F384199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 147 | 281 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10049135|Ga0081539_100491352 |
| Length | 178 |
| Sequence | MPISIPVCGLIFRKTHSVNMFNSDQDHHETTFFDLGDNTALVCVDHQQYQKVIVPQLIDMTYKVHLGLFEEDVLLKLKTYAYDVVVVYENFKGSTLQTNPILAELTQRPDAQRRQHFVVLISHRFATNDAMSAFVNSVDQVINIGDLTNLKPVLRRGVAQHRELYNAFNEMLKSVQSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 77 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 110 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 114 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 116 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 118 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 122 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 123 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 124 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 140 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 141 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 142 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 144 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.56 |
| Rhizosphere | 94.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_380009 | 2162886012 | Bacteria | 1534 |
| 2 | CNXas_1000153 | 3300000545 | Bacteria | 11863 |
| 3 | JGI24034J26672_10068646 | 3300002239 | Unclassified | 632 |
| 4 | JGI25406J46586_10000090 | 3300003203 | Bacteria | 41533 |
| 5 | Ga0065712_10116465 | 3300005290 | Bacteria | 1735 |
| 6 | Ga0065715_10564032 | 3300005293 | Bacteria | 732 |
| 7 | Ga0065707_10063178 | 3300005295 | Unclassified | 625 |
| 8 | Ga0070676_10926800 | 3300005328 | Unclassified | 650 |
| 9 | Ga0070670_100060306 | 3300005331 | Bacteria | 3257 |
| 10 | Ga0070666_10178775 | 3300005335 | Unclassified | 1487 |
| 11 | Ga0070689_100047157 | 3300005340 | Bacteria | 3322 |
| 12 | Ga0070689_100591091 | 3300005340 | Unclassified | 960 |
| 13 | Ga0070668_100008283 | 3300005347 | Bacteria | 7716 |
| 14 | Ga0070668_100103841 | 3300005347 | Unclassified | 2255 |
| 15 | Ga0070668_101268942 | 3300005347 | Bacteria | 669 |
| 16 | Ga0070669_100032142 | 3300005353 | Bacteria | 3790 |
| 17 | Ga0070669_101339710 | 3300005353 | Unclassified | 620 |
| 18 | Ga0070675_100150306 | 3300005354 | Bacteria | 1996 |
| 19 | Ga0070671_100041285 | 3300005355 | Bacteria | 3833 |
| 20 | Ga0070671_100100374 | 3300005355 | Bacteria | 2428 |
| 21 | Ga0070671_100469024 | 3300005355 | Bacteria | 1081 |
| 22 | Ga0070673_100187250 | 3300005364 | Unclassified | 1775 |
| 23 | Ga0070673_101272891 | 3300005364 | Unclassified | 690 |
| 24 | Ga0070688_100114199 | 3300005365 | Unclassified | 1800 |
| 25 | Ga0070688_100762603 | 3300005365 | Unclassified | 754 |
| 26 | Ga0070688_101042685 | 3300005365 | Unclassified | 651 |
| 27 | Ga0070667_100109276 | 3300005367 | Bacteria | 2396 |
| 28 | Ga0070667_102192685 | 3300005367 | Unclassified | 520 |
| 29 | Ga0070709_10252823 | 3300005434 | Bacteria | 1270 |
| 30 | Ga0070709_10504464 | 3300005434 | Unclassified | 919 |
| 31 | Ga0070714_100113385 | 3300005435 | Bacteria | 2404 |
| 32 | Ga0070714_100986426 | 3300005435 | Unclassified | 819 |
| 33 | Ga0070713_100373874 | 3300005436 | Bacteria | 1326 |
| 34 | Ga0070713_102377233 | 3300005436 | Unclassified | 512 |
| 35 | Ga0070710_10139238 | 3300005437 | Bacteria | 1486 |
| 36 | Ga0070710_10324646 | 3300005437 | Unclassified | 1011 |
| 37 | Ga0070710_10518370 | 3300005437 | Bacteria | 818 |
| 38 | Ga0070710_10599793 | 3300005437 | Unclassified | 766 |
| 39 | Ga0070710_11424999 | 3300005437 | Unclassified | 518 |
| 40 | Ga0070711_100200866 | 3300005439 | Bacteria | 1538 |
| 41 | Ga0070711_100349063 | 3300005439 | Unclassified | 1189 |
| 42 | Ga0070711_100366514 | 3300005439 | Unclassified | 1161 |
| 43 | Ga0070711_100618811 | 3300005439 | Unclassified | 905 |
| 44 | Ga0070705_100345957 | 3300005440 | Bacteria | 1082 |
| 45 | Ga0070705_101663547 | 3300005440 | Unclassified | 539 |
| 46 | Ga0070694_100175862 | 3300005444 | Bacteria | 1580 |
| 47 | Ga0070708_100004119 | 3300005445 | Bacteria | 11411 |
| 48 | Ga0070708_100193746 | 3300005445 | Unclassified | 1901 |
| 49 | Ga0070708_100267026 | 3300005445 | Unclassified | 1609 |
| 50 | Ga0070708_100350455 | 3300005445 | Bacteria | 1391 |
| 51 | Ga0070708_100422672 | 3300005445 | Unclassified | 1257 |
| 52 | Ga0070708_100449834 | 3300005445 | Unclassified | 1215 |
| 53 | Ga0070708_100910614 | 3300005445 | Unclassified | 826 |
| 54 | Ga0070708_101234205 | 3300005445 | Unclassified | 699 |
| 55 | Ga0070708_101274003 | 3300005445 | Unclassified | 687 |
| 56 | Ga0070663_101556018 | 3300005455 | Unclassified | 589 |
| 57 | Ga0070662_100230825 | 3300005457 | Unclassified | 1480 |
| 58 | Ga0068867_101198966 | 3300005459 | Unclassified | 697 |
| 59 | Ga0070706_100000012 | 3300005467 | Bacteria | 195040 |
| 60 | Ga0070706_100008143 | 3300005467 | Bacteria | 9778 |
| 61 | Ga0070706_100094219 | 3300005467 | Unclassified | 2779 |
| 62 | Ga0070706_100631624 | 3300005467 | Unclassified | 994 |
