F384387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 144 | 280 | 394 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100039570|Ga0307408_1000395702 |
| Length | 420 |
| Sequence | MRIDVLVVGAGFSGAVIAERLASHGLEVLVIDKRPHIGGNAFDRTDEHGILIHPYGPHIFHTNGMRIAEYLSRFTAWRFYEHRVRAKVGEHWVPMPINIDTVNRLYGLSLTEETIGAFFESVREPRSPIATSEDVVLNSVGRDLYEKLFRGYTRKQWGLEPSQLSASVAARIPTRTNRDDRYFTDTFQHMPLDGYTRMFERMLDHPRIHCECGVDFFRLRPRIQARHIVYTGPIDAYFDHCFGRLPYRSIEFQHEHLPDTETYQPVGTVNFPNDHAYTRITEFKHLTGQVHRGTSIVREFPCDEGDPYYPVPRPENEALFKRYETLAKEAQEVTFVGRLAQYRYYNMDQCVGAALKAAEGVVTRLGLDAVQPVEGSAPRIVSVPHPEVVDEVVAAAHATAGRGGAPTARREGVPLRQKVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 113 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 127 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 128 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 129 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 139 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 140 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 142 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 143 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 144 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.15 |
| Metatranscriptomes | 2.49 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.78 |
| Rhizosphere | 97.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10002172 | 3300005327 | Bacteria | 16462 |
| 2 | Ga0070658_10033041 | 3300005327 | Bacteria | 4161 |
| 3 | Ga0070658_10049675 | 3300005327 | Bacteria | 3399 |
| 4 | Ga0070683_100013709 | 3300005329 | Bacteria | 7078 |
| 5 | Ga0070683_100095443 | 3300005329 | Bacteria | 2796 |
| 6 | Ga0070683_100181834 | 3300005329 | Bacteria | 1996 |
| 7 | Ga0070683_100219843 | 3300005329 | Bacteria | 1805 |
| 8 | Ga0070677_10012472 | 3300005333 | Bacteria | 2952 |
| 9 | Ga0070666_10024316 | 3300005335 | Bacteria | 3945 |
| 10 | Ga0070666_10042386 | 3300005335 | Bacteria | 3045 |
| 11 | Ga0068868_100009658 | 3300005338 | Bacteria | 6962 |
| 12 | Ga0068868_100017860 | 3300005338 | Bacteria | 5292 |
| 13 | Ga0070660_100001529 | 3300005339 | Bacteria | 15887 |
| 14 | Ga0070661_100011438 | 3300005344 | Bacteria | 6182 |
| 15 | Ga0070675_100011603 | 3300005354 | Bacteria | 6900 |
| 16 | Ga0070675_100032046 | 3300005354 | Bacteria | 4252 |
| 17 | Ga0070671_100011142 | 3300005355 | Bacteria | 7222 |
| 18 | Ga0070671_100080866 | 3300005355 | Bacteria | 2717 |
| 19 | Ga0070674_100012638 | 3300005356 | Bacteria | 5190 |
| 20 | Ga0070674_100054099 | 3300005356 | Bacteria | 2775 |
| 21 | Ga0070659_100170174 | 3300005366 | Bacteria | 1784 |
| 22 | Ga0070667_100031423 | 3300005367 | Bacteria | 4428 |
| 23 | Ga0070667_100035212 | 3300005367 | Bacteria | 4193 |
| 24 | Ga0070667_100039304 | 3300005367 | Bacteria | 3965 |
| 25 | Ga0070667_100061157 | 3300005367 | Bacteria | 3188 |
| 26 | Ga0070714_100030632 | 3300005435 | Bacteria | 4481 |
| 27 | Ga0070714_100032353 | 3300005435 | Bacteria | 4365 |
| 28 | Ga0070700_100122643 | 3300005441 | Bacteria | 1744 |
| 29 | Ga0070678_100008861 | 3300005456 | Bacteria | 6054 |
| 30 | Ga0070662_100047262 | 3300005457 | Bacteria | 3095 |
| 31 | Ga0070681_10087051 | 3300005458 | Bacteria | 3077 |
| 32 | Ga0068867_100020255 | 3300005459 | Bacteria | 4740 |
| 33 | Ga0070685_10038965 | 3300005466 | Bacteria | 2698 |
| 34 | Ga0070679_100009285 | 3300005530 | Bacteria | 9296 |
| 35 | Ga0070684_100062949 | 3300005535 | Bacteria | 3251 |
| 36 | Ga0070684_100152738 | 3300005535 | Bacteria | 2092 |
| 37 | Ga0068853_100283918 | 3300005539 | Bacteria | 1526 |
| 38 | Ga0070672_100008010 | 3300005543 | Bacteria | 7217 |
| 39 | Ga0070672_100011849 | 3300005543 | Bacteria | 6092 |
| 40 | Ga0070672_100070812 | 3300005543 | Bacteria | 2772 |
| 41 | Ga0070665_100020187 | 3300005548 | Bacteria | 6689 |
| 42 | Ga0070665_100027300 | 3300005548 | Bacteria | 5750 |
| 43 | Ga0070665_100122855 | 3300005548 | Bacteria | 2598 |
| 44 | Ga0070665_100147521 | 3300005548 | Bacteria | 2355 |
| 45 | Ga0068855_100028988 | 3300005563 | Bacteria | 6621 |
| 46 | Ga0068855_100031015 | 3300005563 | Bacteria | 6388 |
| 47 | Ga0070664_100006331 | 3300005564 | Bacteria | 9549 |
| 48 | Ga0070664_100006976 | 3300005564 | Bacteria | 9109 |
| 49 | Ga0070664_100010069 | 3300005564 | Bacteria | 7664 |
| 50 | Ga0070664_100013966 | 3300005564 | Bacteria | 6547 |
| 51 | Ga0068857_100121572 | 3300005577 | Bacteria | 2351 |
| 52 | Ga0068857_100123559 | 3300005577 | Bacteria | 2332 |
| 53 | Ga0068857_100339191 | 3300005577 | Bacteria | 1390 |
| 54 | Ga0068854_100011447 | 3300005578 | Bacteria | 5778 |
| 55 | Ga0068854_100140422 | 3300005578 | Bacteria | 1853 |
| 56 | Ga0068856_100014278 | 3300005614 | Bacteria | 7680 |
| 57 | Ga0068856_100014696 | 3300005614 | Bacteria | 7555 |
| 58 | Ga0068856_100033675 | 3300005614 | Bacteria | 5017 |
| 59 | Ga0068852_100028019 | 3300005616 | Bacteria | 4603 |
| 60 | Ga0068852_100139433 | 3300005616 | Bacteria | 2242 |
| 61 | Ga0068852_100204556 | 3300005616 | Bacteria | 1869 |
| 62 | Ga0068864_100042774 | 3300005618 | Bacteria | 3877 |
| 63 | Ga0068864_100046222 | 3300005618 | Bacteria | 3735 |
| 64 | Ga0068864_100108444 | 3300005618 | Bacteria | 2471 |
| 65 | Ga0068866_10052245 | 3300005718 | Bacteria | 2085 |
| 66 | Ga0068861_100123848 | 3300005719 | Bacteria | 2089 |
| 67 | Ga0068863_100001717 | 3300005841 | Bacteria | 21691 |
| 68 | Ga0068863_100040094 | 3300005841 | Bacteria | 4453 |
| 69 | Ga0068863_100041966 | 3300005841 | Bacteria | 4348 |
| 70 | Ga0068860_100049010 | 3300005843 | Bacteria | 4026 |
| 71 | Ga0070717_10002336 | 3300006028 | Bacteria | 13353 |
| 72 | Ga0097621_100019276 | 3300006237 | Bacteria | 5233 |
| 73 | Ga0097621_100160835 | 3300006237 | Bacteria | 1930 |
| 74 | Ga0097621_100237849 | 3300006237 | Bacteria | 1591 |
| 75 | Ga0068871_100003740 | 3300006358 | Bacteria | 10474 |
| 76 | Ga0068871_100011560 | 3300006358 | Bacteria | 6476 |
| 77 | Ga0068871_100110117 | 3300006358 | Bacteria | 2316 |
| 78 | Ga0105240_10000137 | 3300009093 | Bacteria | 149925 |
| 79 | Ga0105240_10002009 | 3300009093 | Bacteria | 33547 |
| 80 | Ga0105240_10002051 | 3300009093 | Bacteria | 33088 |
| 81 | Ga0105240_10006240 | 3300009093 | Bacteria | 17538 |
| 82 | Ga0105240_10007610 | 3300009093 | Bacteria | 15688 |
| 83 | Ga0105240_10009029 | 3300009093 | Bacteria | 14155 |
| 84 | Ga0105240_10081862 | 3300009093 | Bacteria | 3965 |
| 85 | Ga0105240_10132956 | 3300009093 | Bacteria | 2982 |
| 86 | Ga0105245_10105938 | 3300009098 | Bacteria | 2608 |
| 87 | Ga0105241_10005150 | 3300009174 | Bacteria | 9643 |
| 88 | Ga0105241_10023863 | 3300009174 | Bacteria | 4539 |
| 89 | Ga0105242_10001238 | 3300009176 | Bacteria | 20130 |
| 90 | Ga0105242_10043003 | 3300009176 | Bacteria | 3652 |
| 91 | Ga0105242_10370708 | 3300009176 | Bacteria | 1328 |
| 92 | Ga0105248_10000932 | 3300009177 | Bacteria | 32593 |
| 93 | Ga0105248_10024731 | 3300009177 | Bacteria | 6679 |
| 94 | Ga0105248_10032594 | 3300009177 | Bacteria | 5822 |
| 95 | Ga0105248_10107979 | 3300009177 | Bacteria | 3138 |
| 96 | Ga0105237_10048615 | 3300009545 | Bacteria | 4264 |
| 97 | Ga0105237_10106981 | 3300009545 | Bacteria | 2789 |
| 98 | Ga0105237_10189651 | 3300009545 | Bacteria | 2056 |
| 99 | Ga0105238_10001876 | 3300009551 | Bacteria | 21082 |
| 100 | Ga0105238_10004193 | 3300009551 | Bacteria | 14309 |
| 101 | Ga0105238_10029701 | 3300009551 | Bacteria | 5567 |
| 102 | Ga0105238_10069292 | 3300009551 | Bacteria | 3528 |
| 103 | Ga0105249_10113942 | 3300009553 | Bacteria | 2559 |
| 104 | Ga0105249_10284645 | 3300009553 | Bacteria | 1652 |
| 105 | Ga0105239_10040525 | 3300010375 | Bacteria | 5103 |
| 106 | Ga0157373_10112876 | 3300013100 | Bacteria | 1910 |
| 107 | Ga0157371_10092050 | 3300013102 | Bacteria | 2148 |
| 108 | Ga0157370_10000193 | 3300013104 | Bacteria | 76373 |
| 109 | Ga0157370_10004867 | 3300013104 | Bacteria | 15245 |
| 110 | Ga0157370_10005591 | 3300013104 | Bacteria | 14077 |
| 111 | Ga0157370_10135107 | 3300013104 | Bacteria | 2299 |
| 112 | Ga0157369_10001807 | 3300013105 | Bacteria | 25881 |
| 113 | Ga0157369_10009272 | 3300013105 | Bacteria | 11261 |
| 114 | Ga0157369_10164623 | 3300013105 | Bacteria | 2340 |
| 115 | Ga0157374_10006705 | 3300013296 | Bacteria | 9784 |
| 116 | Ga0157374_10010223 | 3300013296 | Bacteria | 8070 |
| 117 | Ga0157374_10015952 | 3300013296 | Bacteria | 6599 |
| 118 | Ga0157374_10143470 | 3300013296 | Bacteria | 2319 |
| 119 | Ga0157374_10248475 | 3300013296 | Bacteria | 1750 |
| 120 | Ga0157378_10088442 | 3300013297 | Bacteria | 2811 |
| 121 | Ga0157378_10224569 | 3300013297 | Bacteria | 1787 |
| 122 | Ga0163162_10027241 | 3300013306 | Bacteria | 5651 |
| 123 | Ga0163162_10044104 | 3300013306 | Bacteria | 4466 |
| 124 | Ga0163162_10075775 | 3300013306 | Bacteria | 3425 |
| 125 | Ga0157372_10009672 | 3300013307 | Bacteria | 10249 |
| 126 | Ga0157372_10017735 | 3300013307 | Bacteria | 7641 |
| 127 | Ga0157372_10020336 | 3300013307 | Bacteria | 7160 |
| 128 | Ga0157372_10027432 | 3300013307 | Bacteria | 6202 |
| 129 | Ga0157372_10067556 | 3300013307 | Bacteria | 4017 |
| 130 | Ga0157372_10435639 | 3300013307 | Bacteria | 1528 |
| 131 | Ga0157372_10492763 | 3300013307 | Bacteria | 1429 |
| 132 | Ga0157375_10014739 | 3300013308 | Bacteria | 6987 |
| 133 | Ga0157375_10034530 | 3300013308 | Bacteria | 4819 |
| 134 | Ga0157375_10313135 | 3300013308 | Bacteria | 1734 |
| 135 | Ga0163163_10008761 | 3300014325 | Bacteria | 9003 |
| 136 | Ga0163163_10130419 | 3300014325 | Bacteria | 2554 |
| 137 | Ga0182008_10042560 | 3300014497 | Bacteria | 2263 |
| 138 | Ga0157377_10032051 | 3300014745 | Bacteria | 2859 |
| 139 | Ga0157376_10002965 | 3300014969 | Bacteria | 11647 |
| 140 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 141 | Ga0163161_10071497 | 3300017792 | Bacteria | 2539 |
| 142 | Ga0197907_11030823 | 3300020069 | Bacteria | 2720 |
| 143 | Ga0206356_10111372 | 3300020070 | Bacteria | 1356 |
| 144 | Ga0206356_10487446 | 3300020070 | Bacteria | 1999 |
