F384491

General Info

Members Datasets Scaffolds Average Seq Length
281 149 562 178

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0003645|Ga0451576_0003645_6223_6756
Length 177
Sequence MELRERFASVSILFLDVDGVLTDGRVTLDGKGGETKDFDVTDGLGLRLLQDSGVTVALITGRVSEVVAQRAKELRIAELHQGVRDKVPVFRKILLEKGLAPKNAAYVGDDLLDLPVLTRVGLAVTVPSAPEEVKSSVHYVTAKNGGRGAVREVCEEILKAKGQWDSIVKGFLGAEEP

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.34
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 4.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0003645 3300045051 Bacteria 20903
2 MBSR1b_contig_13990851 2162886012 Bacteria 894
3 Ga0065712_10000485 3300005290 Bacteria 12704
4 Ga0065712_10071100 3300005290 Bacteria 5486
5 Ga0065715_10099963 3300005293 Bacteria 3352
6 Ga0065715_10184816 3300005293 Bacteria 1452
7 Ga0065715_10190788 3300005293 Bacteria 1416
8 Ga0065707_10109901 3300005295 Bacteria 2452
9 Ga0070676_10064728 3300005328 Bacteria 2181
10 Ga0070683_100000857 3300005329 Bacteria 22475
11 Ga0070683_100334396 3300005329 Bacteria 1442
12 Ga0070690_100024967 3300005330 Bacteria 3679
13 Ga0070690_100491485 3300005330 Bacteria 917
14 Ga0070670_100041349 3300005331 Bacteria 3962
15 Ga0070670_100088314 3300005331 Bacteria 2665
16 Ga0070670_100384336 3300005331 Bacteria 1237
17 Ga0070670_100575934 3300005331 Bacteria 1006
18 Ga0070666_10016739 3300005335 Bacteria 4694
19 Ga0070680_100068639 3300005336 Bacteria 2910
20 Ga0068868_100084575 3300005338 Bacteria 2548
21 Ga0070691_10001081 3300005341 Bacteria 11289
22 Ga0070687_100154589 3300005343 Bacteria 1350
23 Ga0070661_100343902 3300005344 Bacteria 1169
24 Ga0070668_100055676 3300005347 Bacteria 3053
25 Ga0070668_100304617 3300005347 Bacteria 1337
26 Ga0070669_100002972 3300005353 Bacteria 12219
27 Ga0070669_100073654 3300005353 Bacteria 2530
28 Ga0070669_100125922 3300005353 Bacteria 1960
29 Ga0070669_101030748 3300005353 Bacteria 707
30 Ga0070675_100171758 3300005354 Bacteria 1870
31 Ga0070675_100256572 3300005354 Bacteria 1531
32 Ga0070675_101485961 3300005354 Bacteria 625
33 Ga0070671_100026542 3300005355 Bacteria 4761
34 Ga0070671_100215002 3300005355 Bacteria 1631
35 Ga0070674_100002729 3300005356 Bacteria 9764
36 Ga0070674_100181191 3300005356 Bacteria 1614
37 Ga0070674_100512441 3300005356 Bacteria 1001
38 Ga0070673_100886248 3300005364 Bacteria 827
39 Ga0070688_100114836 3300005365 Bacteria 1796
40 Ga0070688_100299297 3300005365 Bacteria 1162
41 Ga0070659_100699730 3300005366 Bacteria 876
42 Ga0070701_10001830 3300005438 Bacteria 8046
43 Ga0070701_10141606 3300005438 Bacteria 1376
44 Ga0070701_10427646 3300005438 Bacteria 845
45 Ga0070705_100001314 3300005440 Bacteria 13321
46 Ga0070700_100001496 3300005441 Bacteria 11632
47 Ga0070700_100713663 3300005441 Bacteria 799
48 Ga0070694_100003841 3300005444 Bacteria 8975
49 Ga0070678_100114481 3300005456 Bacteria 2116
50 Ga0070678_100427987 3300005456 Bacteria 1155
51 Ga0068867_100024164 3300005459 Bacteria 4355
52 Ga0068867_100170741 3300005459 Bacteria 1722
53 Ga0068867_101285601 3300005459 Bacteria 675
54 Ga0070707_101402347 3300005468 Bacteria 665
55 Ga0070698_100149048 3300005471 Bacteria 2288
56 Ga0070698_100210326 3300005471 Bacteria 1880
