664_100382467
329 Ga0068854_100176369
330 Ga0068854_100532044
331 Ga0070702_100223493
332 Ga0068864_100191688
333 Ga0068870_10440125
334 Ga0068858_100579382
335 Ga0068860_100145339
336 Ga0068862_100316026
337 Ga0081455_10381169
338 Ga0081538_10049177
339 Ga0075365_10045242
340 Ga0075363_100065771
341 Ga0075364_10041870
342 Ga0075364_10044382
343 Ga0075364_10072419
344 Ga0075364_10139490
345 Ga0075362_10002808
346 Ga0075367_10004610
347 Ga0075367_10038797
348 Ga0075369_10486185
349 Ga0075366_10010852
350 Ga0075370_10020676
351 Ga0068871_100798190
352 Ga0075428_100078542
353 Ga0075428_100257924
354 Ga0075430_100012703
355 Ga0075430_100014917
356 Ga0075430_100112055
357 Ga0075431_100020423
358 Ga0075431_100028420
359 Ga0075431_100302682
360 Ga0075433_10057002
361 Ga0075434_100096242
362 Ga0075429_100072464
363 Ga0075429_100278049
364 Ga0068865_100610763
365 Ga0075436_100075788
366 Ga0075436_100603312
367 Ga0075435_100007313
368 Ga0105240_10022685
369 Ga0105240_10116810
370 Ga0111539_10101868
371 Ga0111539_11783708
372 Ga0105245_10344320
373 Ga0105247_10257196
374 Ga0114129_10001646
375 Ga0114129_10002811
376 Ga0114129_10012275
377 Ga0114129_10048587
378 Ga0114129_10657500
379 Ga0114129_12497214
380 Ga0105243_10171875
381 Ga0105241_10175958
382 Ga0105242_10345462
383 Ga0105248_10133009
384 Ga0105248_10928924
385 Ga0105249_10097466
386 Ga0105249_10396684
387 Ga0105239_12043999
388 Ga0105246_11658083
389 Ga0157370_10101184
390 Ga0157370_10873734
391 Ga0157369_10538634
392 Ga0157378_10384349
393 Ga0157375_10260928
394 Ga0163163_11046642
395 Ga0157377_10355153
396 Ga0157376_10083598
397 Ga0207697_10000488
398 Ga0207697_10238345
399 Ga0207688_10212391
400 Ga0207684_10652591
401 Ga0207707_10141188
402 Ga0207707_10649289
403 Ga0207695_10085667
404 Ga0207695_10171375
405 Ga0207662_10004273
406 Ga0207649_10128594
407 Ga0207681_10088214
408 Ga0207650_10082298
409 Ga0207659_10111002
410 Ga0207659_10621310
411 Ga0207690_10082723
412 Ga0207690_10487703
413 Ga0207706_10055875
414 Ga0207709_10082688
415 Ga0207670_10025191
416 Ga0207669_10055511
417 Ga0207669_10089629
418 Ga0207669_10332127
419 Ga0207669_10528309
420 Ga0207704_10090863
421 Ga0207691_10014688
422 Ga0207691_10182493
423 Ga0207711_10021474
424 Ga0207661_10005260
425 Ga0207679_10571197
426 Ga0207667_10216890
427 Ga0207651_10079694
428 Ga0207712_10908377
429 Ga0207677_10287153
430 Ga0207703_10144159
431 Ga0207708_10002827
432 Ga0207648_10310999
433 Ga0207676_10456603
434 Ga0207676_11317559
435 Ga0207675_100490374
436 Ga0207683_10326596
437 Ga0207683_11199455
438 Ga0207698_10012418
439 Ga0209998_10106593
440 Ga0209813_10012889
441 Ga0268266_11281531
442 Ga0268264_10315669
443 Ga0307408_100360861
444 Ga0307405_10257407
445 Ga0307406_11110018
446 Ga0307416_100049718
447 Ga0307416_100539194
448 Ga0307416_100800698
449 Ga0307411_10326178
450 Ga0307411_10540480
451 Ga0373949_0078983
452 Ga0373943_0260042
453 Ga0373961_0068748
454 Ga0373962_0150322
455 Ga0373933_0096034
456 Ga0373937_0095539
457 Ga0373937_0133794
458 Ga0373925_0062305
459 Ga0439435_0002168
460 Ga0439444_0008219
461 Ga0495603_0051779
462 Ga0495629_0168221
463 Ga0495653_0126962
464 Ga0495662_0340527
465 Ga0495596_0095589
466 Ga0495634_0077543
467 Ga0495635_0044888
468 Ga0495658_0242500
469 Ga0495658_0373634
470 Ga0495600_0164206
471 Ga0495674_0468342
472 Ga0495676_0218503
473 Ga0495684_0379219
474 Ga0496102_0438599
475 Ga0496102_1758806
476 Ga0496103_0828519
477 Ga0496106_0048805
478 Ga0496108_0154676
479 Ga0496109_0178780
480 Ga0496109_0337018
481 Ga0496112_0889664