| 63 | Ga0070706_100848886 | 3300005467 | Unclassified | 844 |
| 64 | Ga0070706_100930194 | 3300005467 | Bacteria | 803 |
| 65 | Ga0070706_100982107 | 3300005467 | Unclassified | 779 |
| 66 | Ga0070707_100002059 | 3300005468 | Bacteria | 19267 |
| 67 | Ga0070707_100002852 | 3300005468 | Bacteria | 16454 |
| 68 | Ga0070707_100045262 | 3300005468 | Bacteria | 4212 |
| 69 | Ga0070707_100074633 | 3300005468 | Bacteria | 3270 |
| 70 | Ga0070707_100084158 | 3300005468 | Bacteria | 3073 |
| 71 | Ga0070707_100240623 | 3300005468 | Unclassified | 1762 |
| 72 | Ga0070707_100730472 | 3300005468 | Unclassified | 953 |
| 73 | Ga0070707_101925599 | 3300005468 | Unclassified | 559 |
| 74 | Ga0070698_100013365 | 3300005471 | Bacteria | 8691 |
| 75 | Ga0070698_100017848 | 3300005471 | Bacteria | 7476 |
| 76 | Ga0070698_100065392 | 3300005471 | Bacteria | 3662 |
| 77 | Ga0070698_100105072 | 3300005471 | Bacteria | 2794 |
| 78 | Ga0070698_100470598 | 3300005471 | Bacteria | 1193 |
| 79 | Ga0070699_100013795 | 3300005518 | Bacteria | 6951 |
| 80 | Ga0070699_100469114 | 3300005518 | Unclassified | 1142 |
| 81 | Ga0070699_100745312 | 3300005518 | Unclassified | 896 |
| 82 | Ga0070699_100903610 | 3300005518 | Bacteria | 809 |
| 83 | Ga0070679_100157711 | 3300005530 | Bacteria | 2244 |
| 84 | Ga0070697_100004210 | 3300005536 | Bacteria | 11022 |
| 85 | Ga0070697_100010757 | 3300005536 | Bacteria | 7144 |
| 86 | Ga0070697_100021032 | 3300005536 | Bacteria | 5166 |
| 87 | Ga0070697_100033215 | 3300005536 | Bacteria | 4155 |
| 88 | Ga0070697_100058000 | 3300005536 | Bacteria | 3150 |
| 89 | Ga0070697_100062795 | 3300005536 | Unclassified | 3032 |
| 90 | Ga0070697_100067029 | 3300005536 | Bacteria | 2935 |
| 91 | Ga0070697_100089781 | 3300005536 | Bacteria | 2539 |
| 92 | Ga0070697_100213717 | 3300005536 | Bacteria | 1643 |
| 93 | Ga0070697_100249540 | 3300005536 | Bacteria | 1517 |
| 94 | Ga0070697_100694657 | 3300005536 | Bacteria | 897 |
| 95 | Ga0070697_100699698 | 3300005536 | Bacteria | 894 |
| 96 | Ga0070697_100788442 | 3300005536 | Unclassified | 840 |
| 97 | Ga0070697_101312229 | 3300005536 | Unclassified | 646 |
| 98 | Ga0070672_100008229 | 3300005543 | Bacteria | 7126 |
| 99 | Ga0070695_100103967 | 3300005545 | Bacteria | 1917 |
| 100 | Ga0070693_100746824 | 3300005547 | Bacteria | 721 |
| 101 | Ga0070693_100976467 | 3300005547 | Unclassified | 639 |
| 102 | Ga0070665_100258181 | 3300005548 | Bacteria | 1744 |
| 103 | Ga0070704_100497070 | 3300005549 | Bacteria | 1058 |
| 104 | Ga0070704_101216997 | 3300005549 | Unclassified | 687 |
| 105 | Ga0068855_100770099 | 3300005563 | Bacteria | 1025 |
| 106 | Ga0070702_100027125 | 3300005615 | Bacteria | 3087 |
| 107 | Ga0068864_101427368 | 3300005618 | Unclassified | 694 |
| 108 | Ga0068866_10124196 | 3300005718 | Bacteria | 1459 |
| 109 | Ga0068861_100350170 | 3300005719 | Bacteria | 1295 |
| 110 | Ga0068863_100735348 | 3300005841 | Bacteria | 982 |
| 111 | Ga0068858_100852552 | 3300005842 | Bacteria | 890 |
| 112 | Ga0068860_101724763 | 3300005843 | Unclassified | 648 |
| 113 | Ga0081539_10000710 | 3300005985 | Bacteria | 66710 |
| 114 | Ga0081539_10001036 | 3300005985 | Bacteria | 51273 |
| 115 | Ga0081539_10008904 | 3300005985 | Bacteria | 8565 |
| 116 | Ga0081539_10049135 | 3300005985 | Bacteria | 2396 |
| 117 | Ga0081539_10164903 | 3300005985 | Unclassified | 1053 |
| 118 | Ga0070717_10000538 | 3300006028 | Bacteria | 24005 |
| 119 | Ga0070717_10148705 | 3300006028 | Bacteria | 2025 |
| 120 | Ga0070717_10289249 | 3300006028 | Bacteria | 1455 |
| 121 | Ga0070715_10067872 | 3300006163 | Bacteria | 1584 |
| 122 | Ga0070715_10229867 | 3300006163 | Unclassified | 958 |
| 123 | Ga0070715_11078889 | 3300006163 | Unclassified | 504 |
| 124 | Ga0070716_100018305 | 3300006173 | Unclassified | 3647 |
| 125 | Ga0070716_100125825 | 3300006173 | Bacteria | 1612 |
| 126 | Ga0070712_100173556 | 3300006175 | Bacteria | 1674 |
| 127 | Ga0070712_100596575 | 3300006175 | Unclassified | 934 |
| 128 | Ga0070712_100707116 | 3300006175 | Unclassified | 859 |
| 129 | Ga0070712_100872740 | 3300006175 | Bacteria | 775 |
| 130 | Ga0070712_101421517 | 3300006175 | Unclassified | 605 |
| 131 | Ga0097621_100121248 | 3300006237 | Bacteria | 2218 |
| 132 | Ga0097621_100585027 | 3300006237 | Unclassified | 1019 |
| 133 | Ga0097621_101469395 | 3300006237 | Unclassified | 646 |
| 134 | Ga0068871_100868168 | 3300006358 | Bacteria | 835 |
| 135 | Ga0068871_100968169 | 3300006358 | Bacteria | 791 |
| 136 | Ga0075436_100671947 | 3300006914 | Bacteria | 766 |
| 137 | Ga0099794_10162055 | 3300007265 | Unclassified | 1138 |
| 138 | Ga0099795_10234327 | 3300007788 | Unclassified | 786 |
| 139 | Ga0105245_10113845 | 3300009098 | Bacteria | 2519 |
| 140 | Ga0105245_10285458 | 3300009098 | Bacteria | 1615 |
| 141 | Ga0105245_10770761 | 3300009098 | Unclassified | 999 |
| 142 | Ga0105245_12205174 | 3300009098 | Unclassified | 605 |
| 143 | Ga0105243_11090780 | 3300009148 | Unclassified | 806 |
| 144 | Ga0105242_10002735 | 3300009176 | Bacteria | 13799 |
| 145 | Ga0105242_10086361 | 3300009176 | Bacteria | 2633 |
| 146 | Ga0105237_10257963 | 3300009545 | Bacteria | 1746 |
| 147 | Ga0099796_10014855 | 3300010159 | Bacteria | 2260 |
| 148 | Ga0105239_11464661 | 3300010375 | Unclassified | 789 |
| 149 | Ga0157373_10452062 | 3300013100 | Unclassified | 924 |
| 150 | Ga0157371_10086474 | 3300013102 | Bacteria | 2220 |
| 151 | Ga0157374_10100492 | 3300013296 | Bacteria | 2773 |
| 152 | Ga0157374_11062759 | 3300013296 | Unclassified | 829 |
| 153 | Ga0157374_11420341 | 3300013296 | Unclassified | 717 |
| 154 | Ga0157378_10034971 | 3300013297 | Unclassified | 4443 |
| 155 | Ga0157378_10066801 | 3300013297 | Bacteria | 3221 |
| 156 | Ga0157378_10373084 | 3300013297 | Bacteria | 1399 |
| 157 | Ga0157378_10542265 | 3300013297 | Unclassified | 1167 |
| 158 | Ga0157378_10678848 | 3300013297 | Bacteria | 1048 |
| 159 | Ga0157378_10812335 | 3300013297 | Unclassified | 961 |
| 160 | Ga0157378_10869491 | 3300013297 | Unclassified | 931 |
| 161 | Ga0157378_11123117 | 3300013297 | Bacteria | 823 |
| 162 | Ga0157378_11590855 | 3300013297 | Bacteria | 699 |
| 163 | Ga0163162_10099685 | 3300013306 | Bacteria | 2996 |
| 164 | Ga0157372_10059349 | 3300013307 | Bacteria | 4278 |
| 165 | Ga0157372_10067536 | 3300013307 | Bacteria | 4017 |
| 166 | Ga0157375_10567351 | 3300013308 | Bacteria | 1296 |
| 167 | Ga0157375_11147370 | 3300013308 | Unclassified | 910 |
| 168 | Ga0163163_10099566 | 3300014325 | Bacteria | 2928 |
| 169 | Ga0157377_10861047 | 3300014745 | Unclassified | 674 |
| 170 | Ga0157379_10190490 | 3300014968 | Bacteria | 1853 |
| 171 | Ga0157376_10145737 | 3300014969 | Bacteria | 2129 |
| 172 | Ga0157376_10372292 | 3300014969 | Bacteria | 1373 |
| 173 | Ga0157376_11893531 | 3300014969 | Unclassified | 633 |
| 174 | Ga0213875_10078673 | 3300021388 | Unclassified | 1538 |
| 175 | Ga0213875_10217964 | 3300021388 | Unclassified | 899 |
| 176 | Ga0207673_1017564 | 3300025290 | Bacteria | 956 |
| 177 | Ga0207697_10006579 | 3300025315 | Bacteria | 5244 |
| 178 | Ga0207692_10395941 | 3300025898 | Bacteria | 860 |
| 179 | Ga0207688_10002365 | 3300025901 | Bacteria | 10147 |
| 180 | Ga0207647_10222456 | 3300025904 | Bacteria | 1088 |
| 181 | Ga0207685_10327812 | 3300025905 | Unclassified | 766 |
| 182 | Ga0207645_10002801 | 3300025907 | Bacteria | 13548 |
| 183 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 184 | Ga0207684_10003057 | 3300025910 | Bacteria | 16580 |
| 185 | Ga0207684_10030448 | 3300025910 | Bacteria | 4594 |
| 186 | Ga0207684_10032147 | 3300025910 | Bacteria | 4462 |
| 187 | Ga0207684_10068460 | 3300025910 | Bacteria | 3017 |
| 188 | Ga0207684_10076553 | 3300025910 | Unclassified | 2844 |
| 189 | Ga0207646_10004616 | 3300025922 | Bacteria | 14886 |
| 190 | Ga0207646_10020596 | 3300025922 | Bacteria | 6109 |
| 191 | Ga0207646_10046665 | 3300025922 | Bacteria | 3886 |
| 192 | Ga0207646_10115684 | 3300025922 | Unclassified | 2409 |
| 193 | Ga0207646_10282681 | 3300025922 | Bacteria | 1499 |
| 194 | Ga0207646_10342621 | 3300025922 | Bacteria | 1350 |
| 195 | Ga0207646_10514642 | 3300025922 | Unclassified | 1078 |
| 196 | Ga0207646_10728307 | 3300025922 | Unclassified | 886 |
| 197 | Ga0207681_10082286 | 3300025923 | Unclassified | 2275 |
| 198 | Ga0207681_10350678 | 3300025923 | Bacteria | 1181 |
| 199 | Ga0207681_10652177 | 3300025923 | Bacteria | 873 |
| 200 | Ga0207650_10077551 | 3300025925 | Bacteria | 2512 |
| 201 | Ga0207687_10163030 | 3300025927 | Bacteria | 1713 |
| 202 | Ga0207687_10411324 | 3300025927 | Unclassified | 1114 |
| 203 | Ga0207700_10045143 | 3300025928 | Bacteria | 3249 |
| 204 | Ga0207664_10106906 | 3300025929 | Bacteria | 2321 |
| 205 | Ga0207644_10098714 | 3300025931 | Bacteria | 2190 |
| 206 | Ga0207644_10134839 | 3300025931 | Bacteria | 1894 |
| 207 | Ga0207706_10006891 | 3300025933 | Bacteria | 10507 |
| 208 | Ga0207706_10217966 | 3300025933 | Unclassified | 1672 |
| 209 | Ga0207686_10052544 | 3300025934 | Bacteria | 2544 |
| 210 | Ga0207686_10168328 | 3300025934 | Bacteria | 1543 |
| 211 | Ga0207670_10123863 | 3300025936 | Bacteria | 1883 |
| 212 | Ga0207670_10406404 | 3300025936 | Unclassified | 1090 |
| 213 | Ga0207669_10147779 | 3300025937 | Bacteria | 1641 |
| 214 | Ga0207669_10389234 | 3300025937 | Unclassified | 1089 |
| 215 | Ga0207704_10140919 | 3300025938 | Bacteria | 1686 |
| 216 | Ga0207665_10010103 | 3300025939 | Bacteria | 6198 |
| 217 | Ga0207665_10125941 | 3300025939 | Bacteria | 1814 |
| 218 | Ga0207665_10203435 | 3300025939 | Bacteria | 1444 |
| 219 | Ga0207665_10287472 | 3300025939 | Unclassified | 1225 |
| 220 | Ga0207665_10748467 | 3300025939 | Bacteria | 770 |
| 221 | Ga0207691_10000861 | 3300025940 | Bacteria | 30154 |
| 222 | Ga0207689_11312552 | 3300025942 | Bacteria | 608 |
| 223 | Ga0207667_10367825 | 3300025949 | Bacteria | 1466 |
| 224 | Ga0207651_10181626 | 3300025960 | Bacteria | 1669 |
| 225 | Ga0207658_10114194 | 3300025986 | Unclassified | 2141 |
| 226 | Ga0207658_10115228 | 3300025986 | Bacteria | 2132 |
| 227 | Ga0207658_11994307 | 3300025986 | Unclassified | 528 |
| 228 | Ga0207677_10032232 | 3300026023 | Bacteria | 3366 |
| 229 | Ga0207677_10174778 | 3300026023 | Bacteria | 1683 |
| 230 | Ga0207677_10382591 | 3300026023 | Bacteria | 1188 |
| 231 | Ga0207648_10660681 | 3300026089 | Bacteria | 966 |
| 232 | Ga0207648_10936414 | 3300026089 | Unclassified | 810 |
| 233 | Ga0207675_100484603 | 3300026118 | Bacteria | 1229 |
| 234 | Ga0207683_10013132 | 3300026121 | Bacteria | 7065 |
| 235 | Ga0268266_10254821 | 3300028379 | Bacteria | 1624 |
| 236 | Ga0268265_11072581 | 3300028380 | Bacteria | 799 |
| 237 | Ga0307513_10013707 | 3300031456 | Bacteria | 9941 |
| 238 | Ga0373944_0080907 | 3300035089 | Unclassified | 1073 |
| 239 | Ga0373923_0367655 | 3300035111 | Unclassified | 689 |
| 240 | Ga0373943_0054519 | 3300035170 | Bacteria | 1978 |
| 241 | Ga0373943_0491528 | 3300035170 | Unclassified | 716 |
| 242 | Ga0373946_0420253 | 3300035171 | Unclassified | 677 |
| 243 | Ga0373955_0339776 | 3300035172 | Bacteria | 908 |
| 244 | Ga0373924_0146046 | 3300035410 | Bacteria | 1033 |
| 245 | Ga0373935_0065687 | 3300035692 | Bacteria | 2329 |
| 246 | Ga0373927_0202300 | 3300035695 | Bacteria | 1304 |
| 247 | Ga0373927_0499945 | 3300035695 | Unclassified | 803 |
| 248 | Ga0373947_0053762 | 3300035725 | Unclassified | 2429 |
| 249 | Ga0373947_0147747 | 3300035725 | Unclassified | 1512 |
| 250 | Ga0373937_0070735 | 3300036401 | Bacteria | 3218 |
| 251 | Ga0373925_0040387 | 3300037068 | Bacteria | 3454 |
| 252 | Ga0395900_0096416 | 3300037418 | Bacteria | 3039 |
| 253 | Ga0436364_0941594 | 3300037853 | Bacteria | 1783 |
| 254 | Ga0436364_1177641 | 3300037853 | Bacteria | 2348 |
| 255 | Ga0451853_0846236 | 3300041512 | Unclassified | 1123 |
| 256 | Ga0495651_0019333 | 3300046462 | Bacteria | 5280 |
| 257 | Ga0495630_0093650 | 3300046517 | Bacteria | 2271 |
| 258 | Ga0495652_0173870 | 3300046529 | Bacteria | 1660 |
| 259 | Ga0495640_0234841 | 3300046533 | Bacteria | 1152 |
| 260 | Ga0495586_0630476 | 3300046535 | Bacteria | 619 |
| 261 | Ga0495621_0037264 | 3300046539 | Bacteria | 1691 |
| 262 | Ga0495645_0184460 | 3300046543 | Bacteria | 1427 |
| 263 | Ga0495588_0493913 | 3300046674 | Bacteria | 642 |
| 264 | Ga0495623_0288890 | 3300046679 | Bacteria | 910 |
| 265 | Ga0495613_0287169 | 3300046689 | Bacteria | 1141 |
| 266 | Ga0495624_0181369 | 3300046690 | Unclassified | 1283 |
| 267 | Ga0495604_0216959 | 3300047317 | Bacteria | 1319 |
| 268 | Ga0496100_0017778 | 3300048903 | Bacteria | 4205 |
| 269 | Ga0496101_0001941 | 3300048904 | Bacteria | 12525 |
| 270 | Ga0496102_0044189 | 3300048905 | Bacteria | 4042 |
| 271 | Ga0496103_0028192 | 3300048906 | Bacteria | 3406 |
| 272 | Ga0496106_0002667 | 3300048909 | Bacteria | 13285 |
| 273 | Ga0496107_0012424 | 3300048910 | Bacteria | 5945 |
| 274 | Ga0496108_0035982 | 3300048911 | Bacteria | 4118 |
| 275 | Ga0496112_0312693 | 3300048915 | Unclassified | 1516 |
| 276 | Ga0496113_0288505 | 3300048916 | Bacteria | 1313 |
| 277 | Ga0496115_0004034 | 3300048918 | Bacteria | 10601 |
| 278 | nmdc:mga0rr50_305660_c1 | 3300050513 | Bacteria | 1331 |
| 279 | nmdc:mga08x19_153166_c1 | 3300050514 | Bacteria | 1562 |
| 280 | nmdc:mga08x19_33599_c1 | 3300050514 | Bacteria | 3237 |
| 281 | nmdc:mga08x19_957312_c1 | 3300050514 | Unclassified | 608 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10748467 | Ga0207665_107484672 | 135 |
| 2 | 3300005468 | Ga0070707_101925599 | Ga0070707_1019255991 | 149 |
| 3 | 3300035172 | Ga0373955_0339776 | Ga0373955_0339776_407_862 | 151 |
| 4 | 3300035410 | Ga0373924_0146046 | Ga0373924_0146046_280_735 | 151 |
| 5 | 3300036401 | Ga0373937_0070735 | Ga0373937_0070735_1983_2438 | 151 |
| 6 | 3300046462 | Ga0495651_0019333 | Ga0495651_0019333_637_1092 | 151 |
| 7 | 3300046517 | Ga0495630_0093650 | Ga0495630_0093650_1162_1617 | 151 |
| 8 | 3300046529 | Ga0495652_0173870 | Ga0495652_0173870_148_603 | 151 |
| 9 | 3300046533 | Ga0495640_0234841 | Ga0495640_0234841_617_1072 | 151 |
| 10 | 3300046543 | Ga0495645_0184460 | Ga0495645_0184460_187_642 | 151 |
| 11 | 3300046679 | Ga0495623_0288890 | Ga0495623_0288890_47_502 | 151 |
| 12 | 3300046689 | Ga0495613_0287169 | Ga0495613_0287169_635_1090 | 151 |
| 13 | 3300047317 | Ga0495604_0216959 | Ga0495604_0216959_105_560 | 151 |
| 14 | 3300005445 | Ga0070708_100004119 | Ga0070708_10000411911 | 153 |
| 15 | 3300025910 | Ga0207684_10068460 | Ga0207684_100684604 | 153 |
| 16 | 3300037418 | Ga0395900_0096416 | Ga0395900_0096416_1395_1856 | 153 |
| 17 | 3300000545 | CNXas_1000153 | CNXas_10001536 | 154 |
| 18 | 3300002239 | JGI24034J26672_10068646 | JGI24034J26672_100686462 | 154 |
| 19 | 3300003203 | JGI25406J46586_10000090 | JGI25406J46586_1000009030 | 154 |
| 20 | 3300005290 | Ga0065712_10116465 | Ga0065712_101164652 | 154 |
| 21 | 3300005295 | Ga0065707_10063178 | Ga0065707_100631781 | 154 |
| 22 | 3300005328 | Ga0070676_10926800 | Ga0070676_109268001 | 154 |
| 23 | 3300005331 | Ga0070670_100060306 | Ga0070670_1000603063 | 154 |
| 24 | 3300005335 | Ga0070666_10178775 | Ga0070666_101787752 | 154 |
| 25 | 3300005340 | Ga0070689_100047157 | Ga0070689_1000471571 | 154 |
| 26 | 3300005340 | Ga0070689_100591091 | Ga0070689_1005910911 | 154 |
| 27 | 3300005347 | Ga0070668_100008283 | Ga0070668_1000082833 | 154 |
| 28 | 3300005347 | Ga0070668_101268942 | Ga0070668_1012689421 | 154 |
| 29 | 3300005353 | Ga0070669_100032142 | Ga0070669_1000321422 | 154 |
| 30 | 3300005353 | Ga0070669_101339710 | Ga0070669_1013397102 | 154 |
| 31 | 3300005354 | Ga0070675_100150306 | Ga0070675_1001503062 | 154 |
| 32 | 3300005355 | Ga0070671_100100374 | Ga0070671_1001003744 | 154 |
| 33 | 3300005364 | Ga0070673_100187250 | Ga0070673_1001872502 | 154 |
| 34 | 3300005364 | Ga0070673_101272891 | Ga0070673_1012728912 | 154 |
| 35 | 3300005365 | Ga0070688_100114199 | Ga0070688_1001141993 | 154 |
| 36 | 3300005365 | Ga0070688_100762603 | Ga0070688_1007626032 | 154 |
| 37 | 3300005365 | Ga0070688_101042685 | Ga0070688_1010426851 | 154 |
| 38 | 3300005367 | Ga0070667_100109276 | Ga0070667_1001092763 | 154 |
| 39 | 3300005367 | Ga0070667_102192685 | Ga0070667_1021926851 | 154 |
| 40 | 3300005434 | Ga0070709_10252823 | Ga0070709_102528231 | 154 |
| 41 | 3300005434 | Ga0070709_10504464 | Ga0070709_105044642 | 154 |
| 42 | 3300005435 | Ga0070714_100986426 | Ga0070714_1009864262 | 154 |
| 43 | 3300005436 | Ga0070713_100373874 | Ga0070713_1003738741 | 154 |
| 44 | 3300005436 | Ga0070713_102377233 | Ga0070713_1023772331 | 154 |
| 45 | 3300005437 | Ga0070710_10139238 | Ga0070710_101392382 | 154 |
| 46 | 3300005437 | Ga0070710_10324646 | Ga0070710_103246462 | 154 |
| 47 | 3300005437 | Ga0070710_10518370 | Ga0070710_105183702 | 154 |
| 48 | 3300005437 | Ga0070710_11424999 | Ga0070710_114249991 | 154 |
| 49 | 3300005439 | Ga0070711_100200866 | Ga0070711_1002008662 | 154 |
| 50 | 3300005439 | Ga0070711_100349063 | Ga0070711_1003490632 | 154 |
| 51 | 3300005439 | Ga0070711_100366514 | Ga0070711_1003665142 | 154 |
| 52 | 3300005439 | Ga0070711_100618811 | Ga0070711_1006188112 | 154 |
| 53 | 3300005440 | Ga0070705_100345957 | Ga0070705_1003459571 | 154 |
| 54 | 3300005440 | Ga0070705_101663547 | Ga0070705_1016635471 | 154 |
| 55 | 3300005444 | Ga0070694_100175862 | Ga0070694_1001758622 | 154 |
| 56 | 3300005445 | Ga0070708_100910614 | Ga0070708_1009106142 | 154 |
| 57 | 3300005455 | Ga0070663_101556018 | Ga0070663_1015560181 | 154 |
| 58 | 3300005459 | Ga0068867_101198966 | Ga0068867_1011989661 | 154 |
| 59 | 3300005467 | Ga0070706_100008143 | Ga0070706_1000081433 | 154 |
| 60 | 3300005467 | Ga0070706_100848886 | Ga0070706_1008488861 | 154 |
| 61 | 3300005468 | Ga0070707_100084158 | Ga0070707_1000841582 | 154 |
| 62 | 3300005471 | Ga0070698_100105072 | Ga0070698_1001050721 | 154 |
| 63 | 3300005518 | Ga0070699_100013795 | Ga0070699_1000137954 | 154 |
| 64 | 3300005530 | Ga0070679_100157711 | Ga0070679_1001577114 | 154 |
| 65 | 3300005536 | Ga0070697_100062795 | Ga0070697_1000627954 | 154 |
| 66 | 3300005536 | Ga0070697_100249540 | Ga0070697_1002495402 | 154 |
| 67 | 3300005536 | Ga0070697_100694657 | Ga0070697_1006946572 | 154 |
| 68 | 3300005543 | Ga0070672_100008229 | Ga0070672_1000082294 | 154 |
| 69 | 3300005547 | Ga0070693_100746824 | Ga0070693_1007468241 | 154 |
| 70 | 3300005548 | Ga0070665_100258181 | Ga0070665_1002581814 | 154 |
| 71 | 3300005549 | Ga0070704_100497070 | Ga0070704_1004970702 | 154 |
| 72 | 3300005563 | Ga0068855_100770099 | Ga0068855_1007700992 | 154 |
| 73 | 3300005615 | Ga0070702_100027125 | Ga0070702_1000271251 | 154 |
| 74 | 3300005718 | Ga0068866_10124196 | Ga0068866_101241962 | 154 |
| 75 | 3300005719 | Ga0068861_100350170 | Ga0068861_1003501702 | 154 |
| 76 | 3300005841 | Ga0068863_100735348 | Ga0068863_1007353482 | 154 |
| 77 | 3300005842 | Ga0068858_100852552 | Ga0068858_1008525522 | 154 |
| 78 | 3300005843 | Ga0068860_101724763 | Ga0068860_1017247631 | 154 |
| 79 | 3300005985 | Ga0081539_10001036 | Ga0081539_1000103635 | 154 |
| 80 | 3300006028 | Ga0070717_10148705 | Ga0070717_101487054 | 154 |
| 81 | 3300006163 | Ga0070715_10067872 | Ga0070715_100678722 | 154 |
| 82 | 3300006163 | Ga0070715_10229867 | Ga0070715_102298672 | 154 |
| 83 | 3300006163 | Ga0070715_11078889 | Ga0070715_110788891 | 154 |
| 84 | 3300006173 | Ga0070716_100018305 | Ga0070716_1000183052 | 154 |
| 85 | 3300006173 | Ga0070716_100125825 | Ga0070716_1001258252 | 154 |
| 86 | 3300006175 | Ga0070712_100173556 | Ga0070712_1001735563 | 154 |
| 87 | 3300006175 | Ga0070712_100596575 | Ga0070712_1005965751 | 154 |
| 88 | 3300006175 | Ga0070712_101421517 | Ga0070712_1014215171 | 154 |
| 89 | 3300006237 | Ga0097621_100121248 | Ga0097621_1001212483 | 154 |
| 90 | 3300006237 | Ga0097621_100585027 | Ga0097621_1005850272 | 154 |
| 91 | 3300006237 | Ga0097621_101469395 | Ga0097621_1014693951 | 154 |
| 92 | 3300006358 | Ga0068871_100868168 | Ga0068871_1008681682 | 154 |
| 93 | 3300006358 | Ga0068871_100968169 | Ga0068871_1009681692 | 154 |
| 94 | 3300007788 | Ga0099795_10234327 | Ga0099795_102343272 | 154 |
| 95 | 3300009098 | Ga0105245_10113845 | Ga0105245_101138453 | 154 |
| 96 | 3300009098 | Ga0105245_10285458 | Ga0105245_102854581 | 154 |
| 97 | 3300009148 | Ga0105243_11090780 | Ga0105243_110907802 | 154 |
| 98 | 3300009176 | Ga0105242_10002735 | Ga0105242_1000273513 | 154 |
| 99 | 3300009176 | Ga0105242_10086361 | Ga0105242_100863613 | 154 |
| 100 | 3300010159 | Ga0099796_10014855 | Ga0099796_100148552 | 154 |
| 101 | 3300013100 | Ga0157373_10452062 | Ga0157373_104520622 | 154 |
| 102 | 3300013102 | Ga0157371_10086474 | Ga0157371_100864744 | 154 |
| 103 | 3300013296 | Ga0157374_11420341 | Ga0157374_114203412 | 154 |
| 104 | 3300013297 | Ga0157378_10678848 | Ga0157378_106788482 | 154 |
| 105 | 3300013297 | Ga0157378_10869491 | Ga0157378_108694912 | 154 |
| 106 | 3300013297 | Ga0157378_11123117 | Ga0157378_111231171 | 154 |
| 107 | 3300013306 | Ga0163162_10099685 | Ga0163162_100996853 | 154 |
| 108 | 3300013307 | Ga0157372_10059349 | Ga0157372_100593492 | 154 |
| 109 | 3300013308 | Ga0157375_10567351 | Ga0157375_105673512 | 154 |
| 110 | 3300013308 | Ga0157375_11147370 | Ga0157375_111473702 | 154 |
| 111 | 3300014325 | Ga0163163_10099566 | Ga0163163_100995662 | 154 |
| 112 | 3300014745 | Ga0157377_10861047 | Ga0157377_108610471 | 154 |
| 113 | 3300014968 | Ga0157379_10190490 | Ga0157379_101904902 | 154 |
| 114 | 3300014969 | Ga0157376_10145737 | Ga0157376_101457373 | 154 |
| 115 | 3300014969 | Ga0157376_10372292 | Ga0157376_103722922 | 154 |
| 116 | 3300014969 | Ga0157376_11893531 | Ga0157376_118935312 | 154 |
| 117 | 3300021388 | Ga0213875_10078673 | Ga0213875_100786733 | 154 |
| 118 | 3300021388 | Ga0213875_10217964 | Ga0213875_102179642 | 154 |
| 119 | 3300025290 | Ga0207673_1017564 | Ga0207673_10175642 | 154 |
| 120 | 3300025315 | Ga0207697_10006579 | Ga0207697_100065794 | 154 |
| 121 | 3300025898 | Ga0207692_10395941 | Ga0207692_103959412 | 154 |
| 122 | 3300025901 | Ga0207688_10002365 | Ga0207688_100023654 | 154 |
| 123 | 3300025904 | Ga0207647_10222456 | Ga0207647_102224562 | 154 |
| 124 | 3300025905 | Ga0207685_10327812 | Ga0207685_103278122 | 154 |
| 125 | 3300025907 | Ga0207645_10002801 | Ga0207645_1000280112 | 154 |
| 126 | 3300025910 | Ga0207684_10032147 | Ga0207684_100321474 | 154 |
| 127 | 3300025922 | Ga0207646_10115684 | Ga0207646_101156844 | 154 |
| 128 | 3300025923 | Ga0207681_10350678 | Ga0207681_103506782 | 154 |
| 129 | 3300025923 | Ga0207681_10652177 | Ga0207681_106521772 | 154 |
| 130 | 3300025925 | Ga0207650_10077551 | Ga0207650_100775512 | 154 |
| 131 | 3300025927 | Ga0207687_10411324 | Ga0207687_104113242 | 154 |
| 132 | 3300025928 | Ga0207700_10045143 | Ga0207700_100451433 | 154 |
| 133 | 3300025931 | Ga0207644_10134839 | Ga0207644_101348393 | 154 |
| 134 | 3300025933 | Ga0207706_10006891 | Ga0207706_100068916 | 154 |
| 135 | 3300025934 | Ga0207686_10052544 | Ga0207686_100525443 | 154 |
| 136 | 3300025934 | Ga0207686_10168328 | Ga0207686_101683282 | 154 |
| 137 | 3300025936 | Ga0207670_10123863 | Ga0207670_101238633 | 154 |
| 138 | 3300025936 | Ga0207670_10406404 | Ga0207670_104064042 | 154 |
| 139 | 3300025937 | Ga0207669_10147779 | Ga0207669_101477792 | 154 |
| 140 | 3300025938 | Ga0207704_10140919 | Ga0207704_101409192 | 154 |
| 141 | 3300025939 | Ga0207665_10010103 | Ga0207665_100101031 | 154 |
| 142 | 3300025939 | Ga0207665_10125941 | Ga0207665_101259412 | 154 |
| 143 | 3300025939 | Ga0207665_10203435 | Ga0207665_102034351 | 154 |
| 144 | 3300025940 | Ga0207691_10000861 | Ga0207691_1000086124 | 154 |
| 145 | 3300025942 | Ga0207689_11312552 | Ga0207689_113125522 | 154 |
| 146 | 3300025949 | Ga0207667_10367825 | Ga0207667_103678252 | 154 |
| 147 | 3300025960 | Ga0207651_10181626 | Ga0207651_101816262 | 154 |
| 148 | 3300025986 | Ga0207658_10115228 | Ga0207658_101152283 | 154 |
| 149 | 3300025986 | Ga0207658_11994307 | Ga0207658_119943071 | 154 |
| 150 | 3300026023 | Ga0207677_10032232 | Ga0207677_100322323 | 154 |
| 151 | 3300026089 | Ga0207648_10936414 | Ga0207648_109364142 | 154 |
| 152 | 3300026118 | Ga0207675_100484603 | Ga0207675_1004846032 | 154 |
| 153 | 3300026121 | Ga0207683_10013132 | Ga0207683_100131323 | 154 |
| 154 | 3300028379 | Ga0268266_10254821 | Ga0268266_102548212 | 154 |
| 155 | 3300028380 | Ga0268265_11072581 | Ga0268265_110725812 | 154 |
| 156 | 3300031456 | Ga0307513_10013707 | Ga0307513_100137073 | 154 |
| 157 | 3300035089 | Ga0373944_0080907 | Ga0373944_0080907_569_1033 | 154 |
| 158 | 3300035111 | Ga0373923_0367655 | Ga0373923_0367655_202_666 | 154 |
| 159 | 3300035170 | Ga0373943_0054519 | Ga0373943_0054519_114_578 | 154 |
| 160 | 3300035170 | Ga0373943_0491528 | Ga0373943_0491528_62_526 | 154 |
| 161 | 3300035171 | Ga0373946_0420253 | Ga0373946_0420253_127_591 | 154 |
| 162 | 3300035695 | Ga0373927_0499945 | Ga0373927_0499945_322_786 | 154 |
| 163 | 3300035725 | Ga0373947_0053762 | Ga0373947_0053762_427_891 | 154 |
| 164 | 3300035725 | Ga0373947_0147747 | Ga0373947_0147747_960_1424 | 154 |
| 165 | 3300037068 | Ga0373925_0040387 | Ga0373925_0040387_820_1284 | 154 |
| 166 | 3300037853 | Ga0436364_0941594 | Ga0436364_0941594_528_998 | 154 |
| 167 | 3300037853 | Ga0436364_1177641 | Ga0436364_1177641_1828_2298 | 154 |
| 168 | 3300041512 | Ga0451853_0846236 | Ga0451853_0846236_382_846 | 154 |
| 169 | 3300046539 | Ga0495621_0037264 | Ga0495621_0037264_413_877 | 154 |
| 170 | 3300046674 | Ga0495588_0493913 | Ga0495588_0493913_21_485 | 154 |
| 171 | 3300046690 | Ga0495624_0181369 | Ga0495624_0181369_466_930 | 154 |
| 172 | 3300048903 | Ga0496100_0017778 | Ga0496100_0017778_1091_1555 | 154 |
| 173 | 3300048904 | Ga0496101_0001941 | Ga0496101_0001941_2643_3107 | 154 |
| 174 | 3300048905 | Ga0496102_0044189 | Ga0496102_0044189_1876_2340 | 154 |
| 175 | 3300048906 | Ga0496103_0028192 | Ga0496103_0028192_207_671 | 154 |
| 176 | 3300048909 | Ga0496106_0002667 | Ga0496106_0002667_9789_10253 | 154 |
| 177 | 3300048910 | Ga0496107_0012424 | Ga0496107_0012424_831_1295 | 154 |
| 178 | 3300048911 | Ga0496108_0035982 | Ga0496108_0035982_484_948 | 154 |
| 179 | 3300048916 | Ga0496113_0288505 | Ga0496113_0288505_585_1049 | 154 |
| 180 | 3300048918 | Ga0496115_0004034 | Ga0496115_0004034_1726_2190 | 154 |
| 181 | 3300050513 | nmdc:mga0rr50_305660_c1 | nmdc:mga0rr50_305660_c1_484_948 | 154 |
| 182 | 2162886012 | MBSR1b_contig_380009 | MBSR1b_0576.00001730 | 155 |
| 183 | 3300005293 | Ga0065715_10564032 | Ga0065715_105640321 | 155 |
| 184 | 3300005347 | Ga0070668_100103841 | Ga0070668_1001038412 | 155 |
| 185 | 3300005355 | Ga0070671_100041285 | Ga0070671_1000412855 | 155 |
| 186 | 3300005355 | Ga0070671_100469024 | Ga0070671_1004690242 | 155 |
| 187 | 3300005435 | Ga0070714_100113385 | Ga0070714_1001133852 | 155 |
| 188 | 3300005437 | Ga0070710_10599793 | Ga0070710_105997932 | 155 |
| 189 | 3300005445 | Ga0070708_100193746 | Ga0070708_1001937463 | 155 |
| 190 | 3300005445 | Ga0070708_100267026 | Ga0070708_1002670261 | 155 |
| 191 | 3300005445 | Ga0070708_100350455 | Ga0070708_1003504552 | 155 |
| 192 | 3300005445 | Ga0070708_100422672 | Ga0070708_1004226722 | 155 |
| 193 | 3300005445 | Ga0070708_100449834 | Ga0070708_1004498342 | 155 |
| 194 | 3300005445 | Ga0070708_101234205 | Ga0070708_1012342051 | 155 |
| 195 | 3300005445 | Ga0070708_101274003 | Ga0070708_1012740032 | 155 |
| 196 | 3300005457 | Ga0070662_100230825 | Ga0070662_1002308252 | 155 |
| 197 | 3300005467 | Ga0070706_100000012 | Ga0070706_10000001234 | 155 |
| 198 | 3300005467 | Ga0070706_100094219 | Ga0070706_1000942193 | 155 |
| 199 | 3300005467 | Ga0070706_100631624 | Ga0070706_1006316243 | 155 |
| 200 | 3300005467 | Ga0070706_100930194 | Ga0070706_1009301941 | 155 |
| 201 | 3300005467 | Ga0070706_100982107 | Ga0070706_1009821071 | 155 |
| 202 | 3300005468 | Ga0070707_100002059 | Ga0070707_1000020594 | 155 |
| 203 | 3300005468 | Ga0070707_100002852 | Ga0070707_1000028527 | 155 |
| 204 | 3300005468 | Ga0070707_100045262 | Ga0070707_1000452625 | 155 |
| 205 | 3300005468 | Ga0070707_100074633 | Ga0070707_1000746333 | 155 |
| 206 | 3300005468 | Ga0070707_100240623 | Ga0070707_1002406232 | 155 |
| 207 | 3300005468 | Ga0070707_100730472 | Ga0070707_1007304722 | 155 |
| 208 | 3300005471 | Ga0070698_100013365 | Ga0070698_1000133656 | 155 |
| 209 | 3300005471 | Ga0070698_100017848 | Ga0070698_1000178486 | 155 |
| 210 | 3300005471 | Ga0070698_100065392 | Ga0070698_1000653926 | 155 |
| 211 | 3300005471 | Ga0070698_100470598 | Ga0070698_1004705981 | 155 |
| 212 | 3300005518 | Ga0070699_100469114 | Ga0070699_1004691142 | 155 |
| 213 | 3300005518 | Ga0070699_100745312 | Ga0070699_1007453122 | 155 |
| 214 | 3300005518 | Ga0070699_100903610 | Ga0070699_1009036102 | 155 |
| 215 | 3300005536 | Ga0070697_100004210 | Ga0070697_1000042101 | 155 |
| 216 | 3300005536 | Ga0070697_100010757 | Ga0070697_1000107574 | 155 |
| 217 | 3300005536 | Ga0070697_100021032 | Ga0070697_1000210322 | 155 |
| 218 | 3300005536 | Ga0070697_100033215 | Ga0070697_1000332153 | 155 |
| 219 | 3300005536 | Ga0070697_100058000 | Ga0070697_1000580002 | 155 |
| 220 | 3300005536 | Ga0070697_100067029 | Ga0070697_1000670292 | 155 |
| 221 | 3300005536 | Ga0070697_100089781 | Ga0070697_1000897813 | 155 |
| 222 | 3300005536 | Ga0070697_100213717 | Ga0070697_1002137172 | 155 |
| 223 | 3300005536 | Ga0070697_100699698 | Ga0070697_1006996981 | 155 |
| 224 | 3300005536 | Ga0070697_100788442 | Ga0070697_1007884422 | 155 |
| 225 | 3300005536 | Ga0070697_101312229 | Ga0070697_1013122291 | 155 |
| 226 | 3300005545 | Ga0070695_100103967 | Ga0070695_1001039671 | 155 |
| 227 | 3300005547 | Ga0070693_100976467 | Ga0070693_1009764671 | 155 |
| 228 | 3300005549 | Ga0070704_101216997 | Ga0070704_1012169972 | 155 |
| 229 | 3300005618 | Ga0068864_101427368 | Ga0068864_1014273681 | 155 |
| 230 | 3300005985 | Ga0081539_10000710 | Ga0081539_1000071053 | 155 |
| 231 | 3300005985 | Ga0081539_10008904 | Ga0081539_100089043 | 155 |
| 232 | 3300005985 | Ga0081539_10049135 | Ga0081539_100491352 | 155 |
| 233 | 3300005985 | Ga0081539_10164903 | Ga0081539_101649031 | 155 |
| 234 | 3300006028 | Ga0070717_10000538 | Ga0070717_1000053823 | 155 |
| 235 | 3300006028 | Ga0070717_10289249 | Ga0070717_102892492 | 155 |
| 236 | 3300006175 | Ga0070712_100707116 | Ga0070712_1007071162 | 155 |
| 237 | 3300006175 | Ga0070712_100872740 | Ga0070712_1008727401 | 155 |
| 238 | 3300006914 | Ga0075436_100671947 | Ga0075436_1006719472 | 155 |
| 239 | 3300007265 | Ga0099794_10162055 | Ga0099794_101620552 | 155 |
| 240 | 3300009098 | Ga0105245_10770761 | Ga0105245_107707612 | 155 |
| 241 | 3300009098 | Ga0105245_12205174 | Ga0105245_122051741 | 155 |
| 242 | 3300009545 | Ga0105237_10257963 | Ga0105237_102579632 | 155 |
| 243 | 3300010375 | Ga0105239_11464661 | Ga0105239_114646612 | 155 |
| 244 | 3300013296 | Ga0157374_10100492 | Ga0157374_101004922 | 155 |
| 245 | 3300013296 | Ga0157374_11062759 | Ga0157374_110627591 | 155 |
| 246 | 3300013297 | Ga0157378_10034971 | Ga0157378_100349712 | 155 |
| 247 | 3300013297 | Ga0157378_10066801 | Ga0157378_100668012 | 155 |
| 248 | 3300013297 | Ga0157378_10373084 | Ga0157378_103730842 | 155 |
| 249 | 3300013297 | Ga0157378_10542265 | Ga0157378_105422651 | 155 |
| 250 | 3300013297 | Ga0157378_10812335 | Ga0157378_108123352 | 155 |
| 251 | 3300013297 | Ga0157378_11590855 | Ga0157378_115908552 | 155 |
| 252 | 3300013307 | Ga0157372_10067536 | Ga0157372_100675364 | 155 |
| 253 | 3300025910 | Ga0207684_10000028 | Ga0207684_10000028163 | 155 |
| 254 | 3300025910 | Ga0207684_10003057 | Ga0207684_100030572 | 155 |
| 255 | 3300025910 | Ga0207684_10030448 | Ga0207684_100304484 | 155 |
| 256 | 3300025910 | Ga0207684_10076553 | Ga0207684_100765533 | 155 |
| 257 | 3300025922 | Ga0207646_10004616 | Ga0207646_100046169 | 155 |
| 258 | 3300025922 | Ga0207646_10020596 | Ga0207646_100205966 | 155 |
| 259 | 3300025922 | Ga0207646_10046665 | Ga0207646_100466653 | 155 |
| 260 | 3300025922 | Ga0207646_10282681 | Ga0207646_102826813 | 155 |
| 261 | 3300025922 | Ga0207646_10342621 | Ga0207646_103426211 | 155 |
| 262 | 3300025922 | Ga0207646_10514642 | Ga0207646_105146422 | 155 |
| 263 | 3300025922 | Ga0207646_10728307 | Ga0207646_107283072 | 155 |
| 264 | 3300025923 | Ga0207681_10082286 | Ga0207681_100822863 | 155 |
| 265 | 3300025927 | Ga0207687_10163030 | Ga0207687_101630302 | 155 |
| 266 | 3300025929 | Ga0207664_10106906 | Ga0207664_101069062 | 155 |
| 267 | 3300025931 | Ga0207644_10098714 | Ga0207644_100987142 | 155 |
| 268 | 3300025933 | Ga0207706_10217966 | Ga0207706_102179662 | 155 |
| 269 | 3300025937 | Ga0207669_10389234 | Ga0207669_103892341 | 155 |
| 270 | 3300025939 | Ga0207665_10287472 | Ga0207665_102874721 | 155 |
| 271 | 3300025986 | Ga0207658_10114194 | Ga0207658_101141942 | 155 |
| 272 | 3300026023 | Ga0207677_10174778 | Ga0207677_101747782 | 155 |
| 273 | 3300026023 | Ga0207677_10382591 | Ga0207677_103825911 | 155 |
| 274 | 3300026089 | Ga0207648_10660681 | Ga0207648_106606812 | 155 |
| 275 | 3300035692 | Ga0373935_0065687 | Ga0373935_0065687_1096_1563 | 155 |
| 276 | 3300035695 | Ga0373927_0202300 | Ga0373927_0202300_701_1168 | 155 |
| 277 | 3300046535 | Ga0495586_0630476 | Ga0495586_0630476_35_502 | 155 |
| 278 | 3300048915 | Ga0496112_0312693 | Ga0496112_0312693_997_1464 | 155 |
| 279 | 3300050514 | nmdc:mga08x19_153166_c1 | nmdc:mga08x19_153166_c1_238_714 | 155 |
| 280 | 3300050514 | nmdc:mga08x19_33599_c1 | nmdc:mga08x19_33599_c1_2084_2566 | 155 |
| 281 | 3300050514 | nmdc:mga08x19_957312_c1 | nmdc:mga08x19_957312_c1_112_588 | 155 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mb0-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ | 0.8265 | 15 | 135 |
| 4hnr-assembly1.cif.gz_A | high resolution structure of chemotaxis response regulator chey4 of vibrio cholerae | 0.8263 | 14 | 134 |
| 1m5t-assembly1.cif.gz_A | crystal structure of the response regulator divk | 0.8241 | 15 | 135 |
| 1mb3-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ | 0.8232 | 15 | 135 |
| 1m5u-assembly1.cif.gz_A | crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form | 0.8222 | 15 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c97A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8745 | 16 | 64 | 3.40.50.2300 |
| af_P0A9Q1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8345 | 17 | 101 | 3.40.50.2300 |
| 4hnrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8263 | 14 | 134 | 3.40.50.2300 |
| 1m5uA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8222 | 15 | 135 | 3.40.50.2300 |
| af_P38684_4_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8145 | 17 | 101 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8I6I8-F1-model_v4 | Response regulatory domain-containing protein | 0.945 | 28 | 139 |
|
| AF-A0A3N5SJ96-F1-model_v4 | Response regulator | 0.9281 | 14 | 153 |
GO:0000160
|
| AF-A0A832DBV9-F1-model_v4 | Response regulatory domain-containing protein | 0.9274 | 12 | 133 |
|
| AF-A0A2N2LP17-F1-model_v4 | Response regulatory domain-containing protein | 0.9272 | 14 | 125 |
|
| AF-A0A2V6PRV4-F1-model_v4 | Response regulatory domain-containing protein | 0.9244 | 12 | 153 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar