F384367
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 186 | 562 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300028573|Ga0265334_10002985|Ga0265334_100029852 |
| Length | 207 |
| Sequence | MHKPILTIVIGSTRPGRVGPKFAEWFRTRAEAHGGFHIDLVDLAELNLPLLDEPNHPRLRQYTHQHTLDWSRTVDRSDAFVFVMPEYNFGYNAALKNAIDYLSQEWADKAVGFVSYGGVAAGTRAVQQLKQVVTALKMIPVAESVNIPFFSQFIDASGVVQPNEVMTRAADAMLDELARVTALIRPNATASAASEEAAEAEPGVLFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 21 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 39 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 41 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 43 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 44 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 45 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 73 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 75 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 76 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 78 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 79 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 80 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 81 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 82 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 83 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 85 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 86 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 87 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 88 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 89 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 90 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 91 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 92 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 93 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 94 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 95 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 99 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 100 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 101 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 102 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 103 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 104 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 105 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 106 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 107 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 108 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 109 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 112 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 154 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 155 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 158 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 184 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 185 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 186 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.44 |
| Metatranscriptomes | 2.49 |
| Isolates | 1.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.9 |
| Rhizosphere | 84.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265334_10002985 | 3300028573 | Bacteria | 7736 |
| 2 | Ga0058863_11895587 | 3300004799 | Bacteria | 1858 |
| 3 | Ga0070683_100028186 | 3300005329 | Bacteria | 5074 |
| 4 | Ga0070680_100000290 | 3300005336 | Bacteria | 33584 |
| 5 | Ga0068868_100208933 | 3300005338 | Bacteria | 1631 |
| 6 | Ga0070689_100764202 | 3300005340 | Bacteria | 848 |
| 7 | Ga0070668_100026057 | 3300005347 | Bacteria | 4434 |
| 8 | Ga0070667_100070433 | 3300005367 | Bacteria | 2976 |
| 9 | Ga0070667_100103269 | 3300005367 | Bacteria | 2464 |
| 10 | Ga0070709_10002744 | 3300005434 | Bacteria | 9527 |
| 11 | Ga0070710_10016050 | 3300005437 | Bacteria | 3802 |