482 Ga0496113_0133045
483 Ga0501031_0044202
484 Ga0501031_0543231
485 Ga0501034_0035471
486 Ga0501036_0261643
487 Ga0501036_0269206
488 Ga0501038_0095309
489 Ga0501038_0983288
490 Ga0501040_0659068
491 Ga0501041_0012727
492 Ga0501042_0032267
493 Ga0501042_0082279
494 Ga0501042_0228982
495 Ga0501048_0028444
496 Ga0501048_0062993
497 Ga0501048_0080527
498 Ga0501067_0709850
499 Ga0501068_0149404
500 Ga0501069_0720013
501 Ga0501071_0031804
502 Ga0501071_0034631
503 Ga0501071_0250134
504 Ga0501072_0024228
505 Ga0501072_0108308
506 Ga0501072_0136653
507 Ga0501073_0078461
508 Ga0501073_0154054
509 Ga0501074_0603680
510 Ga0501075_0013198
511 Ga0501075_0630376
512 Ga0501076_0006163
513 Ga0501076_0034957
514 Ga0501077_0347113
515 Ga0501079_0059725
516 Ga0501079_0101495
517 Ga0501081_0148419
518 Ga0501081_0160399
519 Ga0501083_0154034
520 Ga0501083_0218441
521 Ga0501083_0328677
522 Ga0501045_0024558
523 Ga0501045_0395133
524 nmdc:mga03683_47302_c1
525 nmdc:mga03n38_40762_c1
526 nmdc:mga00v17_119117_c1
527 nmdc:mga00v17_61690_c1
528 nmdc:mga00v17_61709_c1
529 nmdc:mga0yw44_37184_c1
530 nmdc:mga0yw44_75883_c1
531 nmdc:mga0k408_459228_c1
532 nmdc:mga0k408_91000_c1
533 nmdc:mga06z11_13089_c1
534 nmdc:mga06z11_18849_c1
535 nmdc:mga06z11_439736_c1
536 nmdc:mga04h51_14781_c1
537 nmdc:mga04h51_195563_c1
538 nmdc:mga07m45_104322_c1
539 nmdc:mga05p37_137482_c1
540 nmdc:mga05p37_3592_c1
541 nmdc:mga05p37_41744_c1
542 nmdc:mga05p37_4994_c1
543 nmdc:mga05p37_614548_c1
544 nmdc:mga05p37_946543_c1
545 nmdc:mga09592_932371_c1
546 nmdc:mga09592_995332_c1
547 nmdc:mga0qj67_9188_c1
548 nmdc:mga06r32_217214_c1
549 nmdc:mga06r32_263632_c1
550 nmdc:mga06r32_290343_c1
551 nmdc:mga06r32_395585_c1
552 nmdc:mga06r32_68056_c1
553 nmdc:mga06r32_6888_c1
554 nmdc:mga08y16_1247730_c1
555 nmdc:mga0n895_192044_c1
556 nmdc:mga0rr50_11766_c1
557 nmdc:mga08x19_502902_c1
558 nmdc:mga0a205_138079_c1
559 Ga0501084_0071401
560 Ga0501084_1397151
561 Ga0590071_045151
562 Ga0530510_0215963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

2

147

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.9644 1 149
4dr8-assembly4.cif.gz_D crystal structure of a peptide deformylase from synechococcus elongatus 0.9551 3 150
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9412 2 160
4dr9-assembly1.cif.gz_A crystal structure of a peptide deformylase from synechococcus elongatus in complex with actinonin 0.9405 3 150
1v3y-assembly2.cif.gz_B the crystal structure of peptide deformylase from thermus thermophilus hb8 0.9399 2 162
ID Description Score Start End Superfamily
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9644 1 149 3.90.45.10
af_A0A0R0ELH1_60_189_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9506 4 103 3.90.45.10
af_Q2G265_1_160_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.942 1 150 3.90.45.10
1v3yB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9404 2 162 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9388 1 150 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A533SUB0-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9867 2 139 GO:0042586
GO:0043686
AF-X1D9F8-F1-model_v4 Peptide deformylase 0.9812 27 153 GO:0042586
GO:0043686
AF-A0A7Z1R1P4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9791 1 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A7C7EB55-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9752 1 140 GO:0042586
GO:0043686
AF-A0A3D0Y7U9-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9749 2 147 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map