57 Ga0070684_100000384 3300005535 Bacteria 30726
58 Ga0070684_100273759 3300005535 Bacteria 1546
59 Ga0068853_100537883 3300005539 Bacteria 1106
60 Ga0070672_100495642 3300005543 Unclassified 1056
61 Ga0070686_100001857 3300005544 Bacteria 11778
62 Ga0070695_100007402 3300005545 Bacteria 6512
63 Ga0070695_100567610 3300005545 Bacteria 887
64 Ga0070665_100183153 3300005548 Bacteria 2095
65 Ga0070665_100388118 3300005548 Bacteria 1404
66 Ga0070704_100160057 3300005549 Bacteria 1780
67 Ga0070704_100339352 3300005549 Bacteria 1265
68 Ga0068855_100264049 3300005563 Bacteria 1917
69 Ga0070664_100000442 3300005564 Bacteria 31212
70 Ga0070664_100419190 3300005564 Bacteria 1226
71 Ga0068857_100022947 3300005577 Bacteria 5490
72 Ga0068854_100010165 3300005578 Bacteria 6097
73 Ga0070702_100028656 3300005615 Bacteria 3019
74 Ga0068859_100047722 3300005617 Bacteria 4303
75 Ga0068859_100478212 3300005617 Bacteria 1341
76 Ga0068859_101577788 3300005617 Bacteria 725
77 Ga0068864_100596605 3300005618 Bacteria 1071
78 Ga0068864_101432021 3300005618 Bacteria 693
79 Ga0068866_10010088 3300005718 Bacteria 4039
80 Ga0068861_100001397 3300005719 Bacteria 15173
81 Ga0068861_100271056 3300005719 Bacteria 1457
82 Ga0068861_100451583 3300005719 Bacteria 1152
83 Ga0068861_100499179 3300005719 Bacteria 1100
84 Ga0068861_100581006 3300005719 Bacteria 1025
85 Ga0068861_100748458 3300005719 Bacteria 913
86 Ga0068851_10276489 3300005834 Bacteria 959
87 Ga0068858_101058596 3300005842 Bacteria 796
88 Ga0068860_100012227 3300005843 Bacteria 8458
89 Ga0068860_100176456 3300005843 Bacteria 2065
90 Ga0068860_100324627 3300005843 Bacteria 1511
91 Ga0068862_100025130 3300005844 Bacteria 5000
92 Ga0068862_100043714 3300005844 Bacteria 3819
93 Ga0068862_100348449 3300005844 Bacteria 1373
94 Ga0068862_100798380 3300005844 Bacteria 921
95 Ga0075428_100016132 3300006844 Bacteria 8257
96 Ga0075428_100022183 3300006844 Bacteria 7030
97 Ga0075428_101065670 3300006844 Bacteria 854
98 Ga0075430_100004147 3300006846 Bacteria 12229
99 Ga0075430_100049134 3300006846 Bacteria 3561
100 Ga0075431_100030516 3300006847 Bacteria 5553
101 Ga0075431_100054613 3300006847 Bacteria 4119
102 Ga0075433_10039685 3300006852 Bacteria 4072
103 Ga0075433_10190940 3300006852 Unclassified 1822
104 Ga0075433_10913507 3300006852 Bacteria 766
105 Ga0075434_101154432 3300006871 Bacteria 787
106 Ga0075429_100022466 3300006880 Bacteria 5470
107 Ga0075429_100026882 3300006880 Bacteria 4996
108 Ga0075429_100502948 3300006880 Bacteria 1062
109 Ga0075429_100761136 3300006880 Bacteria 848
110 Ga0068865_100084700 3300006881 Bacteria 2285
111 Ga0068865_100254617 3300006881 Bacteria 1387
112 Ga0068865_100309660 3300006881 Bacteria 1267
113 Ga0075436_100111220 3300006914 Bacteria 1912
114 Ga0075436_100289017 3300006914 Bacteria 1173
115 Ga0097620_100047721 3300006931 Bacteria 4303
116 Ga0097620_100478191 3300006931 Bacteria 1341
117 Ga0097620_101577949 3300006931 Bacteria 725
118 Ga0075435_100801274 3300007076 Bacteria 820
119 Ga0111539_10002104 3300009094 Bacteria 26607
120 Ga0111539_10004657 3300009094 Bacteria 17928
121 Ga0111539_10273862 3300009094 Bacteria 1965
122 Ga0111539_11073298 3300009094 Bacteria 936
