F384367

General Info

Members Datasets Scaffolds Average Seq Length
281 186 562 190

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10002985|Ga0265334_100029852
Length 207
Sequence MHKPILTIVIGSTRPGRVGPKFAEWFRTRAEAHGGFHIDLVDLAELNLPLLDEPNHPRLRQYTHQHTLDWSRTVDRSDAFVFVMPEYNFGYNAALKNAIDYLSQEWADKAVGFVSYGGVAAGTRAVQQLKQVVTALKMIPVAESVNIPFFSQFIDASGVVQPNEVMTRAADAMLDELARVTALIRPNATASAASEEAAEAEPGVLFG

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
185 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
186 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 2.49
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.9
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10002985 3300028573 Bacteria 7736
2 Ga0058863_11895587 3300004799 Bacteria 1858
3 Ga0070683_100028186 3300005329 Bacteria 5074
4 Ga0070680_100000290 3300005336 Bacteria 33584
5 Ga0068868_100208933 3300005338 Bacteria 1631
6 Ga0070689_100764202 3300005340 Bacteria 848
7 Ga0070668_100026057 3300005347 Bacteria 4434
8 Ga0070667_100070433 3300005367 Bacteria 2976
9 Ga0070667_100103269 3300005367 Bacteria 2464
10 Ga0070709_10002744 3300005434 Bacteria 9527
11 Ga0070710_10016050 3300005437 Bacteria 3802
12 Ga0070681_10000060 3300005458 Bacteria 78566
13 Ga0070707_101265180 3300005468 Bacteria 704
14 Ga0070679_100000048 3300005530 Bacteria 89533
15 Ga0070684_101086341 3300005535 Bacteria 752
16 Ga0070665_100662990 3300005548 Bacteria 1056
17 Ga0068855_100013946 3300005563 Bacteria 9692
18 Ga0068855_100147084 3300005563 Bacteria 2681
19 Ga0068855_101276926 3300005563 Bacteria 761
20 Ga0068856_100151001 3300005614 Bacteria 2332
21 Ga0068852_100204616 3300005616 Bacteria 1869
22 Ga0068852_100531211 3300005616 Bacteria 1175
23 Ga0068859_100324814 3300005617 Bacteria 1633
24 Ga0068860_100048399 3300005843 Bacteria 4052
25 Ga0070715_10368021 3300006163 Bacteria 790
26 Ga0070712_100139453 3300006175 Bacteria 1848
27 Ga0070712_100767662 3300006175 Bacteria 826
28 Ga0097620_100324821 3300006931 Bacteria 1633
29 Ga0105240_11269366 3300009093 Bacteria 778
30 Ga0105245_10367541 3300009098 Bacteria 1429
31 Ga0105241_10111432 3300009174 Bacteria 2191
32 Ga0105241_10138361 3300009174 Bacteria 1980
33 Ga0105242_10000010 3300009176 Bacteria 151649
34 Ga0105237_10347679 3300009545 Bacteria 1487
35 Ga0105239_10173051 3300010375 Bacteria 2415
36 Ga0105246_10484996 3300011119 Bacteria 1047
37 Ga0157369_10594761 3300013105 Bacteria 1142
38 Ga0157374_10003476 3300013296 Bacteria 13239
39 Ga0157378_10845034 3300013297 Bacteria 943
40 Ga0163162_10858871 3300013306 Bacteria 1022
41 Ga0163162_10911778 3300013306 Bacteria 991
42 Ga0157372_10562097 3300013307 Bacteria 1330
43 Ga0157375_10463074 3300013308 Bacteria 1433
44 Ga0163163_10304647 3300014325 Bacteria 1646
45 Ga0163163_10358302 3300014325 Bacteria 1515
46 Ga0182008_10144466 3300014497 Bacteria 1191
47 Ga0197907_10172902 3300020069 Bacteria 1745
48 Ga0206355_1260715 3300020076 Bacteria 651
49 Ga0206354_11175435 3300020081 Bacteria 1067
50 Ga0206353_11932501 3300020082 Bacteria 2827
51 Ga0213873_10030698 3300021358 Bacteria 1332
52 Ga0213876_10002247 3300021384 Bacteria 11400
53 Ga0224712_10047138 3300022467 Bacteria 1657
54 Ga0224712_10069471 3300022467 Bacteria 1426
55 Ga0207692_10023452 3300025898 Bacteria 2854
56 Ga0207647_10364658 3300025904 Bacteria 817
57 Ga0207699_10009409 3300025906 Bacteria 4864
58 Ga0207707_10000371 3300025912 Bacteria 47055
59 Ga0207671_10059215 3300025914 Bacteria 2840
60 Ga0207660_10005210 3300025917 Bacteria 8445
61 Ga0207652_10000285 3300025921 Bacteria 52786
62 Ga0207652_10296592 3300025921 Bacteria 1459
63 Ga0207652_11136732 3300025921 Bacteria 682
64 Ga0207646_11080003 3300025922 Bacteria 707
65 Ga0207687_10038278 3300025927 Bacteria 3277
66 Ga0207700_10033460 3300025928 Bacteria 3678
67 Ga0207644_10423052 3300025931 Bacteria 1092
68 Ga0207706_10915755 3300025933 Bacteria 740
69 Ga0207686_10000394 3300025934 Bacteria 30367
70 Ga0207661_10012317 3300025944 Bacteria 6213
71 Ga0207661_10244347 3300025944 Bacteria 1594
72 Ga0207667_10038442 3300025949 Bacteria 5112
73 Ga0207667_10475627 3300025949 Bacteria 1268
74 Ga0207651_10609723 3300025960 Bacteria 955
75 Ga0207668_10798175 3300025972 Bacteria 835
76 Ga0207658_10124625 3300025986 Bacteria 2060
77 Ga0207677_10006135 3300026023 Bacteria 6565
78 Ga0207677_10312423 3300026023 Bacteria 1303
79 Ga0207639_10453993 3300026041 Bacteria 1164
80 Ga0207678_10160289 3300026067 Bacteria 1921
81 Ga0207702_10081811 3300026078 Bacteria 2806
82 Ga0207676_10380984 3300026095 Bacteria 1313
83 Ga0207683_10831276 3300026121 Bacteria 857
84 Ga0207698_10071300 3300026142 Bacteria 2756
85 Ga0207698_10472343 3300026142 Bacteria 1215
86 Ga0268264_11307618 3300028381 Bacteria 735
87 Ga0265323_10009781 3300028653 Bacteria 3903
88 Ga0265322_10002312 3300028654 Bacteria 5907
89 Ga0307517_10446825 3300028786 Unclassified 671
90 Ga0307515_10000005 3300028794 Bacteria 758563
91 Ga0265338_10107416 3300028800 Bacteria 2257
92 Ga0265338_10410637 3300028800 Unclassified 964
93 Ga0307512_10032255 3300030522 Bacteria 4526
94 Ga0265325_10111071 3300031241 Bacteria 1332
95 Ga0265331_10021740 3300031250 Bacteria 3280
96 Ga0265316_10007891 3300031344 Bacteria 9960
97 Ga0307509_10007684 3300031507 Bacteria 14002
98 Ga0307508_10005621 3300031616 Bacteria 11886
99 Ga0307508_10239805 3300031616 Bacteria 1410
100 Ga0265314_10042411 3300031711 Bacteria 3246
101 Ga0307406_10454063 3300031901 Bacteria 1029
102 Ga0307416_100251743 3300032002 Bacteria 1720
103 Ga0307416_101325554 3300032002 Bacteria 826
104 Ga0373923_0059989 3300035111 Bacteria 1614
105 Ga0373936_0316495 3300035113 Bacteria 706
106 Ga0373954_0092118 3300035118 Bacteria 1456
107 Ga0373955_0019699 3300035172 Bacteria 3377
108 Ga0373955_0686651 3300035172 Bacteria 628
109 Ga0373942_0009693 3300035207 Bacteria 2258
110 Ga0316574_0042089 3300035398 Bacteria 2817
111 Ga0373924_0142048 3300035410 Bacteria 1048
112 Ga0373924_0236118 3300035410 Bacteria 808
113 Ga0373935_0019143 3300035692 Bacteria 4174
114 Ga0373933_0061329 3300035724 Bacteria 2269
115 Ga0373933_0316468 3300035724 Bacteria 1011
116 Ga0373937_0372158 3300036401 Bacteria 1354
117 Ga0373937_0524951 3300036401 Bacteria 1125
118 Ga0373937_0538400 3300036401 Bacteria 1109
119 Ga0373937_1000626 3300036401 Unclassified 785
120 Ga0316584_0000992 3300036712 Bacteria 16328
121 Ga0316584_0848587 3300036712 Bacteria 618
122 Ga0395899_0301209 3300037312 Bacteria 1085
123 Ga0436365_1357330 3300039437 Bacteria 64955
124 Ga0436362_0036237 3300039453 Bacteria 2062
125 Ga0436362_0267121 3300039453 Bacteria 1620
126 Ga0451837_1312672 3300041494 Bacteria 785
127 Ga0451853_3506591 3300041512 Bacteria 974
128 Ga0451577_0001166 3300042876 Bacteria 37023
129 Ga0451577_0005053 3300042876 Bacteria 13630
130 Ga0451577_0186261 3300042876 Bacteria 1872
131 Ga0466969_0012437 3300044656 Bacteria 4487
132 Ga0466965_0054781 3300044683 Bacteria 1984
133 Ga0466966_0024843 3300044684 Bacteria 3919
134 Ga0466966_0027765 3300044684 Bacteria 3690
135 Ga0466961_0050008 3300044693 Bacteria 2670
136 Ga0466961_0053190 3300044693 Bacteria 2584
137 Ga0466963_0008689 3300044694 Bacteria 6097
138 Ga0466963_0014420 3300044694 Bacteria 4872
139 Ga0466963_0015014 3300044694 Bacteria 4787
140 Ga0466963_0256700 3300044694 Bacteria 1227
141 Ga0466964_0463594 3300044706 Bacteria 674
142 Ga0453684_0000332 3300044712 Bacteria 197651
143 Ga0453684_0014978 3300044712 Bacteria 12316
144 Ga0466971_0041399 3300044719 Bacteria 2069
145 Ga0466968_0170818 3300044735 Bacteria 1007
146 Ga0466968_0278859 3300044735 Bacteria 799
147 Ga0466970_0007842 3300044765 Bacteria 5361
148 Ga0466970_0241888 3300044765 Bacteria 1010
149 Ga0466957_0045558 3300044842 Unclassified 2660
150 Ga0466957_0078220 3300044842 Bacteria 2056
151 Ga0466957_0375675 3300044842 Bacteria 968
152 Ga0466957_0404344 3300044842 Bacteria 934
153 Ga0466957_0695860 3300044842 Bacteria 717
154 Ga0466957_0899546 3300044842 Bacteria 633
155 Ga0466960_0001503 3300044901 Bacteria 8498
156 Ga0466960_0010218 3300044901 Bacteria 3896
157 Ga0466959_0149568 3300045049 Bacteria 1646
158 Ga0466958_0035393 3300045836 Bacteria 2983
159 Ga0466958_0037297 3300045836 Bacteria 2913
160 Ga0466958_0079210 3300045836 Bacteria 2020
161 Ga0466967_0000302 3300045976 Bacteria 22184
162 Ga0466967_0016006 3300045976 Bacteria 5898
163 Ga0466967_0026146 3300045976 Bacteria 4828
164 Ga0466967_0037868 3300045976 Bacteria 4132
165 Ga0466967_0149752 3300045976 Bacteria 2180
166 Ga0466967_0171684 3300045976 Bacteria 2040
167 Ga0466967_0537956 3300045976 Bacteria 1149
168 Ga0466967_0917116 3300045976 Bacteria 871
169 Ga0495651_0524455 3300046462 Bacteria 755
170 Ga0495653_0040553 3300046463 Bacteria 3638
171 Ga0495650_0032270 3300046471 Bacteria 2344
172 Ga0495662_0096604 3300046476 Bacteria 1444
173 Ga0495664_0391930 3300046477 Bacteria 834
174 Ga0495608_0010219 3300046511 Bacteria 6551
175 Ga0495608_0334472 3300046511 Bacteria 934
176 Ga0495618_0319749 3300046514 Bacteria 961
177 Ga0495632_0077583 3300046519 Bacteria 1588
178 Ga0495666_0038159 3300046526 Bacteria 2337
179 Ga0495640_0208344 3300046533 Bacteria 1237
180 Ga0495586_0270488 3300046535 Bacteria 971
181 Ga0495587_0037975 3300046536 Bacteria 2889
182 Ga0495667_0265705 3300046559 Bacteria 1091
183 Ga0495634_0019638 3300046642 Bacteria 4799
184 Ga0495625_0001443 3300046660 Bacteria 28924
185 Ga0495635_0041398 3300046663 Bacteria 3182
186 Ga0495657_0133365 3300046675 Bacteria 1554
187 Ga0495599_0346800 3300046678 Bacteria 890
188 Ga0495623_0039840 3300046679 Bacteria 3002
189 Ga0495674_0136748 3300047319 Bacteria 2061
190 Ga0495674_0539021 3300047319 Bacteria 930
191 Ga0495680_0118787 3300047322 Bacteria 1953
192 Ga0495684_0017849 3300047471 Bacteria 5466
193 Ga0495602_0408971 3300048088 Bacteria 966
194 Ga0496100_0066015 3300048903 Bacteria 2399
195 Ga0496100_0970272 3300048903 Bacteria 668
196 Ga0496101_0028230 3300048904 Bacteria 3916
197 Ga0496102_0058616 3300048905 Bacteria 3519
198 Ga0496102_1055490 3300048905 Bacteria 732
199 Ga0496104_0051491 3300048907 Bacteria 3886
200 Ga0496105_0048539 3300048908 Bacteria 3504
201 Ga0496105_0116081 3300048908 Bacteria 2208
202 Ga0496105_0583953 3300048908 Bacteria 869
203 Ga0496106_0060424 3300048909 Bacteria 2873
204 Ga0496106_0071593 3300048909 Bacteria 2650
205 Ga0496108_0000102 3300048911 Bacteria 88979
206 Ga0496108_0014505 3300048911 Bacteria 6433
207 Ga0496108_0022727 3300048911 Bacteria 5157
208 Ga0496109_0017790 3300048912 Bacteria 6234
209 Ga0496109_0100117 3300048912 Bacteria 2688
210 Ga0496109_0156934 3300048912 Bacteria 2131
211 Ga0496110_0031949 3300048913 Bacteria 4543
212 Ga0496110_0038190 3300048913 Bacteria 4176
213 Ga0496111_0042924 3300048914 Bacteria 3248
214 Ga0496111_0093675 3300048914 Bacteria 2202
215 Ga0496112_0020445 3300048915 Bacteria 6276
216 Ga0496112_0223411 3300048915 Bacteria 1839
217 Ga0496113_0074321 3300048916 Bacteria 2591
218 Ga0496113_0328045 3300048916 Bacteria 1227
219 Ga0496116_0001616 3300048919 Bacteria 24785
220 Ga0496117_0018368 3300048920 Bacteria 5793
221 Ga0496118_0002400 3300048921 Bacteria 25290
222 Ga0496119_0027397 3300048922 Bacteria 3917
223 Ga0496122_0074098 3300048925 Bacteria 2410
224 Ga0496123_0135164 3300048926 Bacteria 1358
225 Ga0496124_0143565 3300048927 Bacteria 1881
226 Ga0496126_0000235 3300048929 Bacteria 119657
227 Ga0501031_0269103 3300049568 Bacteria 1106
228 Ga0501032_0003315 3300049569 Bacteria 12384
229 Ga0501032_0005450 3300049569 Bacteria 9446
230 Ga0501033_0000066 3300049570 Bacteria 99939
231 Ga0501034_0005381 3300049571 Bacteria 14005
232 Ga0501034_0046484 3300049571 Bacteria 4385
233 Ga0501034_0222849 3300049571 Bacteria 1838
234 Ga0501034_0228596 3300049571 Bacteria 1810
235 Ga0501034_0324545 3300049571 Bacteria 1472
236 Ga0501034_0370883 3300049571 Bacteria 1357
237 Ga0501036_0025196 3300049572 Bacteria 5018
238 Ga0501036_0034402 3300049572 Bacteria 4285
239 Ga0501036_0823004 3300049572 Bacteria 764
240 Ga0501037_0006253 3300049573 Bacteria 8706
241 Ga0501037_0082052 3300049573 Bacteria 2337
242 Ga0501037_0210790 3300049573 Bacteria 1370
243 Ga0501038_0026212 3300049574 Bacteria 5192
244 Ga0501038_0026349 3300049574 Bacteria 5177
245 Ga0501038_0044330 3300049574 Bacteria 3866
246 Ga0501038_0087276 3300049574 Bacteria 2620
247 Ga0501039_0001348 3300049575 Bacteria 17974
248 Ga0501039_0191675 3300049575 Bacteria 1607
249 Ga0501042_0144667 3300049578 Bacteria 1714
250 Ga0501043_0002102 3300049579 Bacteria 17009
251 Ga0501043_0004938 3300049579 Bacteria 10783
252 Ga0501043_0023646 3300049579 Bacteria 4820
253 Ga0501046_0024997 3300049580 Bacteria 4893
254 Ga0501047_0003478 3300049581 Bacteria 14884
255 Ga0501047_0086113 3300049581 Bacteria 3019
256 Ga0501047_0139552 3300049581 Bacteria 2303
257 Ga0501047_0151475 3300049581 Bacteria 2195
258 Ga0501047_0572595 3300049581 Bacteria 953
259 Ga0501048_0003612 3300049582 Bacteria 11784
260 Ga0501048_0058294 3300049582 Bacteria 2737
261 Ga0501067_0148090 3300049583 Bacteria 1308
262 Ga0501070_1030129 3300049586 Bacteria 637
263 Ga0501073_0023739 3300049589 Bacteria 4403
264 Ga0501074_0082764 3300049590 Bacteria 2301
265 Ga0501035_0003036 3300049822 Bacteria 16096
266 Ga0501035_0200460 3300049822 Bacteria 1712
267 Ga0501035_0411302 3300049822 Bacteria 1124
268 Ga0501035_0666390 3300049822 Bacteria 842
269 Ga0501044_0002976 3300049823 Bacteria 19220
270 Ga0501044_0034294 3300049823 Bacteria 5323
271 Ga0501044_0130196 3300049823 Bacteria 2511
272 Ga0501044_0156261 3300049823 Bacteria 2260
273 Ga0501044_0225275 3300049823 Bacteria 1824
274 Ga0501045_0000763 3300049824 Bacteria 20622
275 Ga0495601_0037351 3300053077 Bacteria 3036
276 Ga0495612_0037883 3300053078 Bacteria 1959
277 Ga0466962_0020927 3300061719 Bacteria 3143
278 Ga0466962_0059038 3300061719 Bacteria 1831
279 2734973298 2734482000 Bacteria 5525167
280 2795784805 2795385470 Bacteria 8317180
281 2887484174 2887478801 Bacteria 8972725
282 Ga0265334_10002985
283 Ga0058863_11895587
284 Ga0070683_100028186
285 Ga0070680_100000290
286 Ga0068868_100208933
287 Ga0070689_100764202
288 Ga0070668_100026057
289 Ga0070667_100070433
290 Ga0070667_100103269
291 Ga0070709_10002744
292 Ga0070710_10016050
293 Ga0070681_10000060
294 Ga0070707_101265180
295 Ga0070679_100000048
296 Ga0070684_101086341
297 Ga0070665_100662990
298 Ga0068855_100013946
299 Ga0068855_100147084
300 Ga0068855_101276926
301 Ga0068856_100151001
302 Ga0068852_100204616
303 Ga0068852_100531211
304 Ga0068859_100324814
305 Ga0068860_100048399
306 Ga0070715_10368021
307 Ga0070712_100139453
308 Ga0070712_100767662
309 Ga0097620_100324821
310 Ga0105240_11269366
311 Ga0105245_10367541
312 Ga0105241_10111432
313 Ga0105241_10138361
314 Ga0105242_10000010
315 Ga0105237_10347679
316 Ga0105239_10173051
317 Ga0105246_10484996
318 Ga0157369_10594761
319 Ga0157374_10003476
320 Ga0157378_10845034
321 Ga0163162_10858871
322 Ga0163162_10911778
323 Ga0157372_10562097
324 Ga0157375_10463074
325 Ga0163163_10304647
326 Ga0163163_10358302
327 Ga0182008_10144466
328 Ga0197907_10172902
329 Ga0206355_1260715
330 Ga0206354_11175435
331 Ga0206353_11932501
332 Ga0213873_10030698
333 Ga0213876_10002247
334 Ga0224712_10047138
335 Ga0224712_10069471
336 Ga0207692_10023452
337 Ga0207647_10364658
338 Ga0207699_10009409
339 Ga0207707_10000371
340 Ga0207671_10059215
341 Ga0207660_10005210
342 Ga0207652_10000285
343 Ga0207652_10296592
344 Ga0207652_11136732
345 Ga0207646_11080003
346 Ga0207687_10038278
347 Ga0207700_10033460
348 Ga0207644_10423052
349 Ga0207706_10915755
350 Ga0207686_10000394
351 Ga0207661_10012317
352 Ga0207661_10244347
353 Ga0207667_10038442
354 Ga0207667_10475627
355 Ga0207651_10609723
356 Ga0207668_10798175
357 Ga0207658_10124625
358 Ga0207677_10006135
359 Ga0207677_10312423
360 Ga0207639_10453993
361 Ga0207678_10160289
362 Ga0207702_10081811
363 Ga0207676_10380984
364 Ga0207683_10831276
365 Ga0207698_10071300
366 Ga0207698_10472343
367 Ga0268264_11307618
368 Ga0265323_10009781
369 Ga0265322_10002312
370 Ga0307517_10446825
371 Ga0307515_10000005
372 Ga0265338_10107416
373 Ga0265338_10410637
374 Ga0307512_10032255
375 Ga0265325_10111071
376 Ga0265331_10021740
377 Ga0265316_10007891
378 Ga0307509_10007684
379 Ga0307508_10005621
380 Ga0307508_10239805
381 Ga0265314_10042411
382 Ga0307406_10454063
383 Ga0307416_100251743
384 Ga0307416_101325554
385 Ga0373923_0059989
386 Ga0373936_0316495
387 Ga0373954_0092118
388 Ga0373955_0019699
389 Ga0373955_0686651
390 Ga0373942_0009693
391 Ga0316574_0042089
392 Ga0373924_0142048
393 Ga0373924_0236118
394 Ga0373935_0019143
395 Ga0373933_0061329
396 Ga0373933_0316468
397 Ga0373937_0372158
398 Ga0373937_0524951
399 Ga0373937_0538400
400 Ga0373937_1000626
401 Ga0316584_0000992
402 Ga0316584_0848587
403 Ga0395899_0301209
404 Ga0436365_1357330
405 Ga0436362_0036237
406 Ga0436362_0267121
407 Ga0451837_1312672
408 Ga0451853_3506591
409 Ga0451577_0001166
410 Ga0451577_0005053
411 Ga0451577_0186261
412 Ga0466969_0012437
413 Ga0466965_0054781
414 Ga0466966_0024843
415 Ga0466966_0027765
416 Ga0466961_0050008
417 Ga0466961_0053190
418 Ga0466963_0008689
419 Ga0466963_0014420
420 Ga0466963_0015014
421 Ga0466963_0256700
422 Ga0466964_0463594
423 Ga0453684_0000332
424 Ga0453684_0014978
425 Ga0466971_0041399
426 Ga0466968_0170818
427 Ga0466968_0278859
428 Ga0466970_0007842
429 Ga0466970_0241888
430 Ga0466957_0045558
431 Ga0466957_0078220
432 Ga0466957_0375675
433 Ga0466957_0404344
434 Ga0466957_0695860
435 Ga0466957_0899546
436 Ga0466960_0001503
437 Ga0466960_0010218
438 Ga0466959_0149568
439 Ga0466958_0035393
440 Ga0466958_0037297
441 Ga0466958_0079210
442 Ga0466967_0000302
443 Ga0466967_0016006
444 Ga0466967_0026146
445 Ga0466967_0037868
446 Ga0466967_0149752
447 Ga0466967_0171684
448 Ga0466967_0537956
449 Ga0466967_0917116
450 Ga0495651_0524455
451 Ga0495653_0040553
452 Ga0495650_0032270
453 Ga0495662_0096604
454 Ga0495664_0391930
455 Ga0495608_0010219
456 Ga0495608_0334472
457 Ga0495618_0319749
458 Ga0495632_0077583
459 Ga0495666_0038159
460 Ga0495640_0208344
461 Ga0495586_0270488
462 Ga0495587_0037975
463 Ga0495667_0265705
464 Ga0495634_0019638
465 Ga0495625_0001443
466 Ga0495635_0041398
467 Ga0495657_0133365
468 Ga0495599_0346800
469 Ga0495623_0039840
470 Ga0495674_0136748
471 Ga0495674_0539021
472 Ga0495680_0118787
473 Ga0495684_0017849
474 Ga0495602_0408971
475 Ga0496100_0066015
476 Ga0496100_0970272
477 Ga0496101_0028230
478 Ga0496102_0058616
479 Ga0496102_1055490
480 Ga0496104_0051491
481 Ga0496105_0048539
482 Ga0496105_0116081
483 Ga0496105_0583953
484 Ga0496106_0060424
485 Ga0496106_0071593
486 Ga0496108_0000102
487 Ga0496108_0014505
488 Ga0496108_0022727
489 Ga0496109_0017790
490 Ga0496109_0100117
491 Ga0496109_0156934
492 Ga0496110_0031949
493 Ga0496110_0038190
494 Ga0496111_0042924
495 Ga0496111_0093675
496 Ga0496112_0020445
497 Ga0496112_0223411
498 Ga0496113_0074321
499 Ga0496113_0328045
500 Ga0496116_0001616
501 Ga0496117_0018368
502 Ga0496118_0002400
503 Ga0496119_0027397
504 Ga0496122_0074098
505 Ga0496123_0135164
506 Ga0496124_0143565
507 Ga0496126_0000235
508 Ga0501031_0269103
509 Ga0501032_0003315
510 Ga0501032_0005450
511 Ga0501033_0000066
512 Ga0501034_0005381
513 Ga0501034_0046484
514 Ga0501034_0222849
515 Ga0501034_0228596
516 Ga0501034_0324545
517 Ga0501034_0370883
518 Ga0501036_0025196
519 Ga0501036_0034402
520 Ga0501036_0823004
521 Ga0501037_0006253
522 Ga0501037_0082052
523 Ga0501037_0210790
524 Ga0501038_0026212
525 Ga0501038_0026349
526 Ga0501038_0044330
527 Ga0501038_0087276
528 Ga0501039_0001348
529 Ga0501039_0191675
530 Ga0501042_0144667
531 Ga0501043_0002102
532 Ga0501043_0004938
533 Ga0501043_0023646
534 Ga0501046_0024997
535 Ga0501047_0003478
536 Ga0501047_0086113
537 Ga0501047_0139552
538 Ga0501047_0151475
539 Ga0501047_0572595
540 Ga0501048_0003612
541 Ga0501048_0058294
542 Ga0501067_0148090
543 Ga0501070_1030129
544 Ga0501073_0023739
545 Ga0501074_0082764
546 Ga0501035_0003036
547 Ga0501035_0200460
548 Ga0501035_0411302
549 Ga0501035_0666390
550 Ga0501044_0002976
551 Ga0501044_0034294
552 Ga0501044_0130196
553 Ga0501044_0156261
554 Ga0501044_0225275
555 Ga0501045_0000763
556 Ga0495601_0037351
557 Ga0495612_0037883
558 Ga0466962_0020927
559 Ga0466962_0059038
560 2734973298
561 2795784805
562 2887484174

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

4

152

0.94

PF02525

Flavodoxin_2

Flavodoxin-like fold

5

139

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.852 2 180
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8498 4 179
7f76-assembly1.cif.gz_A crystal structure of fmn-dependent nadph-quinone reductase (azor) from bacillus cohnii 0.8491 1 179
6dgi-assembly1.cif.gz_A-2 the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961 0.8463 2 40
6dgi-assembly1.cif.gz_B the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961 0.8453 2 40
ID Description Score Start End Superfamily
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8931 3 164 3.40.50.360
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8726 3 164 3.40.50.360
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8664 3 170 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8585 1 180 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8453 1 180 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2T2WGI2-F1-model_v4 NADPH-dependent FMN reductase 0.9965 2 184 GO:0005829
GO:0010181
GO:0016491
AF-J2J4H9-F1-model_v4 NADPH-dependent FMN reductase family protein 0.9949 36 184 GO:0005829
GO:0010181
GO:0016491
AF-A0A4Q3VYL5-F1-model_v4 NADPH-dependent oxidoreductase 0.9946 39 184 GO:0005829
GO:0010181
GO:0016491
AF-A0A4R7E4G8-F1-model_v4 deleted 0.9935 2 185
AF-A0A318A0M7-F1-model_v4 NADPH-dependent FMN reductase 0.9934 1 176 GO:0005829
GO:0010181
GO:0016491

Map