F384387

General Info

Members Datasets Scaffolds Average Seq Length
281 144 280 394

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100039570|Ga0307408_1000395702
Length 420
Sequence MRIDVLVVGAGFSGAVIAERLASHGLEVLVIDKRPHIGGNAFDRTDEHGILIHPYGPHIFHTNGMRIAEYLSRFTAWRFYEHRVRAKVGEHWVPMPINIDTVNRLYGLSLTEETIGAFFESVREPRSPIATSEDVVLNSVGRDLYEKLFRGYTRKQWGLEPSQLSASVAARIPTRTNRDDRYFTDTFQHMPLDGYTRMFERMLDHPRIHCECGVDFFRLRPRIQARHIVYTGPIDAYFDHCFGRLPYRSIEFQHEHLPDTETYQPVGTVNFPNDHAYTRITEFKHLTGQVHRGTSIVREFPCDEGDPYYPVPRPENEALFKRYETLAKEAQEVTFVGRLAQYRYYNMDQCVGAALKAAEGVVTRLGLDAVQPVEGSAPRIVSVPHPEVVDEVVAAAHATAGRGGAPTARREGVPLRQKVE

Samples

Sample ID Description Type Environment
1 2919085039 Luteibacter sp. 1214 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 2.49
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.78
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002172 3300005327 Bacteria 16462
2 Ga0070658_10033041 3300005327 Bacteria 4161
3 Ga0070658_10049675 3300005327 Bacteria 3399
4 Ga0070683_100013709 3300005329 Bacteria 7078
5 Ga0070683_100095443 3300005329 Bacteria 2796
6 Ga0070683_100181834 3300005329 Bacteria 1996
7 Ga0070683_100219843 3300005329 Bacteria 1805
8 Ga0070677_10012472 3300005333 Bacteria 2952
9 Ga0070666_10024316 3300005335 Bacteria 3945
10 Ga0070666_10042386 3300005335 Bacteria 3045
11 Ga0068868_100009658 3300005338 Bacteria 6962
12 Ga0068868_100017860 3300005338 Bacteria 5292
13 Ga0070660_100001529 3300005339 Bacteria 15887
14 Ga0070661_100011438 3300005344 Bacteria 6182
15 Ga0070675_100011603 3300005354 Bacteria 6900
16 Ga0070675_100032046 3300005354 Bacteria 4252
17 Ga0070671_100011142 3300005355 Bacteria 7222
18 Ga0070671_100080866 3300005355 Bacteria 2717
19 Ga0070674_100012638 3300005356 Bacteria 5190
20 Ga0070674_100054099 3300005356 Bacteria 2775
21 Ga0070659_100170174 3300005366 Bacteria 1784
22 Ga0070667_100031423 3300005367 Bacteria 4428
23 Ga0070667_100035212 3300005367 Bacteria 4193
24 Ga0070667_100039304 3300005367 Bacteria 3965
25 Ga0070667_100061157 3300005367 Bacteria 3188
26 Ga0070714_100030632 3300005435 Bacteria 4481
27 Ga0070714_100032353 3300005435 Bacteria 4365
28 Ga0070700_100122643 3300005441 Bacteria 1744
29 Ga0070678_100008861 3300005456 Bacteria 6054
30 Ga0070662_100047262 3300005457 Bacteria 3095
31 Ga0070681_10087051 3300005458 Bacteria 3077
32 Ga0068867_100020255 3300005459 Bacteria 4740
33 Ga0070685_10038965 3300005466 Bacteria 2698
34 Ga0070679_100009285 3300005530 Bacteria 9296
35 Ga0070684_100062949 3300005535 Bacteria 3251
36 Ga0070684_100152738 3300005535 Bacteria 2092
37 Ga0068853_100283918 3300005539 Bacteria 1526
38 Ga0070672_100008010 3300005543 Bacteria 7217
39 Ga0070672_100011849 3300005543 Bacteria 6092
40 Ga0070672_100070812 3300005543 Bacteria 2772
41 Ga0070665_100020187 3300005548 Bacteria 6689
42 Ga0070665_100027300 3300005548 Bacteria 5750
43 Ga0070665_100122855 3300005548 Bacteria 2598
44 Ga0070665_100147521 3300005548 Bacteria 2355
45 Ga0068855_100028988 3300005563 Bacteria 6621
46 Ga0068855_100031015 3300005563 Bacteria 6388
47 Ga0070664_100006331 3300005564 Bacteria 9549
48 Ga0070664_100006976 3300005564 Bacteria 9109
49 Ga0070664_100010069 3300005564 Bacteria 7664
50 Ga0070664_100013966 3300005564 Bacteria 6547
51 Ga0068857_100121572 3300005577 Bacteria 2351
52 Ga0068857_100123559 3300005577 Bacteria 2332
53 Ga0068857_100339191 3300005577 Bacteria 1390
54 Ga0068854_100011447 3300005578 Bacteria 5778
55 Ga0068854_100140422 3300005578 Bacteria 1853
56 Ga0068856_100014278 3300005614 Bacteria 7680
57 Ga0068856_100014696 3300005614 Bacteria 7555
58 Ga0068856_100033675 3300005614 Bacteria 5017
59 Ga0068852_100028019 3300005616 Bacteria 4603
60 Ga0068852_100139433 3300005616 Bacteria 2242
61 Ga0068852_100204556 3300005616 Bacteria 1869
62 Ga0068864_100042774 3300005618 Bacteria 3877
63 Ga0068864_100046222 3300005618 Bacteria 3735
64 Ga0068864_100108444 3300005618 Bacteria 2471
65 Ga0068866_10052245 3300005718 Bacteria 2085
66 Ga0068861_100123848 3300005719 Bacteria 2089
67 Ga0068863_100001717 3300005841 Bacteria 21691
68 Ga0068863_100040094 3300005841 Bacteria 4453
69 Ga0068863_100041966 3300005841 Bacteria 4348
70 Ga0068860_100049010 3300005843 Bacteria 4026
71 Ga0070717_10002336 3300006028 Bacteria 13353
72 Ga0097621_100019276 3300006237 Bacteria 5233
73 Ga0097621_100160835 3300006237 Bacteria 1930
74 Ga0097621_100237849 3300006237 Bacteria 1591
75 Ga0068871_100003740 3300006358 Bacteria 10474
76 Ga0068871_100011560 3300006358 Bacteria 6476
77 Ga0068871_100110117 3300006358 Bacteria 2316
78 Ga0105240_10000137 3300009093 Bacteria 149925
79 Ga0105240_10002009 3300009093 Bacteria 33547
80 Ga0105240_10002051 3300009093 Bacteria 33088
81 Ga0105240_10006240 3300009093 Bacteria 17538
82 Ga0105240_10007610 3300009093 Bacteria 15688