123 Ga0114129_10008634 3300009147 Bacteria 14527
124 Ga0114129_10011193 3300009147 Bacteria 12788
125 Ga0114129_10018670 3300009147 Bacteria 9874
126 Ga0105243_10011387 3300009148 Bacteria 6731
127 Ga0105243_10029935 3300009148 Bacteria 4189
128 Ga0105243_10307117 3300009148 Bacteria 1440
129 Ga0105243_10964398 3300009148 Bacteria 853
130 Ga0105248_10582558 3300009177 Bacteria 1262
131 Ga0105248_11242569 3300009177 Bacteria 842
132 Ga0105249_10054836 3300009553 Bacteria 3645
133 Ga0105249_10247342 3300009553 Bacteria 1766
134 Ga0105249_10424104 3300009553 Unclassified 1365
135 Ga0105249_10566527 3300009553 Bacteria 1188
136 Ga0105249_10600058 3300009553 Bacteria 1156
137 Ga0105249_10657139 3300009553 Bacteria 1106
138 Ga0105249_11200254 3300009553 Bacteria 830
139 Ga0105239_11577159 3300010375 Unclassified 759
140 Ga0105246_10251852 3300011119 Unclassified 1402
141 Ga0105246_10362933 3300011119 Bacteria 1191
142 Ga0157374_10168457 3300013296 Bacteria 2136
143 Ga0157375_10153538 3300013308 Bacteria 2439
144 Ga0157375_10272953 3300013308 Bacteria 1853
145 Ga0157375_10591973 3300013308 Bacteria 1269
146 Ga0157375_11655436 3300013308 Bacteria 757
147 Ga0163163_10054390 3300014325 Bacteria 3955
148 Ga0157380_10146225 3300014326 Bacteria 2037
149 Ga0157380_10197531 3300014326 Bacteria 1782
150 Ga0157377_10502797 3300014745 Bacteria 847
151 Ga0163161_11043070 3300017792 Bacteria 700
152 Ga0207697_10001012 3300025315 Bacteria 15720
153 Ga0207656_10290463 3300025321 Bacteria 808
154 Ga0207642_10047615 3300025899 Unclassified 1917
155 Ga0207642_10502777 3300025899 Bacteria 742
156 Ga0207688_10026205 3300025901 Bacteria 3204
157 Ga0207688_10077400 3300025901 Bacteria 1895
158 Ga0207680_10406953 3300025903 Bacteria 962
159 Ga0207645_10000802 3300025907 Bacteria 26290
160 Ga0207645_10070943 3300025907 Bacteria 2229
161 Ga0207660_10489169 3300025917 Bacteria 998
162 Ga0207662_10051424 3300025918 Bacteria 2452
163 Ga0207681_10014159 3300025923 Bacteria 4949
164 Ga0207681_10874721 3300025923 Bacteria 752
165 Ga0207650_10435064 3300025925 Bacteria 1090
166 Ga0207659_10391404 3300025926 Bacteria 1161
167 Ga0207659_10678883 3300025926 Bacteria 881
168 Ga0207644_10083791 3300025931 Bacteria 2362
169 Ga0207644_10504016 3300025931 Bacteria 999
170 Ga0207706_10051795 3300025933 Bacteria 3625
171 Ga0207709_10026775 3300025935 Bacteria 3315
172 Ga0207709_10351405 3300025935 Bacteria 1113
173 Ga0207670_10134091 3300025936 Bacteria 1818
174 Ga0207669_10254082 3300025937 Bacteria 1310
175 Ga0207669_10313785 3300025937 Bacteria 1197
176 Ga0207704_10030247 3300025938 Bacteria 3033
177 Ga0207704_10049656 3300025938 Bacteria 2526
178 Ga0207704_10096767 3300025938 Bacteria 1956
179 Ga0207704_10146454 3300025938 Bacteria 1660
180 Ga0207691_10377412 3300025940 Bacteria 1211
181 Ga0207711_10119569 3300025941 Bacteria 2351
182 Ga0207711_10566698 3300025941 Bacteria 1059
183 Ga0207661_10000600 3300025944 Bacteria 22994
184 Ga0207661_10112959 3300025944 Bacteria 2301
185 Ga0207651_10098551 3300025960 Unclassified 2162
186 Ga0207651_10826367 3300025960 Bacteria 822
187 Ga0207712_10128588 3300025961 Bacteria 1927
188 Ga0207712_10501644 3300025961 Bacteria 1037
189 Ga0207712_10664458 3300025961 Bacteria 907
190 Ga0207712_10846068 3300025961 Bacteria 806
191 Ga0207668_10493996 3300025972 Bacteria 1052
192 Ga0207640_10001184 3300025981 Bacteria 14256
193 Ga0207703_10088906 3300026035 Bacteria 2593
194 Ga0207703_10389192 3300026035 Bacteria 1291
195 Ga0207639_10290776 3300026041 Bacteria 1441
196 Ga0207678_10065112 3300026067 Bacteria 3130
197 Ga0207708_10003693 3300026075 Bacteria 11298
198 Ga0207708_10032219 3300026075 Bacteria 3981
199 Ga0207648_10017009 3300026089 Bacteria 6627
200 Ga0207648_10041242 3300026089 Bacteria 4053
201 Ga0207676_10195897 3300026095 Bacteria 1782
202 Ga0207676_10255323 3300026095 Bacteria 1580
203 Ga0207676_10405019 3300026095 Bacteria 1276
204 Ga0207676_11007299 3300026095 Unclassified 821
205 Ga0207674_10020785 3300026116 Bacteria 7084
206 Ga0207675_100004573 3300026118 Bacteria 13347
207 Ga0207675_100036702 3300026118 Bacteria 4571
208 Ga0207675_100174319 3300026118 Bacteria 2057
209 Ga0207675_100681295 3300026118 Bacteria 1036
210 Ga0207675_100990674 3300026118 Bacteria 859
211 Ga0207683_10020548 3300026121 Bacteria 5649
212 Ga0207683_10775829 3300026121 Bacteria 889
213 Ga0207428_10016216 3300027907 Bacteria 6415
214 Ga0207428_10016482 3300027907 Bacteria 6355
215 Ga0207428_10085010 3300027907 Bacteria 2465
216 Ga0268266_10591685 3300028379 Bacteria 1065
217 Ga0268265_10025473 3300028380 Bacteria 4199
218 Ga0268265_10054392 3300028380 Bacteria 3037
219 Ga0268265_10326076 3300028380 Unclassified 1393
220 Ga0268265_11777510 3300028380 Bacteria 623
221 Ga0268264_10007844 3300028381 Bacteria 8886
222 Ga0268264_10051074 3300028381 Bacteria 3445
223 Ga0268264_10913117 3300028381 Bacteria 882
224 Ga0307413_11240635 3300031824 Bacteria 650
225 Ga0373943_0218928 3300035170 Bacteria 1060
226 Ga0451851_0637157 3300041507 Bacteria 1015
227 Ga0451577_0150839 3300042876 Bacteria 2091
228 Ga0451577_0155216 3300042876 Bacteria 2060
229 Ga0453684_0143673 3300044712 Bacteria 2845
230 Ga0451576_0161748 3300045051 Bacteria 2337
231 Ga0495653_0067418 3300046463 Bacteria 2688
232 Ga0495594_0065394 3300046499 Bacteria 2017
233 Ga0495586_0317348 3300046535 Bacteria 893
234 Ga0495622_0264310 3300046557 Bacteria 755
235 Ga0495676_0468067 3300047321 Bacteria 830
236 Ga0496102_0188464 3300048905 Bacteria 1944
237 Ga0496104_0004899 3300048907 Bacteria 11674
238 Ga0496106_0543896 3300048909 Bacteria 932
239 Ga0496107_0095698 3300048910 Bacteria 2173
240 Ga0496108_0001072 3300048911 Bacteria 21340
241 Ga0496109_0001229 3300048912 Bacteria 21283
242 Ga0496109_0299698 3300048912 Unclassified 1516
243 Ga0496109_0739527 3300048912 Bacteria 921
244 Ga0496110_0001039 3300048913 Bacteria 19543
245 Ga0496110_0160461 3300048913 Bacteria 2038
246 Ga0496111_0019595 3300048914 Bacteria 4704
247 Ga0496112_0001561 3300048915 Bacteria 17703
248 Ga0496113_0219161 3300048916 Unclassified 1516
249 Ga0496114_0262640 3300048917 Bacteria 1520
250 Ga0496115_0107220 3300048918 Bacteria 2294
251 Ga0501038_0376237 3300049574 Bacteria 1102
252 Ga0501072_0204987 3300049588 Bacteria 1572
253 Ga0501075_0611674 3300049591 Bacteria 831
254 Ga0501079_0585658 3300049741 Bacteria 878
255 Ga0501080_1410626 3300049742 Bacteria 594
256 Ga0501045_0589222 3300049824 Bacteria 824
257 nmdc:mga05p37_16708_c1 3300050507 Bacteria 8844
258 nmdc:mga05p37_24305_c1 3300050507 Bacteria 6494
259 nmdc:mga05p37_31481_c1 3300050507 Bacteria 6479
260 nmdc:mga09592_17447_c1 3300050508 Bacteria 5881
261 nmdc:mga09592_455854_c1 3300050508 Bacteria 1103
262 nmdc:mga09592_68573_c1 3300050508 Bacteria 3008
263 nmdc:mga0qj67_19822_c1 3300050509 Bacteria 5144
264 nmdc:mga0qj67_96221_c1 3300050509 Bacteria 2384
265 nmdc:mga06r32_150686_c1 3300050510 Bacteria 2304
266 nmdc:mga06r32_46524_c1 3300050510 Bacteria 4140
267 nmdc:mga06r32_869027_c1 3300050510 Bacteria 860
268 nmdc:mga08y16_132148_c1 3300050511 Bacteria 2595
269 nmdc:mga08y16_143245_c1 3300050511 Bacteria 2485
270 nmdc:mga08y16_3591_c1 3300050511 Bacteria 16109
271 nmdc:mga08y16_373097_c1 3300050511 Bacteria 1463
272 nmdc:mga08y16_81224_c1 3300050511 Bacteria 3380
273 nmdc:mga0n895_1031102_c1 3300050512 Bacteria 803
274 nmdc:mga0rr50_111258_c1 3300050513 Bacteria 2167
275 nmdc:mga0rr50_164070_c1 3300050513 Bacteria 1805
276 nmdc:mga08x19_174383_c1 3300050514 Bacteria 1465
277 nmdc:mga08x19_312535_c1 3300050514 Bacteria 1093
278 nmdc:mga0a205_150242_c1 3300050515 Bacteria 2229
279 nmdc:mga0a205_154759_c1 3300050515 Unclassified 2191
280 nmdc:mga0a205_48666_c1 3300050515 Bacteria 4092
281 Ga0501082_0294528 3300060353 Bacteria 1413
282 Ga0451576_0003645
283 MBSR1b_contig_13990851
284 Ga0065712_10000485
285 Ga0065712_10071100
286 Ga0065715_10099963
287 Ga0065715_10184816
288 Ga0065715_10190788
289 Ga0065707_10109901
290 Ga0070676_10064728
291 Ga0070683_100000857
292 Ga0070683_100334396
293 Ga0070690_100024967
294 Ga0070690_100491485
295 Ga0070670_100041349
296 Ga0070670_100088314
297 Ga0070670_100384336
298 Ga0070670_100575934
299 Ga0070666_10016739
300 Ga0070680_100068639
301 Ga0068868_100084575
302 Ga0070691_10001081
303 Ga0070687_100154589
304 Ga0070661_100343902
305 Ga0070668_100055676
306 Ga0070668_100304617
307 Ga0070669_100002972
308 Ga0070669_100073654
309 Ga0070669_100125922
310 Ga0070669_101030748
311 Ga0070675_100171758
312 Ga0070675_100256572
313 Ga0070675_101485961
314 Ga0070671_100026542
315 Ga0070671_100215002
316 Ga0070674_100002729
317 Ga0070674_100181191
318 Ga0070674_100512441
319 Ga0070673_100886248
320 Ga0070688_100114836
321 Ga0070688_100299297
322 Ga0070659_100699730
323 Ga0070701_10001830
324 Ga0070701_10141606
325 Ga0070701_10427646
326 Ga0070705_100001314
327 Ga0070700_100001496
328 Ga0070700_100713663
329 Ga0070694_100003841
330 Ga0070678_100114481
331 Ga0070678_100427987
332 Ga0068867_100024164
333 Ga0068867_100170741
334 Ga0068867_101285601
335 Ga0070707_101402347
336 Ga0070698_100149048
337 Ga0070698_100210326
338 Ga0070684_100000384
339 Ga0070684_100273759
340 Ga0068853_100537883
341 Ga0070672_100495642
342 Ga0070686_100001857
343 Ga0070695_100007402
344 Ga0070695_100567610
345 Ga0070665_100183153
346 Ga0070665_100388118
347 Ga0070704_100160057
348 Ga0070704_100339352
349 Ga0068855_100264049
350 Ga0070664_100000442
351 Ga0070664_100419190
352 Ga0068857_100022947
353 Ga0068854_100010165
354 Ga0070702_100028656
355 Ga0068859_100047722
356 Ga0068859_100478212
357 Ga0068859_101577788
358 Ga0068864_100596605
359 Ga0068864_101432021
360 Ga0068866_10010088
361 Ga0068861_100001397
362 Ga0068861_100271056
363 Ga0068861_100451583
364 Ga0068861_100499179
365 Ga0068861_100581006
366 Ga0068861_100748458
367 Ga0068851_10276489
368 Ga0068858_101058596
369 Ga0068860_100012227
370 Ga0068860_100176456
371 Ga0068860_100324627
372 Ga0068862_100025130
373 Ga0068862_100043714
374 Ga0068862_100348449
375 Ga0068862_100798380
376 Ga0075428_100016132
377 Ga0075428_100022183
378 Ga0075428_101065670
379 Ga0075430_100004147
380 Ga0075430_100049134
381 Ga0075431_100030516
382 Ga0075431_100054613
383 Ga0075433_10039685
384 Ga0075433_10190940
385 Ga0075433_10913507
386 Ga0075434_101154432
387 Ga0075429_100022466
388 Ga0075429_100026882
389 Ga0075429_100502948
390 Ga0075429_100761136
391 Ga0068865_100084700
392 Ga0068865_100254617
393 Ga0068865_100309660
394 Ga0075436_100111220
395 Ga0075436_100289017
396 Ga0097620_100047721
397 Ga0097620_100478191
398 Ga0097620_101577949
399 Ga0075435_100801274
400 Ga0111539_10002104
401 Ga0111539_10004657
402 Ga0111539_10273862
403 Ga0111539_11073298
404 Ga0114129_10008634
405 Ga0114129_10011193
406 Ga0114129_10018670
407 Ga0105243_10011387
408 Ga0105243_10029935
409 Ga0105243_10307117
410 Ga0105243_10964398
411 Ga0105248_10582558
412 Ga0105248_11242569
413 Ga0105249_10054836
414 Ga0105249_10247342
415 Ga0105249_10424104
416 Ga0105249_10566527
417 Ga0105249_10600058
418 Ga0105249_10657139
419 Ga0105249_11200254
420 Ga0105239_11577159
421 Ga0105246_10251852
422 Ga0105246_10362933
423 Ga0157374_10168457
424 Ga0157375_10153538
425 Ga0157375_10272953
426 Ga0157375_10591973
427 Ga0157375_11655436
428 Ga0163163_10054390
429 Ga0157380_10146225
430 Ga0157380_10197531
431 Ga0157377_10502797
432 Ga0163161_11043070
433 Ga0207697_10001012
434 Ga0207656_10290463
435 Ga0207642_10047615
436 Ga0207642_10502777
437 Ga0207688_10026205
438 Ga0207688_10077400
439 Ga0207680_10406953
440 Ga0207645_10000802
441 Ga0207645_10070943
442 Ga0207660_10489169
443 Ga0207662_10051424
444 Ga0207681_10014159
445 Ga0207681_10874721
446 Ga0207650_10435064
447 Ga0207659_10391404
448 Ga0207659_10678883
449 Ga0207644_10083791
450 Ga0207644_10504016
451 Ga0207706_10051795
452 Ga0207709_10026775
453 Ga0207709_10351405
454 Ga0207670_10134091
455 Ga0207669_10254082
456 Ga0207669_10313785
457 Ga0207704_10030247
458 Ga0207704_10049656
459 Ga0207704_10096767
460 Ga0207704_10146454
461 Ga0207691_10377412
462 Ga0207711_10119569
463 Ga0207711_10566698
464 Ga0207661_10000600
465 Ga0207661_10112959
466 Ga0207651_10098551
467 Ga0207651_10826367
468 Ga0207712_10128588
469 Ga0207712_10501644
470 Ga0207712_10664458
471 Ga0207712_10846068
472 Ga0207668_10493996
473 Ga0207640_10001184
474 Ga0207703_10088906
475 Ga0207703_10389192
476 Ga0207639_10290776
477 Ga0207678_10065112
478 Ga0207708_10003693
479 Ga0207708_10032219
480 Ga0207648_10017009
481 Ga0207648_10041242
482 Ga0207676_10195897
483 Ga0207676_10255323
484 Ga0207676_10405019
485 Ga0207676_11007299
486 Ga0207674_10020785
487 Ga0207675_100004573
488 Ga0207675_100036702
489 Ga0207675_100174319
490 Ga0207675_100681295
491 Ga0207675_100990674
492 Ga0207683_10020548
493 Ga0207683_10775829
494 Ga0207428_10016216
495 Ga0207428_10016482
496 Ga0207428_10085010
497 Ga0268266_10591685
498 Ga0268265_10025473
499 Ga0268265_10054392
500 Ga0268265_10326076
501 Ga0268265_11777510
502 Ga0268264_10007844
503 Ga0268264_10051074
504 Ga0268264_10913117
505 Ga0307413_11240635
506 Ga0373943_0218928
507 Ga0451851_0637157
508 Ga0451577_0150839
509 Ga0451577_0155216
510 Ga0453684_0143673
511 Ga0451576_0161748
512 Ga0495653_0067418
513 Ga0495594_0065394
514 Ga0495586_0317348
515 Ga0495622_0264310
516 Ga0495676_0468067
517 Ga0496102_0188464
518 Ga0496104_0004899
519 Ga0496106_0543896
520 Ga0496107_0095698
521 Ga0496108_0001072
522 Ga0496109_0001229
523 Ga0496109_0299698
524 Ga0496109_0739527
525 Ga0496110_0001039
526 Ga0496110_0160461
527 Ga0496111_0019595
528 Ga0496112_0001561
529 Ga0496113_0219161
530 Ga0496114_0262640
531 Ga0496115_0107220
532 Ga0501038_0376237
533 Ga0501072_0204987
534 Ga0501075_0611674
535 Ga0501079_0585658
536 Ga0501080_1410626
537 Ga0501045_0589222
538 nmdc:mga05p37_16708_c1
539 nmdc:mga05p37_24305_c1
540 nmdc:mga05p37_31481_c1
541 nmdc:mga09592_17447_c1
542 nmdc:mga09592_455854_c1
543 nmdc:mga09592_68573_c1
544 nmdc:mga0qj67_19822_c1
545 nmdc:mga0qj67_96221_c1
546 nmdc:mga06r32_150686_c1
547 nmdc:mga06r32_46524_c1
548 nmdc:mga06r32_869027_c1
549 nmdc:mga08y16_132148_c1
550 nmdc:mga08y16_143245_c1
551 nmdc:mga08y16_3591_c1
552 nmdc:mga08y16_373097_c1
553 nmdc:mga08y16_81224_c1
554 nmdc:mga0n895_1031102_c1
555 nmdc:mga0rr50_111258_c1
556 nmdc:mga0rr50_164070_c1
557 nmdc:mga08x19_174383_c1
558 nmdc:mga08x19_312535_c1
559 nmdc:mga0a205_150242_c1
560 nmdc:mga0a205_154759_c1
561 nmdc:mga0a205_48666_c1
562 Ga0501082_0294528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

76

153

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.986 3 165
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.9806 3 166
4umf-assembly1.cif.gz_C crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule 0.9767 3 171
3nrj-assembly3.cif.gz_I crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium 0.9747 3 171
3n07-assembly1.cif.gz_A-1 structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae 0.9725 3 163
ID Description Score Start End Superfamily
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9816 3 163 3.40.50.1000
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9746 3 171 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9674 3 172 3.40.50.1000
1j8dB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9588 5 162 3.40.50.1000
3mmzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9584 7 158 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7W0FM05-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9932 3 174 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A2E4WAY8-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9927 3 164 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A7C7L7L6-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9918 3 168 GO:0008781
GO:0009103
GO:0016788
AF-A0A317HV95-F1-model_v4 Phenylphosphate carboxylase subunit delta 0.9914 4 171 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A7V9AW43-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9909 2 172 GO:0008781
GO:0009103
GO:0016788
GO:0046872

Map