| 12 | Ga0070681_10000060 | 3300005458 | Bacteria | 78566 |
| 13 | Ga0070707_101265180 | 3300005468 | Bacteria | 704 |
| 14 | Ga0070679_100000048 | 3300005530 | Bacteria | 89533 |
| 15 | Ga0070684_101086341 | 3300005535 | Bacteria | 752 |
| 16 | Ga0070665_100662990 | 3300005548 | Bacteria | 1056 |
| 17 | Ga0068855_100013946 | 3300005563 | Bacteria | 9692 |
| 18 | Ga0068855_100147084 | 3300005563 | Bacteria | 2681 |
| 19 | Ga0068855_101276926 | 3300005563 | Bacteria | 761 |
| 20 | Ga0068856_100151001 | 3300005614 | Bacteria | 2332 |
| 21 | Ga0068852_100204616 | 3300005616 | Bacteria | 1869 |
| 22 | Ga0068852_100531211 | 3300005616 | Bacteria | 1175 |
| 23 | Ga0068859_100324814 | 3300005617 | Bacteria | 1633 |
| 24 | Ga0068860_100048399 | 3300005843 | Bacteria | 4052 |
| 25 | Ga0070715_10368021 | 3300006163 | Bacteria | 790 |
| 26 | Ga0070712_100139453 | 3300006175 | Bacteria | 1848 |
| 27 | Ga0070712_100767662 | 3300006175 | Bacteria | 826 |
| 28 | Ga0097620_100324821 | 3300006931 | Bacteria | 1633 |
| 29 | Ga0105240_11269366 | 3300009093 | Bacteria | 778 |
| 30 | Ga0105245_10367541 | 3300009098 | Bacteria | 1429 |
| 31 | Ga0105241_10111432 | 3300009174 | Bacteria | 2191 |
| 32 | Ga0105241_10138361 | 3300009174 | Bacteria | 1980 |
| 33 | Ga0105242_10000010 | 3300009176 | Bacteria | 151649 |
| 34 | Ga0105237_10347679 | 3300009545 | Bacteria | 1487 |
| 35 | Ga0105239_10173051 | 3300010375 | Bacteria | 2415 |
| 36 | Ga0105246_10484996 | 3300011119 | Bacteria | 1047 |
| 37 | Ga0157369_10594761 | 3300013105 | Bacteria | 1142 |
| 38 | Ga0157374_10003476 | 3300013296 | Bacteria | 13239 |
| 39 | Ga0157378_10845034 | 3300013297 | Bacteria | 943 |
| 40 | Ga0163162_10858871 | 3300013306 | Bacteria | 1022 |
| 41 | Ga0163162_10911778 | 3300013306 | Bacteria | 991 |
| 42 | Ga0157372_10562097 | 3300013307 | Bacteria | 1330 |
| 43 | Ga0157375_10463074 | 3300013308 | Bacteria | 1433 |
| 44 | Ga0163163_10304647 | 3300014325 | Bacteria | 1646 |
| 45 | Ga0163163_10358302 | 3300014325 | Bacteria | 1515 |
| 46 | Ga0182008_10144466 | 3300014497 | Bacteria | 1191 |
| 47 | Ga0197907_10172902 | 3300020069 | Bacteria | 1745 |
| 48 | Ga0206355_1260715 | 3300020076 | Bacteria | 651 |
| 49 | Ga0206354_11175435 | 3300020081 | Bacteria | 1067 |
| 50 | Ga0206353_11932501 | 3300020082 | Bacteria | 2827 |
| 51 | Ga0213873_10030698 | 3300021358 | Bacteria | 1332 |
| 52 | Ga0213876_10002247 | 3300021384 | Bacteria | 11400 |
| 53 | Ga0224712_10047138 | 3300022467 | Bacteria | 1657 |
| 54 | Ga0224712_10069471 | 3300022467 | Bacteria | 1426 |
| 55 | Ga0207692_10023452 | 3300025898 | Bacteria | 2854 |
| 56 | Ga0207647_10364658 | 3300025904 | Bacteria | 817 |
| 57 | Ga0207699_10009409 | 3300025906 | Bacteria | 4864 |
| 58 | Ga0207707_10000371 | 3300025912 | Bacteria | 47055 |
| 59 | Ga0207671_10059215 | 3300025914 | Bacteria | 2840 |
| 60 | Ga0207660_10005210 | 3300025917 | Bacteria | 8445 |
| 61 | Ga0207652_10000285 | 3300025921 | Bacteria | 52786 |
| 62 | Ga0207652_10296592 | 3300025921 | Bacteria | 1459 |
| 63 | Ga0207652_11136732 | 3300025921 | Bacteria | 682 |
| 64 | Ga0207646_11080003 | 3300025922 | Bacteria | 707 |
| 65 | Ga0207687_10038278 | 3300025927 | Bacteria | 3277 |
| 66 | Ga0207700_10033460 | 3300025928 | Bacteria | 3678 |
| 67 | Ga0207644_10423052 | 3300025931 | Bacteria | 1092 |
| 68 | Ga0207706_10915755 | 3300025933 | Bacteria | 740 |
| 69 | Ga0207686_10000394 | 3300025934 | Bacteria | 30367 |
| 70 | Ga0207661_10012317 | 3300025944 | Bacteria | 6213 |
| 71 | Ga0207661_10244347 | 3300025944 | Bacteria | 1594 |
| 72 | Ga0207667_10038442 | 3300025949 | Bacteria | 5112 |
| 73 | Ga0207667_10475627 | 3300025949 | Bacteria | 1268 |
| 74 | Ga0207651_10609723 | 3300025960 | Bacteria | 955 |
| 75 | Ga0207668_10798175 | 3300025972 | Bacteria | 835 |
| 76 | Ga0207658_10124625 | 3300025986 | Bacteria | 2060 |
| 77 | Ga0207677_10006135 | 3300026023 | Bacteria | 6565 |
| 78 | Ga0207677_10312423 | 3300026023 | Bacteria | 1303 |
| 79 | Ga0207639_10453993 | 3300026041 | Bacteria | 1164 |
| 80 | Ga0207678_10160289 | 3300026067 | Bacteria | 1921 |
| 81 | Ga0207702_10081811 | 3300026078 | Bacteria | 2806 |
| 82 | Ga0207676_10380984 | 3300026095 | Bacteria | 1313 |
| 83 | Ga0207683_10831276 | 3300026121 | Bacteria | 857 |
| 84 | Ga0207698_10071300 | 3300026142 | Bacteria | 2756 |
| 85 | Ga0207698_10472343 | 3300026142 | Bacteria | 1215 |
| 86 | Ga0268264_11307618 | 3300028381 | Bacteria | 735 |
| 87 | Ga0265323_10009781 | 3300028653 | Bacteria | 3903 |
| 88 | Ga0265322_10002312 | 3300028654 | Bacteria | 5907 |
| 89 | Ga0307517_10446825 | 3300028786 | Unclassified | 671 |
| 90 | Ga0307515_10000005 | 3300028794 | Bacteria | 758563 |
| 91 | Ga0265338_10107416 | 3300028800 | Bacteria | 2257 |
| 92 | Ga0265338_10410637 | 3300028800 | Unclassified | 964 |
| 93 | Ga0307512_10032255 | 3300030522 | Bacteria | 4526 |
| 94 | Ga0265325_10111071 | 3300031241 | Bacteria | 1332 |
| 95 | Ga0265331_10021740 | 3300031250 | Bacteria | 3280 |
| 96 | Ga0265316_10007891 | 3300031344 | Bacteria | 9960 |
| 97 | Ga0307509_10007684 | 3300031507 | Bacteria | 14002 |
| 98 | Ga0307508_10005621 | 3300031616 | Bacteria | 11886 |
| 99 | Ga0307508_10239805 | 3300031616 | Bacteria | 1410 |
| 100 | Ga0265314_10042411 | 3300031711 | Bacteria | 3246 |
| 101 | Ga0307406_10454063 | 3300031901 | Bacteria | 1029 |
| 102 | Ga0307416_100251743 | 3300032002 | Bacteria | 1720 |
| 103 | Ga0307416_101325554 | 3300032002 | Bacteria | 826 |
| 104 | Ga0373923_0059989 | 3300035111 | Bacteria | 1614 |
| 105 | Ga0373936_0316495 | 3300035113 | Bacteria | 706 |
| 106 | Ga0373954_0092118 | 3300035118 | Bacteria | 1456 |
| 107 | Ga0373955_0019699 | 3300035172 | Bacteria | 3377 |
| 108 | Ga0373955_0686651 | 3300035172 | Bacteria | 628 |
| 109 | Ga0373942_0009693 | 3300035207 | Bacteria | 2258 |
| 110 | Ga0316574_0042089 | 3300035398 | Bacteria | 2817 |
| 111 | Ga0373924_0142048 | 3300035410 | Bacteria | 1048 |
| 112 | Ga0373924_0236118 | 3300035410 | Bacteria | 808 |
| 113 | Ga0373935_0019143 | 3300035692 | Bacteria | 4174 |
| 114 | Ga0373933_0061329 | 3300035724 | Bacteria | 2269 |
| 115 | Ga0373933_0316468 | 3300035724 | Bacteria | 1011 |
| 116 | Ga0373937_0372158 | 3300036401 | Bacteria | 1354 |
| 117 | Ga0373937_0524951 | 3300036401 | Bacteria | 1125 |
| 118 | Ga0373937_0538400 | 3300036401 | Bacteria | 1109 |
| 119 | Ga0373937_1000626 | 3300036401 | Unclassified | 785 |
| 120 | Ga0316584_0000992 | 3300036712 | Bacteria | 16328 |
| 121 | Ga0316584_0848587 | 3300036712 | Bacteria | 618 |
| 122 | Ga0395899_0301209 | 3300037312 | Bacteria | 1085 |
| 123 | Ga0436365_1357330 | 3300039437 | Bacteria | 64955 |
| 124 | Ga0436362_0036237 | 3300039453 | Bacteria | 2062 |
| 125 | Ga0436362_0267121 | 3300039453 | Bacteria | 1620 |
| 126 | Ga0451837_1312672 | 3300041494 | Bacteria | 785 |
| 127 | Ga0451853_3506591 | 3300041512 | Bacteria | 974 |
| 128 | Ga0451577_0001166 | 3300042876 | Bacteria | 37023 |
| 129 | Ga0451577_0005053 | 3300042876 | Bacteria | 13630 |
| 130 | Ga0451577_0186261 | 3300042876 | Bacteria | 1872 |
| 131 | Ga0466969_0012437 | 3300044656 | Bacteria | 4487 |
| 132 | Ga0466965_0054781 | 3300044683 | Bacteria | 1984 |
| 133 | Ga0466966_0024843 | 3300044684 | Bacteria | 3919 |
| 134 | Ga0466966_0027765 | 3300044684 | Bacteria | 3690 |
| 135 | Ga0466961_0050008 | 3300044693 | Bacteria | 2670 |
| 136 | Ga0466961_0053190 | 3300044693 | Bacteria | 2584 |
| 137 | Ga0466963_0008689 | 3300044694 | Bacteria | 6097 |
| 138 | Ga0466963_0014420 | 3300044694 | Bacteria | 4872 |
| 139 | Ga0466963_0015014 | 3300044694 | Bacteria | 4787 |
| 140 | Ga0466963_0256700 | 3300044694 | Bacteria | 1227 |
| 141 | Ga0466964_0463594 | 3300044706 | Bacteria | 674 |
| 142 | Ga0453684_0000332 | 3300044712 | Bacteria | 197651 |
| 143 | Ga0453684_0014978 | 3300044712 | Bacteria | 12316 |
| 144 | Ga0466971_0041399 | 3300044719 | Bacteria | 2069 |
| 145 | Ga0466968_0170818 | 3300044735 | Bacteria | 1007 |
| 146 | Ga0466968_0278859 | 3300044735 | Bacteria | 799 |
| 147 | Ga0466970_0007842 | 3300044765 | Bacteria | 5361 |
| 148 | Ga0466970_0241888 | 3300044765 | Bacteria | 1010 |
| 149 | Ga0466957_0045558 | 3300044842 | Unclassified | 2660 |
| 150 | Ga0466957_0078220 | 3300044842 | Bacteria | 2056 |
| 151 | Ga0466957_0375675 | 3300044842 | Bacteria | 968 |
| 152 | Ga0466957_0404344 | 3300044842 | Bacteria | 934 |
| 153 | Ga0466957_0695860 | 3300044842 | Bacteria | 717 |
| 154 | Ga0466957_0899546 | 3300044842 | Bacteria | 633 |
| 155 | Ga0466960_0001503 | 3300044901 | Bacteria | 8498 |
| 156 | Ga0466960_0010218 | 3300044901 | Bacteria | 3896 |
| 157 | Ga0466959_0149568 | 3300045049 | Bacteria | 1646 |
| 158 | Ga0466958_0035393 | 3300045836 | Bacteria | 2983 |
| 159 | Ga0466958_0037297 | 3300045836 | Bacteria | 2913 |
| 160 | Ga0466958_0079210 | 3300045836 | Bacteria | 2020 |
| 161 | Ga0466967_0000302 | 3300045976 | Bacteria | 22184 |
| 162 | Ga0466967_0016006 | 3300045976 | Bacteria | 5898 |
| 163 | Ga0466967_0026146 | 3300045976 | Bacteria | 4828 |
| 164 | Ga0466967_0037868 | 3300045976 | Bacteria | 4132 |
| 165 | Ga0466967_0149752 | 3300045976 | Bacteria | 2180 |
| 166 | Ga0466967_0171684 | 3300045976 | Bacteria | 2040 |
| 167 | Ga0466967_0537956 | 3300045976 | Bacteria | 1149 |
| 168 | Ga0466967_0917116 | 3300045976 | Bacteria | 871 |
| 169 | Ga0495651_0524455 | 3300046462 | Bacteria | 755 |
| 170 | Ga0495653_0040553 | 3300046463 | Bacteria | 3638 |
| 171 | Ga0495650_0032270 | 3300046471 | Bacteria | 2344 |
| 172 | Ga0495662_0096604 | 3300046476 | Bacteria | 1444 |
| 173 | Ga0495664_0391930 | 3300046477 | Bacteria | 834 |
| 174 | Ga0495608_0010219 | 3300046511 | Bacteria | 6551 |
| 175 | Ga0495608_0334472 | 3300046511 | Bacteria | 934 |
| 176 | Ga0495618_0319749 | 3300046514 | Bacteria | 961 |
| 177 | Ga0495632_0077583 | 3300046519 | Bacteria | 1588 |
| 178 | Ga0495666_0038159 | 3300046526 | Bacteria | 2337 |
| 179 | Ga0495640_0208344 | 3300046533 | Bacteria | 1237 |
| 180 | Ga0495586_0270488 | 3300046535 | Bacteria | 971 |
| 181 | Ga0495587_0037975 | 3300046536 | Bacteria | 2889 |
| 182 | Ga0495667_0265705 | 3300046559 | Bacteria | 1091 |
| 183 | Ga0495634_0019638 | 3300046642 | Bacteria | 4799 |
| 184 | Ga0495625_0001443 | 3300046660 | Bacteria | 28924 |
| 185 | Ga0495635_0041398 | 3300046663 | Bacteria | 3182 |
| 186 | Ga0495657_0133365 | 3300046675 | Bacteria | 1554 |
| 187 | Ga0495599_0346800 | 3300046678 | Bacteria | 890 |
| 188 | Ga0495623_0039840 | 3300046679 | Bacteria | 3002 |
| 189 | Ga0495674_0136748 | 3300047319 | Bacteria | 2061 |
| 190 | Ga0495674_0539021 | 3300047319 | Bacteria | 930 |
| 191 | Ga0495680_0118787 | 3300047322 | Bacteria | 1953 |
| 192 | Ga0495684_0017849 | 3300047471 | Bacteria | 5466 |
| 193 | Ga0495602_0408971 | 3300048088 | Bacteria | 966 |
| 194 | Ga0496100_0066015 | 3300048903 | Bacteria | 2399 |
| 195 | Ga0496100_0970272 | 3300048903 | Bacteria | 668 |
| 196 | Ga0496101_0028230 | 3300048904 | Bacteria | 3916 |
| 197 | Ga0496102_0058616 | 3300048905 | Bacteria | 3519 |
| 198 | Ga0496102_1055490 | 3300048905 | Bacteria | 732 |
| 199 | Ga0496104_0051491 | 3300048907 | Bacteria | 3886 |
| 200 | Ga0496105_0048539 | 3300048908 | Bacteria | 3504 |
| 201 | Ga0496105_0116081 | 3300048908 | Bacteria | 2208 |
| 202 | Ga0496105_0583953 | 3300048908 | Bacteria | 869 |
| 203 | Ga0496106_0060424 | 3300048909 | Bacteria | 2873 |
| 204 | Ga0496106_0071593 | 3300048909 | Bacteria | 2650 |
| 205 | Ga0496108_0000102 | 3300048911 | Bacteria | 88979 |
| 206 | Ga0496108_0014505 | 3300048911 | Bacteria | 6433 |
| 207 | Ga0496108_0022727 | 3300048911 | Bacteria | 5157 |
| 208 | Ga0496109_0017790 | 3300048912 | Bacteria | 6234 |
| 209 | Ga0496109_0100117 | 3300048912 | Bacteria | 2688 |
| 210 | Ga0496109_0156934 | 3300048912 | Bacteria | 2131 |
| 211 | Ga0496110_0031949 | 3300048913 | Bacteria | 4543 |
| 212 | Ga0496110_0038190 | 3300048913 | Bacteria | 4176 |
| 213 | Ga0496111_0042924 | 3300048914 | Bacteria | 3248 |
| 214 | Ga0496111_0093675 | 3300048914 | Bacteria | 2202 |
| 215 | Ga0496112_0020445 | 3300048915 | Bacteria | 6276 |
| 216 | Ga0496112_0223411 | 3300048915 | Bacteria | 1839 |
| 217 | Ga0496113_0074321 | 3300048916 | Bacteria | 2591 |
| 218 | Ga0496113_0328045 | 3300048916 | Bacteria | 1227 |
| 219 | Ga0496116_0001616 | 3300048919 | Bacteria | 24785 |
| 220 | Ga0496117_0018368 | 3300048920 | Bacteria | 5793 |
| 221 | Ga0496118_0002400 | 3300048921 | Bacteria | 25290 |
| 222 | Ga0496119_0027397 | 3300048922 | Bacteria | 3917 |
| 223 | Ga0496122_0074098 | 3300048925 | Bacteria | 2410 |
| 224 | Ga0496123_0135164 | 3300048926 | Bacteria | 1358 |
| 225 | Ga0496124_0143565 | 3300048927 | Bacteria | 1881 |
| 226 | Ga0496126_0000235 | 3300048929 | Bacteria | 119657 |
| 227 | Ga0501031_0269103 | 3300049568 | Bacteria | 1106 |
| 228 | Ga0501032_0003315 | 3300049569 | Bacteria | 12384 |
| 229 | Ga0501032_0005450 | 3300049569 | Bacteria | 9446 |
| 230 | Ga0501033_0000066 | 3300049570 | Bacteria | 99939 |
| 231 | Ga0501034_0005381 | 3300049571 | Bacteria | 14005 |
| 232 | Ga0501034_0046484 | 3300049571 | Bacteria | 4385 |
| 233 | Ga0501034_0222849 | 3300049571 | Bacteria | 1838 |
| 234 | Ga0501034_0228596 | 3300049571 | Bacteria | 1810 |
| 235 | Ga0501034_0324545 | 3300049571 | Bacteria | 1472 |
| 236 | Ga0501034_0370883 | 3300049571 | Bacteria | 1357 |
| 237 | Ga0501036_0025196 | 3300049572 | Bacteria | 5018 |
| 238 | Ga0501036_0034402 | 3300049572 | Bacteria | 4285 |
| 239 | Ga0501036_0823004 | 3300049572 | Bacteria | 764 |
| 240 | Ga0501037_0006253 | 3300049573 | Bacteria | 8706 |
| 241 | Ga0501037_0082052 | 3300049573 | Bacteria | 2337 |
| 242 | Ga0501037_0210790 | 3300049573 | Bacteria | 1370 |
| 243 | Ga0501038_0026212 | 3300049574 | Bacteria | 5192 |
| 244 | Ga0501038_0026349 | 3300049574 | Bacteria | 5177 |
| 245 | Ga0501038_0044330 | 3300049574 | Bacteria | 3866 |
| 246 | Ga0501038_0087276 | 3300049574 | Bacteria | 2620 |
| 247 | Ga0501039_0001348 | 3300049575 | Bacteria | 17974 |
| 248 | Ga0501039_0191675 | 3300049575 | Bacteria | 1607 |
| 249 | Ga0501042_0144667 | 3300049578 | Bacteria | 1714 |
| 250 | Ga0501043_0002102 | 3300049579 | Bacteria | 17009 |
| 251 | Ga0501043_0004938 | 3300049579 | Bacteria | 10783 |
| 252 | Ga0501043_0023646 | 3300049579 | Bacteria | 4820 |
| 253 | Ga0501046_0024997 | 3300049580 | Bacteria | 4893 |
| 254 | Ga0501047_0003478 | 3300049581 | Bacteria | 14884 |
| 255 | Ga0501047_0086113 | 3300049581 | Bacteria | 3019 |
| 256 | Ga0501047_0139552 | 3300049581 | Bacteria | 2303 |
| 257 | Ga0501047_0151475 | 3300049581 | Bacteria | 2195 |
| 258 | Ga0501047_0572595 | 3300049581 | Bacteria | 953 |
| 259 | Ga0501048_0003612 | 3300049582 | Bacteria | 11784 |
| 260 | Ga0501048_0058294 | 3300049582 | Bacteria | 2737 |
| 261 | Ga0501067_0148090 | 3300049583 | Bacteria | 1308 |
| 262 | Ga0501070_1030129 | 3300049586 | Bacteria | 637 |
| 263 | Ga0501073_0023739 | 3300049589 | Bacteria | 4403 |
| 264 | Ga0501074_0082764 | 3300049590 | Bacteria | 2301 |
| 265 | Ga0501035_0003036 | 3300049822 | Bacteria | 16096 |
| 266 | Ga0501035_0200460 | 3300049822 | Bacteria | 1712 |
| 267 | Ga0501035_0411302 | 3300049822 | Bacteria | 1124 |
| 268 | Ga0501035_0666390 | 3300049822 | Bacteria | 842 |
| 269 | Ga0501044_0002976 | 3300049823 | Bacteria | 19220 |
| 270 | Ga0501044_0034294 | 3300049823 | Bacteria | 5323 |
| 271 | Ga0501044_0130196 | 3300049823 | Bacteria | 2511 |
| 272 | Ga0501044_0156261 | 3300049823 | Bacteria | 2260 |
| 273 | Ga0501044_0225275 | 3300049823 | Bacteria | 1824 |
| 274 | Ga0501045_0000763 | 3300049824 | Bacteria | 20622 |
| 275 | Ga0495601_0037351 | 3300053077 | Bacteria | 3036 |
| 276 | Ga0495612_0037883 | 3300053078 | Bacteria | 1959 |
| 277 | Ga0466962_0020927 | 3300061719 | Bacteria | 3143 |
| 278 | Ga0466962_0059038 | 3300061719 | Bacteria | 1831 |
| 279 | 2734973298 | 2734482000 | Bacteria | 5525167 |
| 280 | 2795784805 | 2795385470 | Bacteria | 8317180 |
| 281 | 2887484174 | 2887478801 | Bacteria | 8972725 |
| 282 | Ga0265334_10002985 | |||
| 283 | Ga0058863_11895587 | |||
| 284 | Ga0070683_100028186 | |||
| 285 | Ga0070680_100000290 | |||
| 286 | Ga0068868_100208933 | |||
| 287 | Ga0070689_100764202 | |||
| 288 | Ga0070668_100026057 | |||
| 289 | Ga0070667_100070433 | |||
| 290 | Ga0070667_100103269 | |||
| 291 | Ga0070709_10002744 | |||
| 292 | Ga0070710_10016050 | |||
| 293 | Ga0070681_10000060 | |||
| 294 | Ga0070707_101265180 | |||
| 295 | Ga0070679_100000048 | |||
| 296 | Ga0070684_101086341 | |||
| 297 | Ga0070665_100662990 | |||
| 298 | Ga0068855_100013946 | |||
| 299 | Ga0068855_100147084 | |||
| 300 | Ga0068855_101276926 | |||
| 301 | Ga0068856_100151001 | |||
| 302 | Ga0068852_100204616 | |||
| 303 | Ga0068852_100531211 | |||
| 304 | Ga0068859_100324814 | |||
| 305 | Ga0068860_100048399 | |||
| 306 | Ga0070715_10368021 | |||
| 307 | Ga0070712_100139453 | |||
| 308 | Ga0070712_100767662 | |||
| 309 | Ga0097620_100324821 | |||
| 310 | Ga0105240_11269366 | |||
| 311 | Ga0105245_10367541 | |||
| 312 | Ga0105241_10111432 | |||
| 313 | Ga0105241_10138361 | |||
| 314 | Ga0105242_10000010 | |||
| 315 | Ga0105237_10347679 | |||
| 316 | Ga0105239_10173051 | |||
| 317 | Ga0105246_10484996 | |||
| 318 | Ga0157369_10594761 | |||
| 319 | Ga0157374_10003476 | |||
| 320 | Ga0157378_10845034 | |||
| 321 | Ga0163162_10858871 | |||
| 322 | Ga0163162_10911778 | |||
| 323 | Ga0157372_10562097 | |||
| 324 | Ga0157375_10463074 | |||
| 325 | Ga0163163_10304647 | |||
| 326 | Ga0163163_10358302 | |||
| 327 | Ga0182008_10144466 | |||
| 328 | Ga0197907_10172902 | |||
| 329 | Ga0206355_1260715 | |||
| 330 | Ga0206354_11175435 | |||
| 331 | Ga0206353_11932501 | |||
| 332 | Ga0213873_10030698 | |||
| 333 | Ga0213876_10002247 | |||
| 334 | Ga0224712_10047138 | |||
| 335 | Ga0224712_10069471 | |||
| 336 | Ga0207692_10023452 | |||
| 337 | Ga0207647_10364658 | |||
| 338 | Ga0207699_10009409 | |||
| 339 | Ga0207707_10000371 | |||
| 340 | Ga0207671_10059215 | |||
| 341 | Ga0207660_10005210 | |||
| 342 | Ga0207652_10000285 | |||
| 343 | Ga0207652_10296592 | |||
| 344 | Ga0207652_11136732 | |||
| 345 | Ga0207646_11080003 | |||
| 346 | Ga0207687_10038278 | |||
| 347 | Ga0207700_10033460 | |||
| 348 | Ga0207644_10423052 | |||
| 349 | Ga0207706_10915755 | |||
| 350 | Ga0207686_10000394 | |||
| 351 | Ga0207661_10012317 | |||
| 352 | Ga0207661_10244347 | |||
| 353 | Ga0207667_10038442 | |||
| 354 | Ga0207667_10475627 | |||
| 355 | Ga0207651_10609723 | |||
| 356 | Ga0207668_10798175 | |||
| 357 | Ga0207658_10124625 | |||
| 358 | Ga0207677_10006135 | |||
| 359 | Ga0207677_10312423 | |||
| 360 | Ga0207639_10453993 | |||
| 361 | Ga0207678_10160289 | |||
| 362 | Ga0207702_10081811 | |||
| 363 | Ga0207676_10380984 | |||
| 364 | Ga0207683_10831276 | |||
| 365 | Ga0207698_10071300 | |||
| 366 | Ga0207698_10472343 | |||
| 367 | Ga0268264_11307618 | |||
| 368 | Ga0265323_10009781 | |||
| 369 | Ga0265322_10002312 | |||
| 370 | Ga0307517_10446825 | |||
| 371 | Ga0307515_10000005 | |||
| 372 | Ga0265338_10107416 | |||
| 373 | Ga0265338_10410637 | |||
| 374 | Ga0307512_10032255 | |||
| 375 | Ga0265325_10111071 | |||
| 376 | Ga0265331_10021740 | |||
| 377 | Ga0265316_10007891 | |||
| 378 | Ga0307509_10007684 | |||
| 379 | Ga0307508_10005621 | |||
| 380 | Ga0307508_10239805 | |||
| 381 | Ga0265314_10042411 | |||
| 382 | Ga0307406_10454063 | |||
| 383 | Ga0307416_100251743 | |||
| 384 | Ga0307416_101325554 | |||
| 385 | Ga0373923_0059989 | |||
| 386 | Ga0373936_0316495 | |||
| 387 | Ga0373954_0092118 | |||
| 388 | Ga0373955_0019699 | |||
| 389 | Ga0373955_0686651 | |||
| 390 | Ga0373942_0009693 | |||
| 391 | Ga0316574_0042089 | |||
| 392 | Ga0373924_0142048 | |||
| 393 | Ga0373924_0236118 | |||
| 394 | Ga0373935_0019143 | |||
| 395 | Ga0373933_0061329 | |||
| 396 | Ga0373933_0316468 | |||
| 397 | Ga0373937_0372158 | |||
| 398 | Ga0373937_0524951 | |||
| 399 | Ga0373937_0538400 | |||
| 400 | Ga0373937_1000626 | |||
| 401 | Ga0316584_0000992 | |||
| 402 | Ga0316584_0848587 | |||
| 403 | Ga0395899_0301209 | |||
| 404 | Ga0436365_1357330 | |||
| 405 | Ga0436362_0036237 | |||
| 406 | Ga0436362_0267121 | |||
| 407 | Ga0451837_1312672 | |||
| 408 | Ga0451853_3506591 | |||
| 409 | Ga0451577_0001166 | |||
| 410 | Ga0451577_0005053 | |||
| 411 | Ga0451577_0186261 | |||
| 412 | Ga0466969_0012437 | |||
| 413 | Ga0466965_0054781 | |||
| 414 | Ga0466966_0024843 | |||
| 415 | Ga0466966_0027765 | |||
| 416 | Ga0466961_0050008 | |||
| 417 | Ga0466961_0053190 | |||
| 418 | Ga0466963_0008689 | |||
| 419 | Ga0466963_0014420 | |||
| 420 | Ga0466963_0015014 | |||
| 421 | Ga0466963_0256700 | |||
| 422 | Ga0466964_0463594 | |||
| 423 | Ga0453684_0000332 | |||
| 424 | Ga0453684_0014978 | |||
| 425 | Ga0466971_0041399 | |||
| 426 | Ga0466968_0170818 | |||
| 427 | Ga0466968_0278859 | |||
| 428 | Ga0466970_0007842 | |||
| 429 | Ga0466970_0241888 | |||
| 430 | Ga0466957_0045558 | |||
| 431 | Ga0466957_0078220 | |||
| 432 | Ga0466957_0375675 | |||
| 433 | Ga0466957_0404344 | |||
| 434 | Ga0466957_0695860 | |||
| 435 | Ga0466957_0899546 | |||
| 436 | Ga0466960_0001503 | |||
| 437 | Ga0466960_0010218 | |||
| 438 | Ga0466959_0149568 | |||
| 439 | Ga0466958_0035393 | |||
| 440 | Ga0466958_0037297 | |||
| 441 | Ga0466958_0079210 | |||
| 442 | Ga0466967_0000302 | |||
| 443 | Ga0466967_0016006 | |||
| 444 | Ga0466967_0026146 | |||
| 445 | Ga0466967_0037868 | |||
| 446 | Ga0466967_0149752 | |||
| 447 | Ga0466967_0171684 | |||
| 448 | Ga0466967_0537956 | |||
| 449 | Ga0466967_0917116 | |||
| 450 | Ga0495651_0524455 | |||
| 451 | Ga0495653_0040553 | |||
| 452 | Ga0495650_0032270 | |||
| 453 | Ga0495662_0096604 | |||
| 454 | Ga0495664_0391930 | |||
| 455 | Ga0495608_0010219 | |||
| 456 | Ga0495608_0334472 | |||
| 457 | Ga0495618_0319749 | |||
| 458 | Ga0495632_0077583 | |||
| 459 | Ga0495666_0038159 | |||
| 460 | Ga0495640_0208344 | |||
| 461 | Ga0495586_0270488 | |||
| 462 | Ga0495587_0037975 | |||
| 463 | Ga0495667_0265705 | |||
| 464 | Ga0495634_0019638 | |||
| 465 | Ga0495625_0001443 | |||
| 466 | Ga0495635_0041398 | |||
| 467 | Ga0495657_0133365 | |||
| 468 | Ga0495599_0346800 | |||
| 469 | Ga0495623_0039840 | |||
| 470 | Ga0495674_0136748 | |||
| 471 | Ga0495674_0539021 | |||
| 472 | Ga0495680_0118787 | |||
| 473 | Ga0495684_0017849 | |||
| 474 | Ga0495602_0408971 | |||
| 475 | Ga0496100_0066015 | |||
| 476 | Ga0496100_0970272 | |||
| 477 | Ga0496101_0028230 | |||
| 478 | Ga0496102_0058616 | |||
| 479 | Ga0496102_1055490 | |||
| 480 | Ga0496104_0051491 | |||
| 481 | Ga0496105_0048539 | |||
| 482 | Ga0496105_0116081 | |||
| 483 | Ga0496105_0583953 | |||
| 484 | Ga0496106_0060424 | |||
| 485 | Ga0496106_0071593 | |||
| 486 | Ga0496108_0000102 | |||
| 487 | Ga0496108_0014505 | |||
| 488 | Ga0496108_0022727 | |||
| 489 | Ga0496109_0017790 | |||
| 490 | Ga0496109_0100117 | |||
| 491 | Ga0496109_0156934 | |||
| 492 | Ga0496110_0031949 | |||
| 493 | Ga0496110_0038190 | |||
| 494 | Ga0496111_0042924 | |||
| 495 | Ga0496111_0093675 | |||
| 496 | Ga0496112_0020445 | |||
| 497 | Ga0496112_0223411 | |||
| 498 | Ga0496113_0074321 | |||
| 499 | Ga0496113_0328045 | |||
| 500 | Ga0496116_0001616 | |||
| 501 | Ga0496117_0018368 | |||
| 502 | Ga0496118_0002400 | |||
| 503 | Ga0496119_0027397 | |||
| 504 | Ga0496122_0074098 | |||
| 505 | Ga0496123_0135164 | |||
| 506 | Ga0496124_0143565 | |||
| 507 | Ga0496126_0000235 | |||
| 508 | Ga0501031_0269103 | |||
| 509 | Ga0501032_0003315 | |||
| 510 | Ga0501032_0005450 | |||
| 511 | Ga0501033_0000066 | |||
| 512 | Ga0501034_0005381 | |||
| 513 | Ga0501034_0046484 | |||
| 514 | Ga0501034_0222849 | |||
| 515 | Ga0501034_0228596 | |||
| 516 | Ga0501034_0324545 | |||
| 517 | Ga0501034_0370883 | |||
| 518 | Ga0501036_0025196 | |||
| 519 | Ga0501036_0034402 | |||
| 520 | Ga0501036_0823004 | |||
| 521 | Ga0501037_0006253 | |||
| 522 | Ga0501037_0082052 | |||
| 523 | Ga0501037_0210790 | |||
| 524 | Ga0501038_0026212 | |||
| 525 | Ga0501038_0026349 | |||
| 526 | Ga0501038_0044330 | |||
| 527 | Ga0501038_0087276 | |||
| 528 | Ga0501039_0001348 | |||
| 529 | Ga0501039_0191675 | |||
| 530 | Ga0501042_0144667 | |||
| 531 | Ga0501043_0002102 | |||
| 532 | Ga0501043_0004938 | |||
| 533 | Ga0501043_0023646 | |||
| 534 | Ga0501046_0024997 | |||
| 535 | Ga0501047_0003478 | |||
| 536 | Ga0501047_0086113 | |||
| 537 | Ga0501047_0139552 | |||
| 538 | Ga0501047_0151475 | |||
| 539 | Ga0501047_0572595 | |||
| 540 | Ga0501048_0003612 | |||
| 541 | Ga0501048_0058294 | |||
| 542 | Ga0501067_0148090 | |||
| 543 | Ga0501070_1030129 | |||
| 544 | Ga0501073_0023739 | |||
| 545 | Ga0501074_0082764 | |||
| 546 | Ga0501035_0003036 | |||
| 547 | Ga0501035_0200460 | |||
| 548 | Ga0501035_0411302 | |||
| 549 | Ga0501035_0666390 | |||
| 550 | Ga0501044_0002976 | |||
| 551 | Ga0501044_0034294 | |||
| 552 | Ga0501044_0130196 | |||
| 553 | Ga0501044_0156261 | |||
| 554 | Ga0501044_0225275 | |||
| 555 | Ga0501045_0000763 | |||
| 556 | Ga0495601_0037351 | |||
| 557 | Ga0495612_0037883 | |||
| 558 | Ga0466962_0020927 | |||
| 559 | Ga0466962_0059038 | |||
| 560 | 2734973298 | |||
| 561 | 2795784805 | |||
| 562 | 2887484174 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h6p-assembly1.cif.gz_A | crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. | 0.852 | 2 | 180 |
| 3gfq-assembly1.cif.gz_A | structure of yhda, k109l variant | 0.8498 | 4 | 179 |
| 7f76-assembly1.cif.gz_A | crystal structure of fmn-dependent nadph-quinone reductase (azor) from bacillus cohnii | 0.8491 | 1 | 179 |
| 6dgi-assembly1.cif.gz_A-2 | the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961 | 0.8463 | 2 | 40 |
| 6dgi-assembly1.cif.gz_B | the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961 | 0.8453 | 2 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9USJ6_13_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8931 | 3 | 164 | 3.40.50.360 |
| af_Q9USJ6_13_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8726 | 3 | 164 | 3.40.50.360 |
| af_Q54QT4_9_187_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8664 | 3 | 170 | 3.40.50.360 |
| af_Q2G135_1_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8585 | 1 | 180 | 3.40.50.360 |
| af_Q2G135_1_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8453 | 1 | 180 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T2WGI2-F1-model_v4 | NADPH-dependent FMN reductase | 0.9965 | 2 | 184 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-J2J4H9-F1-model_v4 | NADPH-dependent FMN reductase family protein | 0.9949 | 36 | 184 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A4Q3VYL5-F1-model_v4 | NADPH-dependent oxidoreductase | 0.9946 | 39 | 184 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A4R7E4G8-F1-model_v4 | deleted | 0.9935 | 2 | 185 |
|
| AF-A0A318A0M7-F1-model_v4 | NADPH-dependent FMN reductase | 0.9934 | 1 | 176 |
GO:0005829
GO:0010181 GO:0016491 |