| 145 | Ga0206352_10287084 | 3300020078 | Bacteria | 1727 |
| 146 | Ga0206350_10322456 | 3300020080 | Bacteria | 1623 |
| 147 | Ga0206350_11381908 | 3300020080 | Bacteria | 1406 |
| 148 | Ga0224712_10005227 | 3300022467 | Bacteria | 3591 |
| 149 | Ga0207656_10003082 | 3300025321 | Bacteria | 5702 |
| 150 | Ga0207656_10006514 | 3300025321 | Bacteria | 4203 |
| 151 | Ga0207682_10010801 | 3300025893 | Bacteria | 3576 |
| 152 | Ga0207688_10014520 | 3300025901 | Bacteria | 4280 |
| 153 | Ga0207680_10046822 | 3300025903 | Bacteria | 2559 |
| 154 | Ga0207705_10018018 | 3300025909 | Bacteria | 5050 |
| 155 | Ga0207707_10072871 | 3300025912 | Bacteria | 2994 |
| 156 | Ga0207695_10003599 | 3300025913 | Bacteria | 21692 |
| 157 | Ga0207695_10003668 | 3300025913 | Bacteria | 21407 |
| 158 | Ga0207695_10025947 | 3300025913 | Bacteria | 6548 |
| 159 | Ga0207695_10113198 | 3300025913 | Bacteria | 2690 |
| 160 | Ga0207695_10209052 | 3300025913 | Bacteria | 1863 |
| 161 | Ga0207671_10201371 | 3300025914 | Bacteria | 1555 |
| 162 | Ga0207657_10001063 | 3300025919 | Bacteria | 29134 |
| 163 | Ga0207649_10028307 | 3300025920 | Bacteria | 3298 |
| 164 | Ga0207649_10028711 | 3300025920 | Bacteria | 3278 |
| 165 | Ga0207652_10141156 | 3300025921 | Bacteria | 2154 |
| 166 | Ga0207694_10001873 | 3300025924 | Bacteria | 17439 |
| 167 | Ga0207650_10008699 | 3300025925 | Bacteria | 6930 |
| 168 | Ga0207650_10014624 | 3300025925 | Bacteria | 5450 |
| 169 | Ga0207650_10015225 | 3300025925 | Bacteria | 5352 |
| 170 | Ga0207650_10032568 | 3300025925 | Bacteria | 3770 |
| 171 | Ga0207650_10146791 | 3300025925 | Bacteria | 1858 |
| 172 | Ga0207659_10002745 | 3300025926 | Bacteria | 10494 |
| 173 | Ga0207659_10255177 | 3300025926 | Bacteria | 1424 |
| 174 | Ga0207700_10002326 | 3300025928 | Bacteria | 10898 |
| 175 | Ga0207664_10010283 | 3300025929 | Bacteria | 6608 |
| 176 | Ga0207644_10007412 | 3300025931 | Bacteria | 7151 |
| 177 | Ga0207644_10019216 | 3300025931 | Bacteria | 4631 |
| 178 | Ga0207644_10187507 | 3300025931 | Bacteria | 1625 |
| 179 | Ga0207706_10045360 | 3300025933 | Bacteria | 3895 |
| 180 | Ga0207669_10146140 | 3300025937 | Bacteria | 1649 |
| 181 | Ga0207691_10008248 | 3300025940 | Bacteria | 10002 |
| 182 | Ga0207691_10009016 | 3300025940 | Bacteria | 9566 |
| 183 | Ga0207711_10005491 | 3300025941 | Bacteria | 10717 |
| 184 | Ga0207711_10045843 | 3300025941 | Bacteria | 3736 |
| 185 | Ga0207711_10109185 | 3300025941 | Bacteria | 2458 |
| 186 | Ga0207689_10152424 | 3300025942 | Bacteria | 1905 |
| 187 | Ga0207689_10152538 | 3300025942 | Bacteria | 1904 |
| 188 | Ga0207661_10010316 | 3300025944 | Bacteria | 6720 |
| 189 | Ga0207661_10017086 | 3300025944 | Bacteria | 5361 |
| 190 | Ga0207661_10070785 | 3300025944 | Bacteria | 2848 |
| 191 | Ga0207679_10002560 | 3300025945 | Bacteria | 11213 |
| 192 | Ga0207679_10004512 | 3300025945 | Bacteria | 8671 |
| 193 | Ga0207667_10013882 | 3300025949 | Bacteria | 9202 |
| 194 | Ga0207667_10032563 | 3300025949 | Bacteria | 5616 |
| 195 | Ga0207651_10009305 | 3300025960 | Bacteria | 5368 |
| 196 | Ga0207668_10159247 | 3300025972 | Bacteria | 1757 |
| 197 | Ga0207658_10042697 | 3300025986 | Bacteria | 3291 |
| 198 | Ga0207658_10064576 | 3300025986 | Bacteria | 2746 |
| 199 | Ga0207658_10126436 | 3300025986 | Bacteria | 2047 |
| 200 | Ga0207677_10002904 | 3300026023 | Bacteria | 9055 |
| 201 | Ga0207677_10024522 | 3300026023 | Bacteria | 3749 |
| 202 | Ga0207639_10123703 | 3300026041 | Bacteria | 2130 |
| 203 | Ga0207702_10075359 | 3300026078 | Bacteria | 2915 |
| 204 | Ga0207702_10084261 | 3300026078 | Bacteria | 2767 |
| 205 | Ga0207702_10118844 | 3300026078 | Bacteria | 2362 |
| 206 | Ga0207641_10012264 | 3300026088 | Bacteria | 7031 |
| 207 | Ga0207641_10113530 | 3300026088 | Bacteria | 2406 |
| 208 | Ga0207641_10183100 | 3300026088 | Bacteria | 1920 |
| 209 | Ga0207648_10025103 | 3300026089 | Bacteria | 5313 |
| 210 | Ga0207648_10086471 | 3300026089 | Bacteria | 2736 |
| 211 | Ga0207648_10093101 | 3300026089 | Bacteria | 2636 |
| 212 | Ga0207676_10053545 | 3300026095 | Bacteria | 3159 |
| 213 | Ga0207676_10297403 | 3300026095 | Bacteria | 1472 |
| 214 | Ga0207674_10000084 | 3300026116 | Bacteria | 101302 |
| 215 | Ga0207674_10054838 | 3300026116 | Bacteria | 4056 |
| 216 | Ga0207674_10088298 | 3300026116 | Bacteria | 3094 |
| 217 | Ga0207674_10313715 | 3300026116 | Bacteria | 1517 |
| 218 | Ga0207675_100305471 | 3300026118 | Bacteria | 1550 |
| 219 | Ga0207675_100407084 | 3300026118 | Bacteria | 1341 |
| 220 | Ga0207683_10005263 | 3300026121 | Bacteria | 11104 |
| 221 | Ga0207683_10192592 | 3300026121 | Bacteria | 1851 |
| 222 | Ga0209967_1005581 | 3300027364 | Bacteria | 1694 |
| 223 | Ga0209995_1004870 | 3300027471 | Bacteria | 2154 |
| 224 | Ga0209983_1001761 | 3300027665 | Bacteria | 4796 |
| 225 | Ga0209983_1008310 | 3300027665 | Bacteria | 2122 |
| 226 | Ga0209974_10001762 | 3300027876 | Bacteria | 7887 |
| 227 | Ga0209974_10001986 | 3300027876 | Bacteria | 7459 |
| 228 | Ga0268266_10023831 | 3300028379 | Bacteria | 5208 |
| 229 | Ga0268264_10139245 | 3300028381 | Bacteria | 2162 |
| 230 | Ga0307408_100039570 | 3300031548 | Bacteria | 3333 |
| 231 | Ga0316579_10021720 | 3300031691 | Bacteria | 2863 |
| 232 | Ga0307405_10008881 | 3300031731 | Bacteria | 5123 |
| 233 | Ga0307413_10001524 | 3300031824 | Bacteria | 8884 |
| 234 | Ga0307413_10194791 | 3300031824 | Bacteria | 1458 |
| 235 | Ga0307410_10039533 | 3300031852 | Bacteria | 3097 |
| 236 | Ga0307410_10073770 | 3300031852 | Bacteria | 2374 |
| 237 | Ga0307407_10020574 | 3300031903 | Bacteria | 3385 |
| 238 | Ga0307407_10030895 | 3300031903 | Bacteria | 2895 |
| 239 | Ga0307412_10005830 | 3300031911 | Bacteria | 6930 |
| 240 | Ga0307412_10050294 | 3300031911 | Bacteria | 2750 |
| 241 | Ga0307409_100000809 | 3300031995 | Bacteria | 14331 |
| 242 | Ga0307409_100033854 | 3300031995 | Bacteria | 3724 |
| 243 | Ga0307409_100038759 | 3300031995 | Bacteria | 3528 |
| 244 | Ga0307409_100077090 | 3300031995 | Bacteria | 2676 |
| 245 | Ga0307409_100196371 | 3300031995 | Bacteria | 1801 |
| 246 | Ga0307416_100004180 | 3300032002 | Bacteria | 8651 |
| 247 | Ga0307416_100015045 | 3300032002 | Bacteria | 5327 |
| 248 | Ga0307416_100027900 | 3300032002 | Bacteria | 4189 |
| 249 | Ga0307416_100094696 | 3300032002 | Bacteria | 2576 |
| 250 | Ga0307414_10136212 | 3300032004 | Bacteria | 1915 |
| 251 | Ga0307414_10272694 | 3300032004 | Bacteria | 1418 |
| 252 | Ga0307411_10153518 | 3300032005 | Bacteria | 1714 |
| 253 | Ga0307411_10183382 | 3300032005 | Bacteria | 1591 |
| 254 | Ga0307415_100005220 | 3300032126 | Bacteria | 6867 |
| 255 | Ga0307415_100024605 | 3300032126 | Bacteria | 3763 |
| 256 | Ga0307415_100048962 | 3300032126 | Bacteria | 2854 |
| 257 | Ga0451843_1484314 | 3300041509 | Bacteria | 1610 |
| 258 | Ga0451577_0052536 | 3300042876 | Bacteria | 3638 |
| 259 | Ga0466965_0046047 | 3300044683 | Bacteria | 2158 |
| 260 | Ga0466963_0124486 | 3300044694 | Bacteria | 1776 |
| 261 | Ga0466964_0016907 | 3300044706 | Bacteria | 2789 |
| 262 | Ga0466964_0061551 | 3300044706 | Bacteria | 1563 |
| 263 | Ga0453684_0387737 | 3300044712 | Bacteria | 1567 |
| 264 | Ga0451576_0027372 | 3300045051 | Bacteria | 6124 |
| 265 | Ga0466967_0003901 | 3300045976 | Bacteria | 9898 |
| 266 | Ga0495665_0098375 | 3300046531 | Bacteria | 1536 |
| 267 | Ga0495587_0167447 | 3300046536 | Bacteria | 1249 |
| 268 | Ga0495604_0040839 | 3300047317 | Bacteria | 3641 |
| 269 | Ga0495674_0021415 | 3300047319 | Bacteria | 5980 |
| 270 | Ga0495674_0096612 | 3300047319 | Bacteria | 2518 |
| 271 | Ga0495674_0217442 | 3300047319 | Bacteria | 1581 |
| 272 | Ga0495684_0040467 | 3300047471 | Bacteria | 3573 |
| 273 | Ga0496100_0087330 | 3300048903 | Bacteria | 2120 |
| 274 | Ga0496104_0193144 | 3300048907 | Bacteria | 1948 |
| 275 | Ga0496106_0060043 | 3300048909 | Bacteria | 2882 |
| 276 | Ga0496109_0015948 | 3300048912 | Bacteria | 6563 |
| 277 | Ga0496110_0004228 | 3300048913 | Bacteria | 11112 |
| 278 | Ga0496116_0053370 | 3300048919 | Bacteria | 2670 |
| 279 | Ga0501292_006322 | 3300049515 | Bacteria | 1679 |
| 280 | Ga0501035_0000422 | 3300049822 | Bacteria | 47672 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025913 | Ga0207695_10209052 | Ga0207695_102090522 | 334 |
| 2 | 3300046536 | Ga0495587_0167447 | Ga0495587_0167447_16_1035 | 338 |
| 3 | 3300026095 | Ga0207676_10297403 | Ga0207676_102974032 | 339 |
| 4 | 3300031691 | Ga0316579_10021720 | Ga0316579_100217203 | 363 |
| 5 | 3300013307 | Ga0157372_10067556 | Ga0157372_100675562 | 365 |
| 6 | 3300044683 | Ga0466965_0046047 | Ga0466965_0046047_121_1233 | 365 |
| 7 | 3300044694 | Ga0466963_0124486 | Ga0466963_0124486_309_1421 | 365 |
| 8 | 3300044706 | Ga0466964_0016907 | Ga0466964_0016907_807_1919 | 365 |
| 9 | 3300044706 | Ga0466964_0061551 | Ga0466964_0061551_269_1381 | 365 |
| 10 | 3300045976 | Ga0466967_0003901 | Ga0466967_0003901_7846_8958 | 365 |
| 11 | 3300005329 | Ga0070683_100095443 | Ga0070683_1000954432 | 367 |
| 12 | 3300047319 | Ga0495674_0217442 | Ga0495674_0217442_441_1544 | 367 |
| 13 | 3300005339 | Ga0070660_100001529 | Ga0070660_10000152911 | 369 |
| 14 | 3300005367 | Ga0070667_100035212 | Ga0070667_1000352123 | 370 |
| 15 | 3300005466 | Ga0070685_10038965 | Ga0070685_100389652 | 370 |
| 16 | 3300005543 | Ga0070672_100070812 | Ga0070672_1000708122 | 370 |
| 17 | 3300005618 | Ga0068864_100042774 | Ga0068864_1000427744 | 370 |
| 18 | 3300005841 | Ga0068863_100001717 | Ga0068863_1000017178 | 370 |
| 19 | 3300005843 | Ga0068860_100049010 | Ga0068860_1000490102 | 370 |
| 20 | 3300006358 | Ga0068871_100110117 | Ga0068871_1001101172 | 370 |
| 21 | 3300009098 | Ga0105245_10105938 | Ga0105245_101059382 | 370 |
| 22 | 3300013306 | Ga0163162_10027241 | Ga0163162_100272415 | 370 |
| 23 | 3300013308 | Ga0157375_10034530 | Ga0157375_100345304 | 370 |
| 24 | 3300014325 | Ga0163163_10008761 | Ga0163163_100087612 | 370 |
| 25 | 3300014745 | Ga0157377_10032051 | Ga0157377_100320512 | 370 |
| 26 | 3300025903 | Ga0207680_10046822 | Ga0207680_100468222 | 370 |
| 27 | 3300025925 | Ga0207650_10015225 | Ga0207650_100152256 | 370 |
| 28 | 3300025926 | Ga0207659_10002745 | Ga0207659_100027452 | 370 |
| 29 | 3300025941 | Ga0207711_10005491 | Ga0207711_100054914 | 370 |
| 30 | 3300026088 | Ga0207641_10012264 | Ga0207641_100122642 | 370 |
| 31 | 3300005356 | Ga0070674_100054099 | Ga0070674_1000540992 | 371 |
| 32 | 3300005578 | Ga0068854_100140422 | Ga0068854_1001404222 | 371 |
| 33 | 3300005616 | Ga0068852_100204556 | Ga0068852_1002045562 | 371 |
| 34 | 3300005719 | Ga0068861_100123848 | Ga0068861_1001238482 | 371 |
| 35 | 3300013297 | Ga0157378_10224569 | Ga0157378_102245692 | 371 |
| 36 | 3300025925 | Ga0207650_10008699 | Ga0207650_100086993 | 371 |
| 37 | 3300025928 | Ga0207700_10002326 | Ga0207700_100023266 | 371 |
| 38 | 3300025931 | Ga0207644_10187507 | Ga0207644_101875071 | 371 |
| 39 | 3300025937 | Ga0207669_10146140 | Ga0207669_101461402 | 371 |
| 40 | 3300025972 | Ga0207668_10159247 | Ga0207668_101592471 | 371 |
| 41 | 3300026089 | Ga0207648_10086471 | Ga0207648_100864712 | 371 |
| 42 | 3300026118 | Ga0207675_100407084 | Ga0207675_1004070841 | 371 |
| 43 | iso_pu_bacteria | 2919085039 | 2919085392 | 371 |
| 44 | 3300009093 | Ga0105240_10009029 | Ga0105240_100090298 | 373 |
| 45 | 3300026078 | Ga0207702_10075359 | Ga0207702_100753592 | 373 |
| 46 | 3300031903 | Ga0307407_10030895 | Ga0307407_100308952 | 373 |
| 47 | 3300031995 | Ga0307409_100077090 | Ga0307409_1000770902 | 373 |
| 48 | 3300032002 | Ga0307416_100004180 | Ga0307416_1000041805 | 373 |
| 49 | 3300032004 | Ga0307414_10272694 | Ga0307414_102726941 | 373 |
| 50 | 3300032126 | Ga0307415_100048962 | Ga0307415_1000489622 | 373 |
| 51 | 3300041509 | Ga0451843_1484314 | Ga0451843_1484314_57_1208 | 373 |
| 52 | 3300049515 | Ga0501292_006322 | Ga0501292_006322_75_1244 | 373 |
| 53 | 3300005333 | Ga0070677_10012472 | Ga0070677_100124722 | 374 |
| 54 | 3300005338 | Ga0068868_100009658 | Ga0068868_1000096583 | 374 |
| 55 | 3300005354 | Ga0070675_100032046 | Ga0070675_1000320462 | 374 |
| 56 | 3300005367 | Ga0070667_100039304 | Ga0070667_1000393042 | 374 |
| 57 | 3300005456 | Ga0070678_100008861 | Ga0070678_1000088614 | 374 |
| 58 | 3300005459 | Ga0068867_100020255 | Ga0068867_1000202552 | 374 |
| 59 | 3300005539 | Ga0068853_100283918 | Ga0068853_1002839181 | 374 |
| 60 | 3300005543 | Ga0070672_100008010 | Ga0070672_1000080103 | 374 |
| 61 | 3300005564 | Ga0070664_100010069 | Ga0070664_1000100693 | 374 |
| 62 | 3300005577 | Ga0068857_100121572 | Ga0068857_1001215722 | 374 |
| 63 | 3300005577 | Ga0068857_100339191 | Ga0068857_1003391912 | 374 |
| 64 | 3300005616 | Ga0068852_100028019 | Ga0068852_1000280193 | 374 |
| 65 | 3300005618 | Ga0068864_100046222 | Ga0068864_1000462222 | 374 |
| 66 | 3300005841 | Ga0068863_100041966 | Ga0068863_1000419662 | 374 |
| 67 | 3300006358 | Ga0068871_100003740 | Ga0068871_1000037409 | 374 |
| 68 | 3300009176 | Ga0105242_10043003 | Ga0105242_100430032 | 374 |
| 69 | 3300009177 | Ga0105248_10107979 | Ga0105248_101079792 | 374 |
| 70 | 3300013104 | Ga0157370_10000193 | Ga0157370_1000019328 | 374 |
| 71 | 3300013296 | Ga0157374_10015952 | Ga0157374_100159524 | 374 |
| 72 | 3300013297 | Ga0157378_10088442 | Ga0157378_100884422 | 374 |
| 73 | 3300013306 | Ga0163162_10044104 | Ga0163162_100441044 | 374 |
| 74 | 3300013308 | Ga0157375_10014739 | Ga0157375_100147393 | 374 |
| 75 | 3300014969 | Ga0157376_10002965 | Ga0157376_100029652 | 374 |
| 76 | 3300015265 | Ga0182005_1000004 | Ga0182005_1000004216 | 374 |
| 77 | 3300025321 | Ga0207656_10006514 | Ga0207656_100065142 | 374 |
| 78 | 3300025909 | Ga0207705_10018018 | Ga0207705_100180182 | 374 |
| 79 | 3300025925 | Ga0207650_10014624 | Ga0207650_100146242 | 374 |
| 80 | 3300025940 | Ga0207691_10008248 | Ga0207691_100082488 | 374 |
| 81 | 3300025942 | Ga0207689_10152538 | Ga0207689_101525382 | 374 |
| 82 | 3300025944 | Ga0207661_10010316 | Ga0207661_100103163 | 374 |
| 83 | 3300025960 | Ga0207651_10009305 | Ga0207651_100093052 | 374 |
| 84 | 3300026023 | Ga0207677_10002904 | Ga0207677_100029047 | 374 |
| 85 | 3300026089 | Ga0207648_10025103 | Ga0207648_100251032 | 374 |
| 86 | 3300026095 | Ga0207676_10053545 | Ga0207676_100535452 | 374 |
| 87 | 3300026116 | Ga0207674_10054838 | Ga0207674_100548382 | 374 |
| 88 | 3300026121 | Ga0207683_10005263 | Ga0207683_1000526311 | 374 |
| 89 | 3300031824 | Ga0307413_10194791 | Ga0307413_101947912 | 374 |
| 90 | 3300031852 | Ga0307410_10073770 | Ga0307410_100737702 | 374 |
| 91 | 3300031995 | Ga0307409_100038759 | Ga0307409_1000387593 | 374 |
| 92 | 3300032002 | Ga0307416_100015045 | Ga0307416_1000150452 | 374 |
| 93 | 3300032126 | Ga0307415_100024605 | Ga0307415_1000246053 | 374 |
| 94 | 3300048903 | Ga0496100_0087330 | Ga0496100_0087330_674_1849 | 374 |
| 95 | 3300048907 | Ga0496104_0193144 | Ga0496104_0193144_56_1231 | 374 |
| 96 | 3300048912 | Ga0496109_0015948 | Ga0496109_0015948_2917_4092 | 374 |
| 97 | 3300048913 | Ga0496110_0004228 | Ga0496110_0004228_6614_7789 | 374 |
| 98 | 3300048919 | Ga0496116_0053370 | Ga0496116_0053370_1315_2487 | 374 |
| 99 | 3300027364 | Ga0209967_1005581 | Ga0209967_10055812 | 375 |
| 100 | 3300027471 | Ga0209995_1004870 | Ga0209995_10048702 | 375 |
| 101 | 3300027665 | Ga0209983_1008310 | Ga0209983_10083102 | 375 |
| 102 | 3300027876 | Ga0209974_10001986 | Ga0209974_100019862 | 375 |
| 103 | 3300006028 | Ga0070717_10002336 | Ga0070717_100023367 | 376 |
| 104 | 3300005344 | Ga0070661_100011438 | Ga0070661_1000114384 | 377 |
| 105 | 3300005564 | Ga0070664_100006976 | Ga0070664_1000069763 | 377 |
| 106 | 3300025920 | Ga0207649_10028307 | Ga0207649_100283072 | 377 |
| 107 | 3300025945 | Ga0207679_10004512 | Ga0207679_100045126 | 377 |
| 108 | 3300026116 | Ga0207674_10313715 | Ga0207674_103137151 | 377 |
| 109 | 3300042876 | Ga0451577_0052536 | Ga0451577_0052536_1081_2223 | 377 |
| 110 | 3300044712 | Ga0453684_0387737 | Ga0453684_0387737_127_1269 | 377 |
| 111 | 3300045051 | Ga0451576_0027372 | Ga0451576_0027372_968_2110 | 377 |
| 112 | 3300049822 | Ga0501035_0000422 | Ga0501035_0000422_13185_14318 | 377 |
| 113 | 3300005548 | Ga0070665_100020187 | Ga0070665_1000201875 | 378 |
| 114 | 3300022467 | Ga0224712_10005227 | Ga0224712_100052273 | 378 |
| 115 | 3300005329 | Ga0070683_100219843 | Ga0070683_1002198431 | 381 |
| 116 | 3300005335 | Ga0070666_10042386 | Ga0070666_100423862 | 381 |
| 117 | 3300005354 | Ga0070675_100011603 | Ga0070675_1000116035 | 381 |
| 118 | 3300005355 | Ga0070671_100080866 | Ga0070671_1000808662 | 381 |
| 119 | 3300005367 | Ga0070667_100061157 | Ga0070667_1000611572 | 381 |
| 120 | 3300005535 | Ga0070684_100152738 | Ga0070684_1001527382 | 381 |
| 121 | 3300005543 | Ga0070672_100011849 | Ga0070672_1000118494 | 381 |
| 122 | 3300005548 | Ga0070665_100122855 | Ga0070665_1001228552 | 381 |
| 123 | 3300005616 | Ga0068852_100139433 | Ga0068852_1001394332 | 381 |
| 124 | 3300005618 | Ga0068864_100108444 | Ga0068864_1001084442 | 381 |
| 125 | 3300005841 | Ga0068863_100040094 | Ga0068863_1000400942 | 381 |
| 126 | 3300006237 | Ga0097621_100160835 | Ga0097621_1001608352 | 381 |
| 127 | 3300006237 | Ga0097621_100237849 | Ga0097621_1002378491 | 381 |
| 128 | 3300009177 | Ga0105248_10032594 | Ga0105248_100325942 | 381 |
| 129 | 3300009553 | Ga0105249_10284645 | Ga0105249_102846452 | 381 |
| 130 | 3300013306 | Ga0163162_10075775 | Ga0163162_100757752 | 381 |
| 131 | 3300013308 | Ga0157375_10313135 | Ga0157375_103131352 | 381 |
| 132 | 3300017792 | Ga0163161_10071497 | Ga0163161_100714972 | 381 |
| 133 | 3300025893 | Ga0207682_10010801 | Ga0207682_100108012 | 381 |
| 134 | 3300025901 | Ga0207688_10014520 | Ga0207688_100145202 | 381 |
| 135 | 3300025926 | Ga0207659_10255177 | Ga0207659_102551772 | 381 |
| 136 | 3300025931 | Ga0207644_10019216 | Ga0207644_100192163 | 381 |
| 137 | 3300025940 | Ga0207691_10009016 | Ga0207691_100090166 | 381 |
| 138 | 3300025941 | Ga0207711_10109185 | Ga0207711_101091852 | 381 |
| 139 | 3300025942 | Ga0207689_10152424 | Ga0207689_101524241 | 381 |
| 140 | 3300025986 | Ga0207658_10064576 | Ga0207658_100645762 | 381 |
| 141 | 3300026089 | Ga0207648_10093101 | Ga0207648_100931012 | 381 |
| 142 | 3300032005 | Ga0307411_10183382 | Ga0307411_101833822 | 381 |
| 143 | 3300005327 | Ga0070658_10033041 | Ga0070658_100330412 | 382 |
| 144 | 3300005356 | Ga0070674_100012638 | Ga0070674_1000126382 | 383 |
| 145 | 3300005366 | Ga0070659_100170174 | Ga0070659_1001701742 | 383 |
| 146 | 3300005441 | Ga0070700_100122643 | Ga0070700_1001226432 | 383 |
| 147 | 3300005564 | Ga0070664_100013966 | Ga0070664_1000139665 | 383 |
| 148 | 3300005578 | Ga0068854_100011447 | Ga0068854_1000114473 | 383 |
| 149 | 3300005718 | Ga0068866_10052245 | Ga0068866_100522452 | 383 |
| 150 | 3300013296 | Ga0157374_10010223 | Ga0157374_100102232 | 383 |
| 151 | 3300013307 | Ga0157372_10027432 | Ga0157372_100274324 | 383 |
| 152 | 3300025321 | Ga0207656_10003082 | Ga0207656_100030825 | 383 |
| 153 | 3300025925 | Ga0207650_10032568 | Ga0207650_100325683 | 383 |
| 154 | 3300025925 | Ga0207650_10146791 | Ga0207650_101467912 | 383 |
| 155 | 3300025945 | Ga0207679_10002560 | Ga0207679_100025605 | 383 |
| 156 | 3300026121 | Ga0207683_10192592 | Ga0207683_101925922 | 383 |
| 157 | 3300027876 | Ga0209974_10001762 | Ga0209974_100017622 | 383 |
| 158 | 3300009545 | Ga0105237_10189651 | Ga0105237_101896512 | 384 |
| 159 | 3300005335 | Ga0070666_10024316 | Ga0070666_100243163 | 385 |
| 160 | 3300005355 | Ga0070671_100011142 | Ga0070671_1000111422 | 385 |
| 161 | 3300005457 | Ga0070662_100047262 | Ga0070662_1000472622 | 385 |
| 162 | 3300005577 | Ga0068857_100123559 | Ga0068857_1001235592 | 385 |
| 163 | 3300009177 | Ga0105248_10000932 | Ga0105248_100009329 | 385 |
| 164 | 3300013100 | Ga0157373_10112876 | Ga0157373_101128761 | 385 |
| 165 | 3300013102 | Ga0157371_10092050 | Ga0157371_100920502 | 385 |
| 166 | 3300013307 | Ga0157372_10435639 | Ga0157372_104356391 | 385 |
| 167 | 3300013307 | Ga0157372_10492763 | Ga0157372_104927632 | 385 |
| 168 | 3300020080 | Ga0206350_10322456 | Ga0206350_103224562 | 385 |
| 169 | 3300025931 | Ga0207644_10007412 | Ga0207644_100074123 | 385 |
| 170 | 3300025933 | Ga0207706_10045360 | Ga0207706_100453602 | 385 |
| 171 | 3300025941 | Ga0207711_10045843 | Ga0207711_100458432 | 385 |
| 172 | 3300026041 | Ga0207639_10123703 | Ga0207639_101237032 | 385 |
| 173 | 3300026088 | Ga0207641_10183100 | Ga0207641_101831001 | 385 |
| 174 | 3300026116 | Ga0207674_10088298 | Ga0207674_100882982 | 385 |
| 175 | 3300027665 | Ga0209983_1001761 | Ga0209983_10017612 | 385 |
| 176 | 3300048909 | Ga0496106_0060043 | Ga0496106_0060043_1432_2676 | 385 |
| 177 | 3300005327 | Ga0070658_10049675 | Ga0070658_100496752 | 386 |
| 178 | 3300005329 | Ga0070683_100013709 | Ga0070683_1000137092 | 386 |
| 179 | 3300005329 | Ga0070683_100181834 | Ga0070683_1001818342 | 386 |
| 180 | 3300005435 | Ga0070714_100032353 | Ga0070714_1000323533 | 386 |
| 181 | 3300005458 | Ga0070681_10087051 | Ga0070681_100870511 | 386 |
| 182 | 3300005530 | Ga0070679_100009285 | Ga0070679_1000092857 | 386 |
| 183 | 3300005535 | Ga0070684_100062949 | Ga0070684_1000629492 | 386 |
| 184 | 3300005563 | Ga0068855_100031015 | Ga0068855_1000310152 | 386 |
| 185 | 3300005564 | Ga0070664_100006331 | Ga0070664_1000063312 | 386 |
| 186 | 3300005614 | Ga0068856_100014278 | Ga0068856_1000142785 | 386 |
| 187 | 3300005614 | Ga0068856_100033675 | Ga0068856_1000336753 | 386 |
| 188 | 3300009093 | Ga0105240_10000137 | Ga0105240_1000013742 | 386 |
| 189 | 3300009093 | Ga0105240_10002009 | Ga0105240_100020099 | 386 |
| 190 | 3300009093 | Ga0105240_10002051 | Ga0105240_1000205127 | 386 |
| 191 | 3300009174 | Ga0105241_10023863 | Ga0105241_100238633 | 386 |
| 192 | 3300009551 | Ga0105238_10029701 | Ga0105238_100297012 | 386 |
| 193 | 3300013104 | Ga0157370_10005591 | Ga0157370_100055917 | 386 |
| 194 | 3300013104 | Ga0157370_10135107 | Ga0157370_101351072 | 386 |
| 195 | 3300013105 | Ga0157369_10009272 | Ga0157369_100092724 | 386 |
| 196 | 3300013105 | Ga0157369_10164623 | Ga0157369_101646232 | 386 |
| 197 | 3300013296 | Ga0157374_10006705 | Ga0157374_100067054 | 386 |
| 198 | 3300013307 | Ga0157372_10009672 | Ga0157372_100096723 | 386 |
| 199 | 3300013307 | Ga0157372_10020336 | Ga0157372_100203363 | 386 |
| 200 | 3300014497 | Ga0182008_10042560 | Ga0182008_100425602 | 386 |
| 201 | 3300025912 | Ga0207707_10072871 | Ga0207707_100728712 | 386 |
| 202 | 3300025913 | Ga0207695_10003599 | Ga0207695_1000359916 | 386 |
| 203 | 3300025913 | Ga0207695_10025947 | Ga0207695_100259472 | 386 |
| 204 | 3300025913 | Ga0207695_10113198 | Ga0207695_101131982 | 386 |
| 205 | 3300025920 | Ga0207649_10028711 | Ga0207649_100287112 | 386 |
| 206 | 3300025921 | Ga0207652_10141156 | Ga0207652_101411562 | 386 |
| 207 | 3300025924 | Ga0207694_10001873 | Ga0207694_1000187319 | 386 |
| 208 | 3300025929 | Ga0207664_10010283 | Ga0207664_100102832 | 386 |
| 209 | 3300025944 | Ga0207661_10017086 | Ga0207661_100170864 | 386 |
| 210 | 3300025944 | Ga0207661_10070785 | Ga0207661_100707852 | 386 |
| 211 | 3300025949 | Ga0207667_10013882 | Ga0207667_100138822 | 386 |
| 212 | 3300025949 | Ga0207667_10032563 | Ga0207667_100325632 | 386 |
| 213 | 3300026078 | Ga0207702_10084261 | Ga0207702_100842612 | 386 |
| 214 | 3300026078 | Ga0207702_10118844 | Ga0207702_101188442 | 386 |
| 215 | 3300026116 | Ga0207674_10000084 | Ga0207674_1000008458 | 386 |
| 216 | 3300026118 | Ga0207675_100305471 | Ga0207675_1003054712 | 386 |
| 217 | 3300031903 | Ga0307407_10020574 | Ga0307407_100205742 | 386 |
| 218 | 3300031911 | Ga0307412_10050294 | Ga0307412_100502942 | 386 |
| 219 | 3300031995 | Ga0307409_100033854 | Ga0307409_1000338542 | 386 |
| 220 | 3300031995 | Ga0307409_100196371 | Ga0307409_1001963712 | 386 |
| 221 | 3300032002 | Ga0307416_100094696 | Ga0307416_1000946962 | 386 |
| 222 | 3300005338 | Ga0068868_100017860 | Ga0068868_1000178603 | 387 |
| 223 | 3300005367 | Ga0070667_100031423 | Ga0070667_1000314233 | 387 |
| 224 | 3300005435 | Ga0070714_100030632 | Ga0070714_1000306322 | 387 |
| 225 | 3300005548 | Ga0070665_100027300 | Ga0070665_1000273004 | 387 |
| 226 | 3300006237 | Ga0097621_100019276 | Ga0097621_1000192762 | 387 |
| 227 | 3300006358 | Ga0068871_100011560 | Ga0068871_1000115608 | 387 |
| 228 | 3300009093 | Ga0105240_10006240 | Ga0105240_100062409 | 387 |
| 229 | 3300009093 | Ga0105240_10081862 | Ga0105240_100818622 | 387 |
| 230 | 3300009174 | Ga0105241_10005150 | Ga0105241_100051507 | 387 |
| 231 | 3300009176 | Ga0105242_10001238 | Ga0105242_1000123819 | 387 |
| 232 | 3300009176 | Ga0105242_10370708 | Ga0105242_103707081 | 387 |
| 233 | 3300009177 | Ga0105248_10024731 | Ga0105248_100247313 | 387 |
| 234 | 3300009545 | Ga0105237_10048615 | Ga0105237_100486152 | 387 |
| 235 | 3300009545 | Ga0105237_10106981 | Ga0105237_101069812 | 387 |
| 236 | 3300009551 | Ga0105238_10004193 | Ga0105238_100041937 | 387 |
| 237 | 3300009551 | Ga0105238_10069292 | Ga0105238_100692922 | 387 |
| 238 | 3300013296 | Ga0157374_10143470 | Ga0157374_101434702 | 387 |
| 239 | 3300013296 | Ga0157374_10248475 | Ga0157374_102484752 | 387 |
| 240 | 3300014325 | Ga0163163_10130419 | Ga0163163_101304192 | 387 |
| 241 | 3300025914 | Ga0207671_10201371 | Ga0207671_102013712 | 387 |
| 242 | 3300025986 | Ga0207658_10042697 | Ga0207658_100426972 | 387 |
| 243 | 3300025986 | Ga0207658_10126436 | Ga0207658_101264362 | 387 |
| 244 | 3300026023 | Ga0207677_10024522 | Ga0207677_100245224 | 387 |
| 245 | 3300026088 | Ga0207641_10113530 | Ga0207641_101135302 | 387 |
| 246 | 3300028379 | Ga0268266_10023831 | Ga0268266_100238314 | 387 |
| 247 | 3300028381 | Ga0268264_10139245 | Ga0268264_101392452 | 387 |
| 248 | 3300031548 | Ga0307408_100039570 | Ga0307408_1000395702 | 387 |
| 249 | 3300031731 | Ga0307405_10008881 | Ga0307405_100088812 | 387 |
| 250 | 3300031824 | Ga0307413_10001524 | Ga0307413_100015246 | 387 |
| 251 | 3300031852 | Ga0307410_10039533 | Ga0307410_100395331 | 387 |
| 252 | 3300031911 | Ga0307412_10005830 | Ga0307412_100058304 | 387 |
| 253 | 3300031995 | Ga0307409_100000809 | Ga0307409_10000080914 | 387 |
| 254 | 3300032002 | Ga0307416_100027900 | Ga0307416_1000279003 | 387 |
| 255 | 3300032004 | Ga0307414_10136212 | Ga0307414_101362122 | 387 |
| 256 | 3300032005 | Ga0307411_10153518 | Ga0307411_101535182 | 387 |
| 257 | 3300032126 | Ga0307415_100005220 | Ga0307415_1000052202 | 387 |
| 258 | 3300005327 | Ga0070658_10002172 | Ga0070658_1000217212 | 388 |
| 259 | 3300005548 | Ga0070665_100147521 | Ga0070665_1001475212 | 388 |
| 260 | 3300005563 | Ga0068855_100028988 | Ga0068855_1000289884 | 388 |
| 261 | 3300005614 | Ga0068856_100014696 | Ga0068856_1000146962 | 388 |
| 262 | 3300009093 | Ga0105240_10007610 | Ga0105240_100076106 | 388 |
| 263 | 3300009093 | Ga0105240_10132956 | Ga0105240_101329563 | 388 |
| 264 | 3300009551 | Ga0105238_10001876 | Ga0105238_1000187611 | 388 |
| 265 | 3300009553 | Ga0105249_10113942 | Ga0105249_101139422 | 388 |
| 266 | 3300010375 | Ga0105239_10040525 | Ga0105239_100405254 | 388 |
| 267 | 3300013104 | Ga0157370_10004867 | Ga0157370_1000486710 | 388 |
| 268 | 3300013105 | Ga0157369_10001807 | Ga0157369_1000180710 | 388 |
| 269 | 3300013307 | Ga0157372_10017735 | Ga0157372_100177353 | 388 |
| 270 | 3300020069 | Ga0197907_11030823 | Ga0197907_110308231 | 388 |
| 271 | 3300020070 | Ga0206356_10111372 | Ga0206356_101113721 | 388 |
| 272 | 3300020070 | Ga0206356_10487446 | Ga0206356_104874462 | 388 |
| 273 | 3300020078 | Ga0206352_10287084 | Ga0206352_102870842 | 388 |
| 274 | 3300020080 | Ga0206350_11381908 | Ga0206350_113819081 | 388 |
| 275 | 3300025913 | Ga0207695_10003668 | Ga0207695_1000366810 | 388 |
| 276 | 3300025919 | Ga0207657_10001063 | Ga0207657_100010639 | 388 |
| 277 | 3300046531 | Ga0495665_0098375 | Ga0495665_0098375_198_1367 | 388 |
| 278 | 3300047317 | Ga0495604_0040839 | Ga0495604_0040839_45_1214 | 388 |
| 279 | 3300047319 | Ga0495674_0021415 | Ga0495674_0021415_2032_3198 | 388 |
| 280 | 3300047319 | Ga0495674_0096612 | Ga0495674_0096612_114_1283 | 388 |
| 281 | 3300047471 | Ga0495684_0040467 | Ga0495684_0040467_1695_2861 | 388 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hdq-assembly1.cif.gz_A | crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate | 0.9928 | 2 | 362 |
| 3hdq-assembly1.cif.gz_A | crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate | 0.9766 | 2 | 362 |
| 6c12-assembly2.cif.gz_A | sdha-sdhe complex | 0.9746 | 2 | 34 |
| 3urh-assembly1.cif.gz_A | crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021 | 0.9689 | 2 | 41 |
| 5vj7-assembly1.cif.gz_A | ferredoxin nadp oxidoreductase (xfn) | 0.9685 | 4 | 38 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3he3A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9913 | 2 | 362 | 3.40.50.720 |
| af_P9WHH5_150_268_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9821 | 4 | 37 | 3.50.50.60 |
| 4ntdA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9751 | 2 | 33 | 3.50.50.60 |
| 4j0fB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9705 | 4 | 35 | 3.40.50.720 |
| 3urhB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9698 | 2 | 40 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A442ZW17-F1-model_v4 | UDP-galactopyranose mutase | 0.996 | 1 | 91 |
GO:0005829
GO:0008767 GO:0050660 |
| AF-A0A3N5LUL8-F1-model_v4 | UDP-galactopyranose mutase | 0.9945 | 1 | 101 |
GO:0005829
GO:0008767 GO:0050660 |
| AF-A0A5R2N2Q2-F1-model_v4 | UDP-galactopyranose mutase | 0.9941 | 231 | 362 |
GO:0005829
GO:0008767 GO:0050660 |
| AF-A0A7W1YN75-F1-model_v4 | UDP-galactopyranose mutase (EC 5.4.99.9) | 0.9936 | 1 | 362 |
GO:0005829
GO:0008767 GO:0050660 |
| AF-A0A0Q6LUM8-F1-model_v4 | UDP-galactopyranose mutase | 0.9934 | 2 | 362 |
GO:0005829
GO:0008767 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar