F384430

General Info

Members Datasets Scaffolds Average Seq Length
281 188 562 158

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0024544|Ga0395900_0024544_2222_2710
Length 162
Sequence MRAPAASIHPARRRVLTAGGLAAGSAVLAAPLRAADAALDDSKPFAEHRLALQLSDRSQDKHALILSVANNILKAYGPDLVAIEVVAFGPGIDLLLAASPNRARVDSLIAQGVRFDVCMNTVDTIERDTGRKVELNPQARKVQVGVARIIELCENRYVLVRP

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
32 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
33 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
78 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
79 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
80 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
164 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
165 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
166 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
167 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
168 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
169 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
170 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
178 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
182 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
183 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
186 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
187 2643221651 Afipia sp. Root123D2 Isolate Unclassified
188 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0.71
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.88
Nodule 2.85
Rhizoplane 2.85
Rhizosphere 73.31
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0024544 3300037418 Bacteria 6173
2 Ga0070658_10059853 3300005327 Bacteria 3101
3 Ga0070658_10104752 3300005327 Bacteria 2340
4 Ga0070683_100113376 3300005329 Bacteria 2559
5 Ga0070680_100021709 3300005336 Bacteria 5105
6 Ga0070680_100072853 3300005336 Bacteria 2824
7 Ga0070680_100074828 3300005336 Bacteria 2787
8 Ga0070682_100395155 3300005337 Bacteria 1044
9 Ga0070660_100025374 3300005339 Bacteria 4406
10 Ga0070661_100274064 3300005344 Bacteria 1307
11 Ga0070661_100295991 3300005344 Bacteria 1259
12 Ga0070675_101279078 3300005354 Bacteria 676
13 Ga0070659_100014636 3300005366 Bacteria 5866
14 Ga0070709_10740837 3300005434 Bacteria 767
15 Ga0070714_100257543 3300005435 Bacteria 1615
16 Ga0070663_100568862 3300005455 Bacteria 949
17 Ga0070678_100183810 3300005456 Bacteria 1713
18 Ga0070681_10016067 3300005458 Bacteria 7460
19 Ga0070679_100047901 3300005530 Bacteria 4259
20 Ga0070679_100508584 3300005530 Bacteria 1148
21 Ga0070679_100746550 3300005530 Bacteria 921
22 Ga0070684_100043213 3300005535 Bacteria 3891
23 Ga0070684_100424882 3300005535 Bacteria 1227
24 Ga0068855_100049831 3300005563 Bacteria 4937
25 Ga0068855_100078812 3300005563 Bacteria 3821
26 Ga0068855_100125096 3300005563 Bacteria 2940
27 Ga0068855_100289681 3300005563 Bacteria 1815
28 Ga0068855_100657784 3300005563 Bacteria 1125
29 Ga0070664_100097873 3300005564 Bacteria 2548
30 Ga0068857_100210140 3300005577 Bacteria 1776
31 Ga0068857_100362248 3300005577 Bacteria 1344
32 Ga0068857_100874918 3300005577 Bacteria 861
33 Ga0068854_100165476 3300005578 Bacteria 1716
34 Ga0068856_100057458 3300005614 Bacteria 3841
35 Ga0068856_100162238 3300005614 Bacteria 2246
36 Ga0068856_101315753 3300005614 Bacteria 738
37 Ga0068852_100075043 3300005616 Bacteria 2981
38 Ga0068852_100099563 3300005616 Bacteria 2620
39 Ga0068863_100552585 3300005841 Bacteria 1137
40 Ga0081538_10030588 3300005981 Bacteria 3651
41 Ga0081540_1055491 3300005983 Bacteria 1929
42 Ga0075365_10012979 3300006038 Bacteria 4968
43 Ga0075368_10155186 3300006042 Bacteria 957
44 Ga0070712_100062019 3300006175 Bacteria 2643
45 Ga0075369_10023497 3300006186 Bacteria 2549
46 Ga0068871_100171402 3300006358 Bacteria 1860
47 Ga0099825_1040411 3300006941 Bacteria 1385
48 Ga0099824_1001145 3300006942 Bacteria 36195
49 Ga0099822_1000135 3300006943 Bacteria 49135
50 Ga0099794_10080243 3300007265 Bacteria 1608
51 Ga0099795_10088962 3300007788 Bacteria 1194
52 Ga0105240_10569337 3300009093 Bacteria 1251
53 Ga0105242_10949653 3300009176 Bacteria 864
54 Ga0105237_10028115 3300009545 Bacteria 5730
55 Ga0105238_10283379 3300009551 Bacteria 1638
56 Ga0105238_10385991 3300009551 Bacteria 1392
57 Ga0105238_11122895 3300009551 Bacteria 809
58 Ga0105238_11283592 3300009551 Bacteria 758
59 Ga0099796_10049177 3300010159 Bacteria 1457
60 Ga0099796_10171930 3300010159 Bacteria 865
61 Ga0105239_11260554 3300010375 Bacteria 852
62 Ga0157373_10092804 3300013100 Bacteria 2126
63 Ga0157373_10129080 3300013100 Bacteria 1777
64 Ga0157371_10301288 3300013102 Bacteria 1160
65 Ga0157370_10186909 3300013104 Bacteria 1923
66 Ga0157370_10385991 3300013104 Bacteria 1290
67 Ga0157370_10389375 3300013104 Bacteria 1283
68 Ga0157370_10445717 3300013104 Bacteria 1190
69 Ga0157370_10990402 3300013104 Bacteria 761
70 Ga0157369_10240524 3300013105 Bacteria 1891
71 Ga0157369_10557164 3300013105 Bacteria 1184
72 Ga0157378_10012723 3300013297 Bacteria 7363
73 Ga0157372_10164011 3300013307 Bacteria 2569
74 Ga0157372_10321126 3300013307 Bacteria 1803
75 Ga0157372_10576041 3300013307 Bacteria 1312
76 Ga0157372_11043374 3300013307 Bacteria 946
77 Ga0157372_11844735 3300013307 Bacteria 695
78 Ga0182008_10129538 3300014497 Bacteria 1257
79 Ga0206356_11857533 3300020070 Bacteria 2915
80 Ga0206350_10475326 3300020080 Bacteria 583
81 Ga0207656_10032162 3300025321 Bacteria 2178
82 Ga0207647_10075668 3300025904 Bacteria 2026
83 Ga0207705_10015389 3300025909 Bacteria 5489
84 Ga0207705_10031704 3300025909 Bacteria 3775
85 Ga0207705_10094945 3300025909 Bacteria 2188
86 Ga0207707_10025924 3300025912 Bacteria 5127
87 Ga0207707_10040318 3300025912 Bacteria 4078
88 Ga0207707_10575527 3300025912 Unclassified 955
89 Ga0207707_10965917 3300025912 Unclassified 701
90 Ga0207695_10114206 3300025913 Bacteria 2676
91 Ga0207671_10021105 3300025914 Bacteria 4947
92 Ga0207693_10065401 3300025915 Bacteria 2848
93 Ga0207660_10052156 3300025917 Bacteria 2911
94 Ga0207660_10312287 3300025917 Bacteria 1254
95 Ga0207660_11089012 3300025917 Bacteria 651
96 Ga0207657_10012728 3300025919 Bacteria 8286
97 Ga0207657_10022149 3300025919 Bacteria 5960
98 Ga0207657_10061134 3300025919 Bacteria 3231
99 Ga0207657_10516194 3300025919 Bacteria 935
100 Ga0207649_10220693 3300025920 Bacteria 1350
101 Ga0207652_10065061 3300025921 Bacteria 3156
102 Ga0207652_10123804 3300025921 Bacteria 2302
103 Ga0207652_10362498 3300025921 Bacteria 1308
104 Ga0207652_10464019 3300025921 Bacteria 1141
105 Ga0207652_10811061 3300025921 Bacteria 831
106 Ga0207681_10766449 3300025923 Bacteria 805
107 Ga0207694_10023734 3300025924 Bacteria 4657
108 Ga0207694_10518763 3300025924 Bacteria 998
109 Ga0207687_10239983 3300025927 Bacteria 1436
110 Ga0207664_10110370 3300025929 Bacteria 2287
111 Ga0207664_11374431 3300025929 Unclassified 627
112 Ga0207690_10020060 3300025932 Bacteria 4124
113 Ga0207690_10292367 3300025932 Bacteria 1272
114 Ga0207661_10031859 3300025944 Bacteria 4078
115 Ga0207661_10133993 3300025944 Bacteria 2126
116 Ga0207661_10244908 3300025944 Bacteria 1592
117 Ga0207667_10057659 3300025949 Bacteria 4076
118 Ga0207667_10075012 3300025949 Bacteria 3512
119 Ga0207667_10076124 3300025949 Bacteria 3483
120 Ga0207667_10528516 3300025949 Bacteria 1194
121 Ga0207667_10885529 3300025949 Bacteria 885
122 Ga0207640_10228801 3300025981 Bacteria 1429
123 Ga0207703_10742491 3300026035 Bacteria 935
124 Ga0207639_10062598 3300026041 Bacteria 2878
125 Ga0207639_11591926 3300026041 Unclassified 613
126 Ga0207678_10060565 3300026067 Bacteria 3256
127 Ga0207702_10232937 3300026078 Bacteria 1722
128 Ga0207702_10377686 3300026078 Bacteria 1362
129 Ga0207702_10666671 3300026078 Bacteria 1024
130 Ga0207702_11009699 3300026078 Bacteria 825
131 Ga0207641_10503046 3300026088 Bacteria 1177
132 Ga0207674_10089826 3300026116 Bacteria 3065
133 Ga0207674_10097152 3300026116 Bacteria 2929
134 Ga0207674_10404645 3300026116 Bacteria 1319
135 Ga0207674_10717128 3300026116 Bacteria 965
136 Ga0207698_10018441 3300026142 Bacteria 4755
137 Ga0207698_10158521 3300026142 Bacteria 1976
138 Ga0207698_10307223 3300026142 Bacteria 1479
139 Ga0207698_10623073 3300026142 Bacteria 1066
140 Ga0209589_1000017 3300027357 Bacteria 215546
141 Ga0209489_100018 3300027361 Bacteria 215546
142 Ga0209700_100028 3300027363 Bacteria 215546
143 Ga0209179_1000198 3300027512 Bacteria 5656
144 Ga0268266_10162107 3300028379 Bacteria 2024
145 Ga0265334_10071622 3300028573 Bacteria 1290
146 Ga0307515_10033981 3300028794 Bacteria 8371
147 Ga0265338_10013087 3300028800 Bacteria 9401
148 Ga0265338_10019779 3300028800 Bacteria 7118
149 Ga0265330_10040878 3300031235 Bacteria 2058
150 Ga0265330_10271228 3300031235 Unclassified 715
151 Ga0265325_10014373 3300031241 Bacteria 4476
152 Ga0265325_10142835 3300031241 Bacteria 1137
153 Ga0265339_10000047 3300031249 Bacteria 110601
154 Ga0265316_11071985 3300031344 Bacteria 559
155 Ga0265313_10000992 3300031595 Bacteria 27897
156 Ga0265313_10007846 3300031595 Bacteria 7200
157 Ga0265342_10000082 3300031712 Bacteria 102532
158 Ga0265342_10040613 3300031712 Bacteria 2821
159 Ga0265342_10164100 3300031712 Bacteria 1226
160 Ga0307405_10589702 3300031731 Bacteria 905
161 Ga0307406_10535400 3300031901 Bacteria 956
162 Ga0307412_10113072 3300031911 Bacteria 1942
163 Ga0373953_0377505 3300035117 Bacteria 623
164 Ga0373927_0005319 3300035695 Bacteria 8895
165 Ga0373927_0024013 3300035695 Bacteria 3989
166 Ga0373947_0023859 3300035725 Bacteria 3561
167 Ga0373925_1305600 3300037068 Bacteria 595
168 Ga0395900_0254622 3300037418 Bacteria 1755
169 Ga0395900_0393592 3300037418 Bacteria 1351
170 Ga0395898_0014967 3300037466 Bacteria 7965
171 Ga0395898_0156585 3300037466 Bacteria 2179
172 Ga0395898_0208824 3300037466 Bacteria 1863
173 Ga0395901_0084702 3300038443 Bacteria 3313
174 Ga0395901_0122353 3300038443 Bacteria 2735
175 Ga0395901_0202186 3300038443 Bacteria 2082
176 Ga0395901_0964379 3300038443 Bacteria 831
177 Ga0451843_1562513 3300041509 Bacteria 580
178 Ga0466963_0368666 3300044694 Bacteria 1012
179 Ga0495638_0009373 3300046460 Bacteria 6882
180 Ga0495582_0161823 3300046473 Bacteria 1273
181 Ga0495639_0440876 3300046475 Bacteria 661
182 Ga0495607_0126839 3300046501 Bacteria 1333
183 Ga0495583_0080600 3300046506 Bacteria 1415
184 Ga0495610_0104053 3300046512 Bacteria 1267
185 Ga0495620_0090028 3300046515 Bacteria 1232
186 Ga0495631_0043075 3300046518 Bacteria 1992
187 Ga0495643_0116872 3300046522 Bacteria 1351
188 Ga0495648_0000859 3300046524 Bacteria 32055
189 Ga0495665_0034641 3300046531 Bacteria 2700
190 Ga0495640_0145024 3300046533 Bacteria 1528
191 Ga0495597_0103284 3300046542 Bacteria 1200
192 Ga0495633_0313728 3300046558 Bacteria 712
193 Ga0495668_0266952 3300046616 Bacteria 937
194 Ga0495625_0117044 3300046660 Bacteria 1817
195 Ga0495661_0077102 3300046665 Bacteria 1932
196 Ga0495647_0211347 3300046681 Bacteria 853
197 Ga0495658_0057250 3300046683 Bacteria 2226
198 Ga0495613_0110101 3300046689 Bacteria 1985
199 Ga0495581_0130002 3300047315 Bacteria 1467
200 Ga0495604_0732298 3300047317 Bacteria 626
201 Ga0495672_0016725 3300047320 Bacteria 4927
202 Ga0495676_0068334 3300047321 Bacteria 2746
203 Ga0495602_0229696 3300048088 Bacteria 1395
204 Ga0496100_0116851 3300048903 Bacteria 1862
205 Ga0496104_0109773 3300048907 Bacteria 2644
206 Ga0496105_0169687 3300048908 Bacteria 1789
207 Ga0496106_0547566 3300048909 Bacteria 928
208 Ga0496110_0382198 3300048913 Bacteria 1283
209 Ga0496114_0325322 3300048917 Bacteria 1359
210 Ga0496115_0022097 3300048918 Bacteria 4922
211 Ga0496116_0004670 3300048919 Bacteria 12966
212 Ga0496116_0103272 3300048919 Bacteria 1697
213 Ga0496117_0010575 3300048920 Bacteria 8386
214 Ga0496117_0038883 3300048920 Bacteria 3519
215 Ga0496118_0123731 3300048921 Bacteria 1679
216 Ga0496119_0377431 3300048922 Bacteria 681
217 Ga0496120_0015790 3300048923 Bacteria 4963
218 Ga0496121_0001090 3300048924 Bacteria 47969
219 Ga0496121_0099991 3300048924 Bacteria 2240
220 Ga0496122_0505488 3300048925 Bacteria 586
221 Ga0496123_0006238 3300048926 Bacteria 11627
222 Ga0496124_0371304 3300048927 Bacteria 1004
223 Ga0496124_0412992 3300048927 Bacteria 933
224 Ga0496125_0000566 3300048928 Bacteria 63595
225 Ga0496125_0000964 3300048928 Bacteria 45175
226 Ga0496126_0389793 3300048929 Bacteria 1132
227 Ga0496126_0735755 3300048929 Bacteria 763
228 Ga0501031_0401934 3300049568 Bacteria 886
229 Ga0501034_0358019 3300049571 Bacteria 1387
230 Ga0501038_1221253 3300049574 Bacteria 545
231 Ga0501039_0736912 3300049575 Bacteria 770
232 Ga0501043_0144273 3300049579 Bacteria 1864
233 Ga0501047_0054322 3300049581 Bacteria 3874
234 Ga0501047_0080722 3300049581 Bacteria 3126
235 Ga0501047_0332042 3300049581 Bacteria 1359
236 Ga0501044_0172242 3300049823 Bacteria 2135
237 Ga0501044_0235042 3300049823 Bacteria 1779
238 nmdc:mga03n38_608413_c1 3300050490 Bacteria 623
239 nmdc:mga0yw44_42974_c1 3300050492 Bacteria 2697
240 nmdc:mga0sz30_24466_c1 3300050516 Bacteria 2464
241 Ga0495601_0413719 3300053077 Bacteria 874
242 Ga0495612_0050224 3300053078 Bacteria 1713
243 Ga0495655_0059787 3300053083 Bacteria 1036
244 Ga0495595_0107690 3300053084 Bacteria 1349
245 Ga0500643_008995 3300053087 Bacteria 3859
246 Ga0500644_0286270 3300053088 Bacteria 702
247 Ga0500581_092442 3300053089 Bacteria 1497
248 Ga0500581_113281 3300053089 Bacteria 1318
249 Ga0500651_0122537 3300053093 Bacteria 1577
250 Ga0500566_0000208 3300053094 Bacteria 31057
251 Ga0500650_0000130 3300053098 Bacteria 19817
252 Ga0500556_0000066 3300053104 Bacteria 105850
253 Ga0500556_0036315 3300053104 Bacteria 1708
254 Ga0500562_063745 3300053108 Bacteria 991
255 Ga0500592_020053 3300053116 Bacteria 1076
256 Ga0500594_0009876 3300053118 Bacteria 2205
257 Ga0500607_070352 3300053121 Bacteria 1809
258 Ga0500607_275662 3300053121 Bacteria 645
259 Ga0500608_092865 3300053122 Bacteria 1408
260 Ga0500618_013164 3300053125 Bacteria 2147
261 Ga0500642_0000072 3300053130 Bacteria 55645
262 Ga0500652_000232 3300053131 Bacteria 21254
263 Ga0500658_0314094 3300053134 Bacteria 720
264 Ga0500559_0000413 3300053136 Bacteria 30711
265 Ga0500568_0000453 3300053139 Bacteria 30769
266 Ga0500586_000407 3300053145 Bacteria 8599
267 Ga0500604_0012547 3300053151 Bacteria 2288
268 Ga0500604_0119281 3300053151 Bacteria 881
269 Ga0500616_0000028 3300053153 Bacteria 435722
270 Ga0500616_0000177 3300053153 Bacteria 106498
271 Ga0500622_0000223 3300053156 Bacteria 59337
272 Ga0500622_0259605 3300053156 Bacteria 758
273 Ga0500627_0106543 3300053158 Bacteria 1260
274 Ga0500633_0193751 3300053160 Bacteria 761
275 Ga0500634_0087443 3300053161 Bacteria 1591
276 Ga0500636_0016826 3300053177 Bacteria 4311
277 Ga0500636_0017510 3300053177 Bacteria 4234
278 2545677471 2545555834 Bacteria 8130841
279 2603856994 2602042107 Bacteria 6226103
280 2644291132 2643221651 Bacteria 4798932
281 641640480 641522639 Bacteria 7737025
282 Ga0395900_0024544
283 Ga0070658_10059853
284 Ga0070658_10104752
285 Ga0070683_100113376
286 Ga0070680_100021709
287 Ga0070680_100072853
288 Ga0070680_100074828
289 Ga0070682_100395155
290 Ga0070660_100025374
291 Ga0070661_100274064
292 Ga0070661_100295991
293 Ga0070675_101279078
294 Ga0070659_100014636
295 Ga0070709_10740837
296 Ga0070714_100257543
297 Ga0070663_100568862
298 Ga0070678_100183810
299 Ga0070681_10016067
300 Ga0070679_100047901
301 Ga0070679_100508584
302 Ga0070679_100746550
303 Ga0070684_100043213
304 Ga0070684_100424882
305 Ga0068855_100049831
306 Ga0068855_100078812
307 Ga0068855_100125096
308 Ga0068855_100289681
309 Ga0068855_100657784
310 Ga0070664_100097873
311 Ga0068857_100210140
312 Ga0068857_100362248
313 Ga0068857_100874918
314 Ga0068854_100165476
315 Ga0068856_100057458
316 Ga0068856_100162238
317 Ga0068856_101315753
318 Ga0068852_100075043
319 Ga0068852_100099563
320 Ga0068863_100552585
321 Ga0081538_10030588
322 Ga0081540_1055491
323 Ga0075365_10012979
324 Ga0075368_10155186
325 Ga0070712_100062019
326 Ga0075369_10023497
327 Ga0068871_100171402
328 Ga0099825_1040411
329 Ga0099824_1001145
330 Ga0099822_1000135
331 Ga0099794_10080243
332 Ga0099795_10088962
333 Ga0105240_10569337
334 Ga0105242_10949653
335 Ga0105237_10028115
336 Ga0105238_10283379
337 Ga0105238_10385991
338 Ga0105238_11122895
339 Ga0105238_11283592
340 Ga0099796_10049177
341 Ga0099796_10171930
342 Ga0105239_11260554
343 Ga0157373_10092804
344 Ga0157373_10129080
345 Ga0157371_10301288
346 Ga0157370_10186909
347 Ga0157370_10385991
348 Ga0157370_10389375
349 Ga0157370_10445717
350 Ga0157370_10990402
351 Ga0157369_10240524
352 Ga0157369_10557164
353 Ga0157378_10012723
354 Ga0157372_10164011
355 Ga0157372_10321126
356 Ga0157372_10576041
357 Ga0157372_11043374
358 Ga0157372_11844735
359 Ga0182008_10129538
360 Ga0206356_11857533
361 Ga0206350_10475326
362 Ga0207656_10032162
363 Ga0207647_10075668
364 Ga0207705_10015389
365 Ga0207705_10031704
366 Ga0207705_10094945
367 Ga0207707_10025924
368 Ga0207707_10040318
369 Ga0207707_10575527
370 Ga0207707_10965917
371 Ga0207695_10114206
372 Ga0207671_10021105
373 Ga0207693_10065401
374 Ga0207660_10052156
375 Ga0207660_10312287
376 Ga0207660_11089012
377 Ga0207657_10012728
378 Ga0207657_10022149
379 Ga0207657_10061134
380 Ga0207657_10516194
381 Ga0207649_10220693
382 Ga0207652_10065061
383 Ga0207652_10123804
384 Ga0207652_10362498
385 Ga0207652_10464019
386 Ga0207652_10811061
387 Ga0207681_10766449
388 Ga0207694_10023734
389 Ga0207694_10518763
390 Ga0207687_10239983
391 Ga0207664_10110370
392 Ga0207664_11374431
393 Ga0207690_10020060
394 Ga0207690_10292367
395 Ga0207661_10031859
396 Ga0207661_10133993
397 Ga0207661_10244908
398 Ga0207667_10057659
399 Ga0207667_10075012
400 Ga0207667_10076124
401 Ga0207667_10528516
402 Ga0207667_10885529
403 Ga0207640_10228801
404 Ga0207703_10742491
405 Ga0207639_10062598
406 Ga0207639_11591926
407 Ga0207678_10060565
408 Ga0207702_10232937
409 Ga0207702_10377686
410 Ga0207702_10666671
411 Ga0207702_11009699
412 Ga0207641_10503046
413 Ga0207674_10089826
414 Ga0207674_10097152
415 Ga0207674_10404645
416 Ga0207674_10717128
417 Ga0207698_10018441
418 Ga0207698_10158521
419 Ga0207698_10307223
420 Ga0207698_10623073
421 Ga0209589_1000017
422 Ga0209489_100018
423 Ga0209700_100028
424 Ga0209179_1000198
425 Ga0268266_10162107
426 Ga0265334_10071622
427 Ga0307515_10033981
428 Ga0265338_10013087
429 Ga0265338_10019779
430 Ga0265330_10040878
431 Ga0265330_10271228
432 Ga0265325_10014373
433 Ga0265325_10142835
434 Ga0265339_10000047
435 Ga0265316_11071985
436 Ga0265313_10000992
437 Ga0265313_10007846
438 Ga0265342_10000082
439 Ga0265342_10040613
440 Ga0265342_10164100
441 Ga0307405_10589702
442 Ga0307406_10535400
443 Ga0307412_10113072
444 Ga0373953_0377505
445 Ga0373927_0005319
446 Ga0373927_0024013
447 Ga0373947_0023859
448 Ga0373925_1305600
449 Ga0395900_0254622
450 Ga0395900_0393592
451 Ga0395898_0014967
452 Ga0395898_0156585
453 Ga0395898_0208824
454 Ga0395901_0084702
455 Ga0395901_0122353
456 Ga0395901_0202186
457 Ga0395901_0964379
458 Ga0451843_1562513
459 Ga0466963_0368666
460 Ga0495638_0009373
461 Ga0495582_0161823
462 Ga0495639_0440876
463 Ga0495607_0126839
464 Ga0495583_0080600
465 Ga0495610_0104053
466 Ga0495620_0090028
467 Ga0495631_0043075
468 Ga0495643_0116872
469 Ga0495648_0000859
470 Ga0495665_0034641
471 Ga0495640_0145024
472 Ga0495597_0103284
473 Ga0495633_0313728
474 Ga0495668_0266952
475 Ga0495625_0117044
476 Ga0495661_0077102
477 Ga0495647_0211347
478 Ga0495658_0057250
479 Ga0495613_0110101
480 Ga0495581_0130002
481 Ga0495604_0732298
482 Ga0495672_0016725
483 Ga0495676_0068334
484 Ga0495602_0229696
485 Ga0496100_0116851
486 Ga0496104_0109773
487 Ga0496105_0169687
488 Ga0496106_0547566
489 Ga0496110_0382198
490 Ga0496114_0325322
491 Ga0496115_0022097
492 Ga0496116_0004670
493 Ga0496116_0103272
494 Ga0496117_0010575
495 Ga0496117_0038883
496 Ga0496118_0123731
497 Ga0496119_0377431
498 Ga0496120_0015790
499 Ga0496121_0001090
500 Ga0496121_0099991
501 Ga0496122_0505488
502 Ga0496123_0006238
503 Ga0496124_0371304
504 Ga0496124_0412992
505 Ga0496125_0000566
506 Ga0496125_0000964
507 Ga0496126_0389793
508 Ga0496126_0735755
509 Ga0501031_0401934
510 Ga0501034_0358019
511 Ga0501038_1221253
512 Ga0501039_0736912
513 Ga0501043_0144273
514 Ga0501047_0054322
515 Ga0501047_0080722
516 Ga0501047_0332042
517 Ga0501044_0172242
518 Ga0501044_0235042
519 nmdc:mga03n38_608413_c1
520 nmdc:mga0yw44_42974_c1
521 nmdc:mga0sz30_24466_c1
522 Ga0495601_0413719
523 Ga0495612_0050224
524 Ga0495655_0059787
525 Ga0495595_0107690
526 Ga0500643_008995
527 Ga0500644_0286270
528 Ga0500581_092442
529 Ga0500581_113281
530 Ga0500651_0122537
531 Ga0500566_0000208
532 Ga0500650_0000130
533 Ga0500556_0000066
534 Ga0500556_0036315
535 Ga0500562_063745
536 Ga0500592_020053
537 Ga0500594_0009876
538 Ga0500607_070352
539 Ga0500607_275662
540 Ga0500608_092865
541 Ga0500618_013164
542 Ga0500642_0000072
543 Ga0500652_000232
544 Ga0500658_0314094
545 Ga0500559_0000413
546 Ga0500568_0000453
547 Ga0500586_000407
548 Ga0500604_0012547
549 Ga0500604_0119281
550 Ga0500616_0000028
551 Ga0500616_0000177
552 Ga0500622_0000223
553 Ga0500622_0259605
554 Ga0500627_0106543
555 Ga0500633_0193751
556 Ga0500634_0087443
557 Ga0500636_0016826
558 Ga0500636_0017510
559 2545677471
560 2603856994
561 2644291132
562 641640480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.9265 43 157
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.9105 43 157
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.8516 42 157
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.8371 42 157
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.7562 43 157
ID Description Score Start End Superfamily
1l1sA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9113 43 157 3.40.1260.10
1l1sA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8953 43 157 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8938 45 155 3.40.1260.10
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8932 44 157 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8785 45 155 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A0R3L6A4-F1-model_v4 Sulfur reduction protein DsrE 0.9914 33 157
AF-A0A537MD57-F1-model_v4 DsrE family protein 0.9899 29 157
AF-A0A7C9VQX2-F1-model_v4 DsrE family protein 0.9895 78 157
AF-A0A7C5WT76-F1-model_v4 Sulfur reduction protein DsrE 0.9887 47 157
AF-A0A7C7CAN5-F1-model_v4 Uncharacterized protein 0.9881 40 157

Map