83 Ga0105240_10009029 3300009093 Bacteria 14155
84 Ga0105240_10081862 3300009093 Bacteria 3965
85 Ga0105240_10132956 3300009093 Bacteria 2982
86 Ga0105245_10105938 3300009098 Bacteria 2608
87 Ga0105241_10005150 3300009174 Bacteria 9643
88 Ga0105241_10023863 3300009174 Bacteria 4539
89 Ga0105242_10001238 3300009176 Bacteria 20130
90 Ga0105242_10043003 3300009176 Bacteria 3652
91 Ga0105242_10370708 3300009176 Bacteria 1328
92 Ga0105248_10000932 3300009177 Bacteria 32593
93 Ga0105248_10024731 3300009177 Bacteria 6679
94 Ga0105248_10032594 3300009177 Bacteria 5822
95 Ga0105248_10107979 3300009177 Bacteria 3138
96 Ga0105237_10048615 3300009545 Bacteria 4264
97 Ga0105237_10106981 3300009545 Bacteria 2789
98 Ga0105237_10189651 3300009545 Bacteria 2056
99 Ga0105238_10001876 3300009551 Bacteria 21082
100 Ga0105238_10004193 3300009551 Bacteria 14309
101 Ga0105238_10029701 3300009551 Bacteria 5567
102 Ga0105238_10069292 3300009551 Bacteria 3528
103 Ga0105249_10113942 3300009553 Bacteria 2559
104 Ga0105249_10284645 3300009553 Bacteria 1652
105 Ga0105239_10040525 3300010375 Bacteria 5103
106 Ga0157373_10112876 3300013100 Bacteria 1910
107 Ga0157371_10092050 3300013102 Bacteria 2148
108 Ga0157370_10000193 3300013104 Bacteria 76373
109 Ga0157370_10004867 3300013104 Bacteria 15245
110 Ga0157370_10005591 3300013104 Bacteria 14077
111 Ga0157370_10135107 3300013104 Bacteria 2299
112 Ga0157369_10001807 3300013105 Bacteria 25881
113 Ga0157369_10009272 3300013105 Bacteria 11261
114 Ga0157369_10164623 3300013105 Bacteria 2340
115 Ga0157374_10006705 3300013296 Bacteria 9784
116 Ga0157374_10010223 3300013296 Bacteria 8070
117 Ga0157374_10015952 3300013296 Bacteria 6599
118 Ga0157374_10143470 3300013296 Bacteria 2319
119 Ga0157374_10248475 3300013296 Bacteria 1750
120 Ga0157378_10088442 3300013297 Bacteria 2811
121 Ga0157378_10224569 3300013297 Bacteria 1787
122 Ga0163162_10027241 3300013306 Bacteria 5651
123 Ga0163162_10044104 3300013306 Bacteria 4466
124 Ga0163162_10075775 3300013306 Bacteria 3425
125 Ga0157372_10009672 3300013307 Bacteria 10249
126 Ga0157372_10017735 3300013307 Bacteria 7641
127 Ga0157372_10020336 3300013307 Bacteria 7160
128 Ga0157372_10027432 3300013307 Bacteria 6202
129 Ga0157372_10067556 3300013307 Bacteria 4017
130 Ga0157372_10435639 3300013307 Bacteria 1528
131 Ga0157372_10492763 3300013307 Bacteria 1429
132 Ga0157375_10014739 3300013308 Bacteria 6987
133 Ga0157375_10034530 3300013308 Bacteria 4819
134 Ga0157375_10313135 3300013308 Bacteria 1734
135 Ga0163163_10008761 3300014325 Bacteria 9003
136 Ga0163163_10130419 3300014325 Bacteria 2554
137 Ga0182008_10042560 3300014497 Bacteria 2263
138 Ga0157377_10032051 3300014745 Bacteria 2859
139 Ga0157376_10002965 3300014969 Bacteria 11647
140 Ga0182005_1000004 3300015265 Bacteria 609645
141 Ga0163161_10071497 3300017792 Bacteria 2539
142 Ga0197907_11030823 3300020069 Bacteria 2720
143 Ga0206356_10111372 3300020070 Bacteria 1356
144 Ga0206356_10487446 3300020070 Bacteria 1999
145 Ga0206352_10287084 3300020078 Bacteria 1727
146 Ga0206350_10322456 3300020080 Bacteria 1623
147 Ga0206350_11381908 3300020080 Bacteria 1406
148 Ga0224712_10005227 3300022467 Bacteria 3591
149 Ga0207656_10003082 3300025321 Bacteria 5702
150 Ga0207656_10006514 3300025321 Bacteria 4203
151 Ga0207682_10010801 3300025893 Bacteria 3576
152 Ga0207688_10014520 3300025901 Bacteria 4280
153 Ga0207680_10046822 3300025903 Bacteria 2559
154 Ga0207705_10018018 3300025909 Bacteria 5050
155 Ga0207707_10072871 3300025912 Bacteria 2994
156 Ga0207695_10003599 3300025913 Bacteria 21692
157 Ga0207695_10003668 3300025913 Bacteria 21407
158 Ga0207695_10025947 3300025913 Bacteria 6548
159 Ga0207695_10113198 3300025913 Bacteria 2690
160 Ga0207695_10209052 3300025913 Bacteria 1863
161 Ga0207671_10201371 3300025914 Bacteria 1555
162 Ga0207657_10001063 3300025919 Bacteria 29134
163 Ga0207649_10028307 3300025920 Bacteria 3298
164 Ga0207649_10028711 3300025920 Bacteria 3278
165 Ga0207652_10141156 3300025921 Bacteria 2154
166 Ga0207694_10001873 3300025924 Bacteria 17439
167 Ga0207650_10008699 3300025925 Bacteria 6930
168 Ga0207650_10014624 3300025925 Bacteria 5450
169 Ga0207650_10015225 3300025925 Bacteria 5352
170 Ga0207650_10032568 3300025925 Bacteria 3770
171 Ga0207650_10146791 3300025925 Bacteria 1858
172 Ga0207659_10002745 3300025926 Bacteria 10494
173 Ga0207659_10255177 3300025926 Bacteria 1424
174 Ga0207700_10002326 3300025928 Bacteria 10898
175 Ga0207664_10010283 3300025929 Bacteria 6608
176 Ga0207644_10007412 3300025931 Bacteria 7151
177 Ga0207644_10019216 3300025931 Bacteria 4631
178 Ga0207644_10187507 3300025931 Bacteria 1625
179 Ga0207706_10045360 3300025933 Bacteria 3895
180 Ga0207669_10146140 3300025937 Bacteria 1649
181 Ga0207691_10008248 3300025940 Bacteria 10002
182 Ga0207691_10009016 3300025940 Bacteria 9566
183 Ga0207711_10005491 3300025941 Bacteria 10717
184 Ga0207711_10045843 3300025941 Bacteria 3736
185 Ga0207711_10109185 3300025941 Bacteria 2458
186 Ga0207689_10152424 3300025942 Bacteria 1905
187 Ga0207689_10152538 3300025942 Bacteria 1904
188 Ga0207661_10010316 3300025944 Bacteria 6720
189 Ga0207661_10017086 3300025944 Bacteria 5361
190 Ga0207661_10070785 3300025944 Bacteria 2848
191 Ga0207679_10002560 3300025945 Bacteria 11213
192 Ga0207679_10004512 3300025945 Bacteria 8671
193 Ga0207667_10013882 3300025949 Bacteria 9202
194 Ga0207667_10032563 3300025949 Bacteria 5616
195 Ga0207651_10009305 3300025960 Bacteria 5368
196 Ga0207668_10159247 3300025972 Bacteria 1757
197 Ga0207658_10042697 3300025986 Bacteria 3291
198 Ga0207658_10064576 3300025986 Bacteria 2746
199 Ga0207658_10126436 3300025986 Bacteria 2047
200 Ga0207677_10002904 3300026023 Bacteria 9055
201 Ga0207677_10024522 3300026023 Bacteria 3749
202 Ga0207639_10123703 3300026041 Bacteria 2130
203 Ga0207702_10075359 3300026078 Bacteria 2915
204 Ga0207702_10084261 3300026078 Bacteria 2767
205 Ga0207702_10118844 3300026078 Bacteria 2362
206 Ga0207641_10012264 3300026088 Bacteria 7031
207 Ga0207641_10113530 3300026088 Bacteria 2406
208 Ga0207641_10183100 3300026088 Bacteria 1920
209 Ga0207648_10025103 3300026089 Bacteria 5313
210 Ga0207648_10086471 3300026089 Bacteria 2736
211 Ga0207648_10093101 3300026089 Bacteria 2636
212 Ga0207676_10053545 3300026095 Bacteria 3159
213 Ga0207676_10297403 3300026095 Bacteria 1472
214 Ga0207674_10000084 3300026116 Bacteria 101302
215 Ga0207674_10054838 3300026116 Bacteria 4056
216 Ga0207674_10088298 3300026116 Bacteria 3094
217 Ga0207674_10313715 3300026116 Bacteria 1517
218 Ga0207675_100305471 3300026118 Bacteria 1550
219 Ga0207675_100407084 3300026118 Bacteria 1341
220 Ga0207683_10005263 3300026121 Bacteria 11104
221 Ga0207683_10192592 3300026121 Bacteria 1851
222 Ga0209967_1005581 3300027364 Bacteria 1694
223 Ga0209995_1004870 3300027471 Bacteria 2154
224 Ga0209983_1001761 3300027665 Bacteria 4796
225 Ga0209983_1008310 3300027665 Bacteria 2122
226 Ga0209974_10001762 3300027876 Bacteria 7887
227 Ga0209974_10001986 3300027876 Bacteria 7459
228 Ga0268266_10023831 3300028379 Bacteria 5208
229 Ga0268264_10139245 3300028381 Bacteria 2162
230 Ga0307408_100039570 3300031548 Bacteria 3333
231 Ga0316579_10021720 3300031691 Bacteria 2863
232 Ga0307405_10008881 3300031731 Bacteria 5123
233 Ga0307413_10001524 3300031824 Bacteria 8884
234 Ga0307413_10194791 3300031824 Bacteria 1458
235 Ga0307410_10039533 3300031852 Bacteria 3097
236 Ga0307410_10073770 3300031852 Bacteria 2374
237 Ga0307407_10020574 3300031903 Bacteria 3385
238 Ga0307407_10030895 3300031903 Bacteria 2895
239 Ga0307412_10005830 3300031911 Bacteria 6930
240 Ga0307412_10050294 3300031911 Bacteria 2750
241 Ga0307409_100000809 3300031995 Bacteria 14331
242 Ga0307409_100033854 3300031995 Bacteria 3724
243 Ga0307409_100038759 3300031995 Bacteria 3528
244 Ga0307409_100077090 3300031995 Bacteria 2676
245 Ga0307409_100196371 3300031995 Bacteria 1801
246 Ga0307416_100004180 3300032002 Bacteria 8651
247 Ga0307416_100015045 3300032002 Bacteria 5327
248 Ga0307416_100027900 3300032002 Bacteria 4189
249 Ga0307416_100094696 3300032002 Bacteria 2576
250 Ga0307414_10136212 3300032004 Bacteria 1915
251 Ga0307414_10272694 3300032004 Bacteria 1418
252 Ga0307411_10153518 3300032005 Bacteria 1714
253 Ga0307411_10183382 3300032005 Bacteria 1591
254 Ga0307415_100005220 3300032126 Bacteria 6867
255 Ga0307415_100024605 3300032126 Bacteria 3763
256 Ga0307415_100048962 3300032126 Bacteria 2854
257 Ga0451843_1484314 3300041509 Bacteria 1610
258 Ga0451577_0052536 3300042876 Bacteria 3638
259 Ga0466965_0046047 3300044683 Bacteria 2158
260 Ga0466963_0124486 3300044694 Bacteria 1776
261 Ga0466964_0016907 3300044706 Bacteria 2789
262 Ga0466964_0061551 3300044706 Bacteria 1563
263 Ga0453684_0387737 3300044712 Bacteria 1567
264 Ga0451576_0027372 3300045051 Bacteria 6124
265 Ga0466967_0003901 3300045976 Bacteria 9898
266 Ga0495665_0098375 3300046531 Bacteria 1536
267 Ga0495587_0167447 3300046536 Bacteria 1249
268 Ga0495604_0040839 3300047317 Bacteria 3641
269 Ga0495674_0021415 3300047319 Bacteria 5980
270 Ga0495674_0096612 3300047319 Bacteria 2518
271 Ga0495674_0217442 3300047319 Bacteria 1581
272 Ga0495684_0040467 3300047471 Bacteria 3573
273 Ga0496100_0087330 3300048903 Bacteria 2120
274 Ga0496104_0193144 3300048907 Bacteria 1948
275 Ga0496106_0060043 3300048909 Bacteria 2882
276 Ga0496109_0015948 3300048912 Bacteria 6563
277 Ga0496110_0004228 3300048913 Bacteria 11112
278 Ga0496116_0053370 3300048919 Bacteria 2670
279 Ga0501292_006322 3300049515 Bacteria 1679
280 Ga0501035_0000422 3300049822 Bacteria 47672

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10209052 Ga0207695_102090522 334
2 3300046536 Ga0495587_0167447 Ga0495587_0167447_16_1035 338
3 3300026095 Ga0207676_10297403 Ga0207676_102974032 339
4 3300031691 Ga0316579_10021720 Ga0316579_100217203 363
5 3300013307 Ga0157372_10067556 Ga0157372_100675562 365
6 3300044683 Ga0466965_0046047 Ga0466965_0046047_121_1233 365
7 3300044694 Ga0466963_0124486 Ga0466963_0124486_309_1421 365
8 3300044706 Ga0466964_0016907 Ga0466964_0016907_807_1919 365
9 3300044706 Ga0466964_0061551 Ga0466964_0061551_269_1381 365
10 3300045976 Ga0466967_0003901 Ga0466967_0003901_7846_8958 365
11 3300005329 Ga0070683_100095443 Ga0070683_1000954432 367
12 3300047319 Ga0495674_0217442 Ga0495674_0217442_441_1544 367
13 3300005339 Ga0070660_100001529 Ga0070660_10000152911 369
14 3300005367 Ga0070667_100035212 Ga0070667_1000352123 370
15 3300005466 Ga0070685_10038965 Ga0070685_100389652 370
16 3300005543 Ga0070672_100070812 Ga0070672_1000708122 370
17 3300005618 Ga0068864_100042774 Ga0068864_1000427744 370
18 3300005841 Ga0068863_100001717 Ga0068863_1000017178 370
19 3300005843 Ga0068860_100049010 Ga0068860_1000490102 370
20 3300006358 Ga0068871_100110117 Ga0068871_1001101172 370
21 3300009098 Ga0105245_10105938 Ga0105245_101059382 370
22 3300013306 Ga0163162_10027241 Ga0163162_100272415 370
23 3300013308 Ga0157375_10034530 Ga0157375_100345304 370
24 3300014325 Ga0163163_10008761 Ga0163163_100087612 370
25 3300014745 Ga0157377_10032051 Ga0157377_100320512 370
26 3300025903 Ga0207680_10046822 Ga0207680_100468222 370
27 3300025925 Ga0207650_10015225 Ga0207650_100152256 370
28 3300025926 Ga0207659_10002745 Ga0207659_100027452 370
29 3300025941 Ga0207711_10005491 Ga0207711_100054914 370
30 3300026088 Ga0207641_10012264 Ga0207641_100122642 370
31 3300005356 Ga0070674_100054099 Ga0070674_1000540992 371
32 3300005578 Ga0068854_100140422 Ga0068854_1001404222 371
33 3300005616 Ga0068852_100204556 Ga0068852_1002045562 371
34 3300005719 Ga0068861_100123848 Ga0068861_1001238482 371
35 3300013297 Ga0157378_10224569 Ga0157378_102245692 371
36 3300025925 Ga0207650_10008699 Ga0207650_100086993 371
37 3300025928 Ga0207700_10002326 Ga0207700_100023266 371
38 3300025931 Ga0207644_10187507 Ga0207644_101875071 371
39 3300025937 Ga0207669_10146140 Ga0207669_101461402 371
40 3300025972 Ga0207668_10159247 Ga0207668_101592471 371
41 3300026089 Ga0207648_10086471 Ga0207648_100864712 371
42 3300026118 Ga0207675_100407084 Ga0207675_1004070841 371
43 iso_pu_bacteria 2919085039 2919085392 371
44 3300009093 Ga0105240_10009029 Ga0105240_100090298 373
45 3300026078 Ga0207702_10075359 Ga0207702_100753592 373
46 3300031903 Ga0307407_10030895 Ga0307407_100308952 373
47 3300031995 Ga0307409_100077090 Ga0307409_1000770902 373
48 3300032002 Ga0307416_100004180 Ga0307416_1000041805 373
49 3300032004 Ga0307414_10272694 Ga0307414_102726941 373
50 3300032126 Ga0307415_100048962 Ga0307415_1000489622 373
51 3300041509 Ga0451843_1484314 Ga0451843_1484314_57_1208 373
52 3300049515 Ga0501292_006322 Ga0501292_006322_75_1244 373
53 3300005333 Ga0070677_10012472 Ga0070677_100124722 374
54 3300005338 Ga0068868_100009658 Ga0068868_1000096583 374
55 3300005354 Ga0070675_100032046 Ga0070675_1000320462 374
56 3300005367 Ga0070667_100039304 Ga0070667_1000393042 374
57 3300005456 Ga0070678_100008861 Ga0070678_1000088614 374
58 3300005459 Ga0068867_100020255 Ga0068867_1000202552 374
59 3300005539 Ga0068853_100283918 Ga0068853_1002839181 374
60 3300005543 Ga0070672_100008010 Ga0070672_1000080103 374
61 3300005564 Ga0070664_100010069 Ga0070664_1000100693 374
62 3300005577 Ga0068857_100121572 Ga0068857_1001215722 374
63 3300005577 Ga0068857_100339191 Ga0068857_1003391912 374
64 3300005616 Ga0068852_100028019 Ga0068852_1000280193 374
65 3300005618 Ga0068864_100046222 Ga0068864_1000462222 374
66 3300005841 Ga0068863_100041966 Ga0068863_1000419662 374
67 3300006358 Ga0068871_100003740 Ga0068871_1000037409 374
68 3300009176 Ga0105242_10043003 Ga0105242_100430032 374
69 3300009177 Ga0105248_10107979 Ga0105248_101079792 374
70 3300013104 Ga0157370_10000193 Ga0157370_1000019328 374
71 3300013296 Ga0157374_10015952 Ga0157374_100159524 374
72 3300013297 Ga0157378_10088442 Ga0157378_100884422 374
73 3300013306 Ga0163162_10044104 Ga0163162_100441044 374
74 3300013308 Ga0157375_10014739 Ga0157375_100147393 374
75 3300014969 Ga0157376_10002965 Ga0157376_100029652 374
76 3300015265 Ga0182005_1000004 Ga0182005_1000004216 374
77 3300025321 Ga0207656_10006514 Ga0207656_100065142 374
78 3300025909 Ga0207705_10018018 Ga0207705_100180182 374
79 3300025925 Ga0207650_10014624 Ga0207650_100146242 374
80 3300025940 Ga0207691_10008248 Ga0207691_100082488 374
81 3300025942 Ga0207689_10152538 Ga0207689_101525382 374
82 3300025944 Ga0207661_10010316 Ga0207661_100103163 374
83 3300025960 Ga0207651_10009305 Ga0207651_100093052 374
84 3300026023 Ga0207677_10002904 Ga0207677_100029047 374
85 3300026089 Ga0207648_10025103 Ga0207648_100251032 374
86 3300026095 Ga0207676_10053545 Ga0207676_100535452 374
87 3300026116 Ga0207674_10054838 Ga0207674_100548382 374
88 3300026121 Ga0207683_10005263 Ga0207683_1000526311 374
89 3300031824 Ga0307413_10194791 Ga0307413_101947912 374
90 3300031852 Ga0307410_10073770 Ga0307410_100737702 374
91 3300031995 Ga0307409_100038759 Ga0307409_1000387593 374
92 3300032002 Ga0307416_100015045 Ga0307416_1000150452 374
93 3300032126 Ga0307415_100024605 Ga0307415_1000246053 374
94 3300048903 Ga0496100_0087330 Ga0496100_0087330_674_1849 374
95 3300048907 Ga0496104_0193144 Ga0496104_0193144_56_1231 374
96 3300048912 Ga0496109_0015948 Ga0496109_0015948_2917_4092 374
97 3300048913 Ga0496110_0004228 Ga0496110_0004228_6614_7789 374
98 3300048919 Ga0496116_0053370 Ga0496116_0053370_1315_2487 374
99 3300027364 Ga0209967_1005581 Ga0209967_10055812 375
100 3300027471 Ga0209995_1004870 Ga0209995_10048702 375
101 3300027665 Ga0209983_1008310 Ga0209983_10083102 375
102 3300027876 Ga0209974_10001986 Ga0209974_100019862 375
103 3300006028 Ga0070717_10002336 Ga0070717_100023367 376
104 3300005344 Ga0070661_100011438 Ga0070661_1000114384 377
105 3300005564 Ga0070664_100006976 Ga0070664_1000069763 377
106 3300025920 Ga0207649_10028307 Ga0207649_100283072 377
107 3300025945 Ga0207679_10004512 Ga0207679_100045126 377
108 3300026116 Ga0207674_10313715 Ga0207674_103137151 377
109 3300042876 Ga0451577_0052536 Ga0451577_0052536_1081_2223 377
110 3300044712 Ga0453684_0387737 Ga0453684_0387737_127_1269 377
111 3300045051 Ga0451576_0027372 Ga0451576_0027372_968_2110 377
112 3300049822 Ga0501035_0000422 Ga0501035_0000422_13185_14318 377
113 3300005548 Ga0070665_100020187 Ga0070665_1000201875 378
114 3300022467 Ga0224712_10005227 Ga0224712_100052273 378
115 3300005329 Ga0070683_100219843 Ga0070683_1002198431 381
116 3300005335 Ga0070666_10042386 Ga0070666_100423862 381
117 3300005354 Ga0070675_100011603 Ga0070675_1000116035 381
118 3300005355 Ga0070671_100080866 Ga0070671_1000808662 381
119 3300005367 Ga0070667_100061157 Ga0070667_1000611572 381
120 3300005535 Ga0070684_100152738 Ga0070684_1001527382 381
121 3300005543 Ga0070672_100011849 Ga0070672_1000118494 381
122 3300005548 Ga0070665_100122855 Ga0070665_1001228552 381
123 3300005616 Ga0068852_100139433 Ga0068852_1001394332 381
124 3300005618 Ga0068864_100108444 Ga0068864_1001084442 381
125 3300005841 Ga0068863_100040094 Ga0068863_1000400942 381
126 3300006237 Ga0097621_100160835 Ga0097621_1001608352 381
127 3300006237 Ga0097621_100237849 Ga0097621_1002378491 381
128 3300009177 Ga0105248_10032594 Ga0105248_100325942 381
129 3300009553 Ga0105249_10284645 Ga0105249_102846452 381
130 3300013306 Ga0163162_10075775 Ga0163162_100757752 381
131 3300013308 Ga0157375_10313135 Ga0157375_103131352 381
132 3300017792 Ga0163161_10071497 Ga0163161_100714972 381
133 3300025893 Ga0207682_10010801 Ga0207682_100108012 381
134 3300025901 Ga0207688_10014520 Ga0207688_100145202 381
135 3300025926 Ga0207659_10255177 Ga0207659_102551772 381
136 3300025931 Ga0207644_10019216 Ga0207644_100192163 381
137 3300025940 Ga0207691_10009016 Ga0207691_100090166 381
138 3300025941 Ga0207711_10109185 Ga0207711_101091852 381
139 3300025942 Ga0207689_10152424 Ga0207689_101524241 381
140 3300025986 Ga0207658_10064576 Ga0207658_100645762 381
141 3300026089 Ga0207648_10093101 Ga0207648_100931012 381
142 3300032005 Ga0307411_10183382 Ga0307411_101833822 381
143 3300005327 Ga0070658_10033041 Ga0070658_100330412 382
144 3300005356 Ga0070674_100012638 Ga0070674_1000126382 383
145 3300005366 Ga0070659_100170174 Ga0070659_1001701742 383
146 3300005441 Ga0070700_100122643 Ga0070700_1001226432 383
147 3300005564 Ga0070664_100013966 Ga0070664_1000139665 383
148 3300005578 Ga0068854_100011447 Ga0068854_1000114473 383
149 3300005718 Ga0068866_10052245 Ga0068866_100522452 383
150 3300013296 Ga0157374_10010223 Ga0157374_100102232 383
151 3300013307 Ga0157372_10027432 Ga0157372_100274324 383
152 3300025321 Ga0207656_10003082 Ga0207656_100030825 383
153 3300025925 Ga0207650_10032568 Ga0207650_100325683 383
154 3300025925 Ga0207650_10146791 Ga0207650_101467912 383
155 3300025945 Ga0207679_10002560 Ga0207679_100025605 383
156 3300026121 Ga0207683_10192592 Ga0207683_101925922 383
157 3300027876 Ga0209974_10001762 Ga0209974_100017622 383
158 3300009545 Ga0105237_10189651 Ga0105237_101896512 384
159 3300005335 Ga0070666_10024316 Ga0070666_100243163 385
160 3300005355 Ga0070671_100011142 Ga0070671_1000111422 385
161 3300005457 Ga0070662_100047262 Ga0070662_1000472622 385
162 3300005577 Ga0068857_100123559 Ga0068857_1001235592 385
163 3300009177 Ga0105248_10000932 Ga0105248_100009329 385
164 3300013100 Ga0157373_10112876 Ga0157373_101128761 385
165 3300013102 Ga0157371_10092050 Ga0157371_100920502 385
166 3300013307 Ga0157372_10435639 Ga0157372_104356391 385
167 3300013307 Ga0157372_10492763 Ga0157372_104927632 385
168 3300020080 Ga0206350_10322456 Ga0206350_103224562 385
169 3300025931 Ga0207644_10007412 Ga0207644_100074123 385
170 3300025933 Ga0207706_10045360 Ga0207706_100453602 385
171 3300025941 Ga0207711_10045843 Ga0207711_100458432 385
172 3300026041 Ga0207639_10123703 Ga0207639_101237032 385
173 3300026088 Ga0207641_10183100 Ga0207641_101831001 385
174 3300026116 Ga0207674_10088298 Ga0207674_100882982 385
175 3300027665 Ga0209983_1001761 Ga0209983_10017612 385
176 3300048909 Ga0496106_0060043 Ga0496106_0060043_1432_2676 385
177 3300005327 Ga0070658_10049675 Ga0070658_100496752 386
178 3300005329 Ga0070683_100013709 Ga0070683_1000137092 386
179 3300005329 Ga0070683_100181834 Ga0070683_1001818342 386
180 3300005435 Ga0070714_100032353 Ga0070714_1000323533 386
181 3300005458 Ga0070681_10087051 Ga0070681_100870511 386
182 3300005530 Ga0070679_100009285 Ga0070679_1000092857 386
183 3300005535 Ga0070684_100062949 Ga0070684_1000629492 386
184 3300005563 Ga0068855_100031015 Ga0068855_1000310152 386
185 3300005564 Ga0070664_100006331 Ga0070664_1000063312 386
186 3300005614 Ga0068856_100014278 Ga0068856_1000142785 386
187 3300005614 Ga0068856_100033675 Ga0068856_1000336753 386
188 3300009093 Ga0105240_10000137 Ga0105240_1000013742 386
189 3300009093 Ga0105240_10002009 Ga0105240_100020099 386
190 3300009093 Ga0105240_10002051 Ga0105240_1000205127 386
191 3300009174 Ga0105241_10023863 Ga0105241_100238633 386
192 3300009551 Ga0105238_10029701 Ga0105238_100297012 386
193 3300013104 Ga0157370_10005591 Ga0157370_100055917 386
194 3300013104 Ga0157370_10135107 Ga0157370_101351072 386
195 3300013105 Ga0157369_10009272 Ga0157369_100092724 386
196 3300013105 Ga0157369_10164623 Ga0157369_101646232 386
197 3300013296 Ga0157374_10006705 Ga0157374_100067054 386
198 3300013307 Ga0157372_10009672 Ga0157372_100096723 386
199 3300013307 Ga0157372_10020336 Ga0157372_100203363 386
200 3300014497 Ga0182008_10042560 Ga0182008_100425602 386
201 3300025912 Ga0207707_10072871 Ga0207707_100728712 386
202 3300025913 Ga0207695_10003599 Ga0207695_1000359916 386
203 3300025913 Ga0207695_10025947 Ga0207695_100259472 386
204 3300025913 Ga0207695_10113198 Ga0207695_101131982 386
205 3300025920 Ga0207649_10028711 Ga0207649_100287112 386
206 3300025921 Ga0207652_10141156 Ga0207652_101411562 386
207 3300025924 Ga0207694_10001873 Ga0207694_1000187319 386
208 3300025929 Ga0207664_10010283 Ga0207664_100102832 386
209 3300025944 Ga0207661_10017086 Ga0207661_100170864 386
210 3300025944 Ga0207661_10070785 Ga0207661_100707852 386
211 3300025949 Ga0207667_10013882 Ga0207667_100138822 386
212 3300025949 Ga0207667_10032563 Ga0207667_100325632 386
213 3300026078 Ga0207702_10084261 Ga0207702_100842612 386
214 3300026078 Ga0207702_10118844 Ga0207702_101188442 386
215 3300026116 Ga0207674_10000084 Ga0207674_1000008458 386
216 3300026118 Ga0207675_100305471 Ga0207675_1003054712 386
217 3300031903 Ga0307407_10020574 Ga0307407_100205742 386
218 3300031911 Ga0307412_10050294 Ga0307412_100502942 386
219 3300031995 Ga0307409_100033854 Ga0307409_1000338542 386
220 3300031995 Ga0307409_100196371 Ga0307409_1001963712 386
221 3300032002 Ga0307416_100094696 Ga0307416_1000946962 386
222 3300005338 Ga0068868_100017860 Ga0068868_1000178603 387
223 3300005367 Ga0070667_100031423 Ga0070667_1000314233 387
224 3300005435 Ga0070714_100030632 Ga0070714_1000306322 387
225 3300005548 Ga0070665_100027300 Ga0070665_1000273004 387
226 3300006237 Ga0097621_100019276 Ga0097621_1000192762 387
227 3300006358 Ga0068871_100011560 Ga0068871_1000115608 387
228 3300009093 Ga0105240_10006240 Ga0105240_100062409 387
229 3300009093 Ga0105240_10081862 Ga0105240_100818622 387
230 3300009174 Ga0105241_10005150 Ga0105241_100051507 387
231 3300009176 Ga0105242_10001238 Ga0105242_1000123819 387
232 3300009176 Ga0105242_10370708 Ga0105242_103707081 387
233 3300009177 Ga0105248_10024731 Ga0105248_100247313 387
234 3300009545 Ga0105237_10048615 Ga0105237_100486152 387
235 3300009545 Ga0105237_10106981 Ga0105237_101069812 387
236 3300009551 Ga0105238_10004193 Ga0105238_100041937 387
237 3300009551 Ga0105238_10069292 Ga0105238_100692922 387
238 3300013296 Ga0157374_10143470 Ga0157374_101434702 387
239 3300013296 Ga0157374_10248475 Ga0157374_102484752 387
240 3300014325 Ga0163163_10130419 Ga0163163_101304192 387
241 3300025914 Ga0207671_10201371 Ga0207671_102013712 387
242 3300025986 Ga0207658_10042697 Ga0207658_100426972 387
243 3300025986 Ga0207658_10126436 Ga0207658_101264362 387
244 3300026023 Ga0207677_10024522 Ga0207677_100245224 387
245 3300026088 Ga0207641_10113530 Ga0207641_101135302 387
246 3300028379 Ga0268266_10023831 Ga0268266_100238314 387
247 3300028381 Ga0268264_10139245 Ga0268264_101392452 387
248 3300031548 Ga0307408_100039570 Ga0307408_1000395702 387
249 3300031731 Ga0307405_10008881 Ga0307405_100088812 387
250 3300031824 Ga0307413_10001524 Ga0307413_100015246 387
251 3300031852 Ga0307410_10039533 Ga0307410_100395331 387
252 3300031911 Ga0307412_10005830 Ga0307412_100058304 387
253 3300031995 Ga0307409_100000809 Ga0307409_10000080914 387
254 3300032002 Ga0307416_100027900 Ga0307416_1000279003 387
255 3300032004 Ga0307414_10136212 Ga0307414_101362122 387
256 3300032005 Ga0307411_10153518 Ga0307411_101535182 387
257 3300032126 Ga0307415_100005220 Ga0307415_1000052202 387
258 3300005327 Ga0070658_10002172 Ga0070658_1000217212 388
259 3300005548 Ga0070665_100147521 Ga0070665_1001475212 388
260 3300005563 Ga0068855_100028988 Ga0068855_1000289884 388
261 3300005614 Ga0068856_100014696 Ga0068856_1000146962 388
262 3300009093 Ga0105240_10007610 Ga0105240_100076106 388
263 3300009093 Ga0105240_10132956 Ga0105240_101329563 388
264 3300009551 Ga0105238_10001876 Ga0105238_1000187611 388
265 3300009553 Ga0105249_10113942 Ga0105249_101139422 388
266 3300010375 Ga0105239_10040525 Ga0105239_100405254 388
267 3300013104 Ga0157370_10004867 Ga0157370_1000486710 388
268 3300013105 Ga0157369_10001807 Ga0157369_1000180710 388
269 3300013307 Ga0157372_10017735 Ga0157372_100177353 388
270 3300020069 Ga0197907_11030823 Ga0197907_110308231 388
271 3300020070 Ga0206356_10111372 Ga0206356_101113721 388
272 3300020070 Ga0206356_10487446 Ga0206356_104874462 388
273 3300020078 Ga0206352_10287084 Ga0206352_102870842 388
274 3300020080 Ga0206350_11381908 Ga0206350_113819081 388
275 3300025913 Ga0207695_10003668 Ga0207695_1000366810 388
276 3300025919 Ga0207657_10001063 Ga0207657_100010639 388
277 3300046531 Ga0495665_0098375 Ga0495665_0098375_198_1367 388
278 3300047317 Ga0495604_0040839 Ga0495604_0040839_45_1214 388
279 3300047319 Ga0495674_0021415 Ga0495674_0021415_2032_3198 388
280 3300047319 Ga0495674_0096612 Ga0495674_0096612_114_1283 388
281 3300047471 Ga0495684_0040467 Ga0495684_0040467_1695_2861 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03275

GLF

UDP-galactopyranose mutase

147

344

0.98

PF00890

FAD_binding_2

FAD binding domain

4

43

0.96

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

4

48

0.95

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

12

88

0.91

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

7

74

0.91

PF13454

NAD_binding_9

FAD-NAD(P)-binding

6

83

0.88

PF01266

DAO

FAD dependent oxidoreductase

4

190

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdq-assembly1.cif.gz_A crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate 0.9928 2 362
3hdq-assembly1.cif.gz_A crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate 0.9766 2 362
6c12-assembly2.cif.gz_A sdha-sdhe complex 0.9746 2 34
3urh-assembly1.cif.gz_A crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021 0.9689 2 41
5vj7-assembly1.cif.gz_A ferredoxin nadp oxidoreductase (xfn) 0.9685 4 38
ID Description Score Start End Superfamily
3he3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9913 2 362 3.40.50.720
af_P9WHH5_150_268_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9821 4 37 3.50.50.60
4ntdA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9751 2 33 3.50.50.60
4j0fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9705 4 35 3.40.50.720
3urhB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9698 2 40 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A442ZW17-F1-model_v4 UDP-galactopyranose mutase 0.996 1 91 GO:0005829
GO:0008767
GO:0050660
AF-A0A3N5LUL8-F1-model_v4 UDP-galactopyranose mutase 0.9945 1 101 GO:0005829
GO:0008767
GO:0050660
AF-A0A5R2N2Q2-F1-model_v4 UDP-galactopyranose mutase 0.9941 231 362 GO:0005829
GO:0008767
GO:0050660
AF-A0A7W1YN75-F1-model_v4 UDP-galactopyranose mutase (EC 5.4.99.9) 0.9936 1 362 GO:0005829
GO:0008767
GO:0050660
AF-A0A0Q6LUM8-F1-model_v4 UDP-galactopyranose mutase 0.9934 2 362 GO:0005829
GO:0008767
GO:0050660

Feature Viewer

pLDDT pTM Quality
91.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map