F384199

General Info

Members Datasets Scaffolds Average Seq Length
281 147 281 155

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10049135|Ga0081539_100491352
Length 178
Sequence MPISIPVCGLIFRKTHSVNMFNSDQDHHETTFFDLGDNTALVCVDHQQYQKVIVPQLIDMTYKVHLGLFEEDVLLKLKTYAYDVVVVYENFKGSTLQTNPILAELTQRPDAQRRQHFVVLISHRFATNDAMSAFVNSVDQVINIGDLTNLKPVLRRGVAQHRELYNAFNEMLKSVQSL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.56
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_380009 2162886012 Bacteria 1534
2 CNXas_1000153 3300000545 Bacteria 11863
3 JGI24034J26672_10068646 3300002239 Unclassified 632
4 JGI25406J46586_10000090 3300003203 Bacteria 41533
5 Ga0065712_10116465 3300005290 Bacteria 1735
6 Ga0065715_10564032 3300005293 Bacteria 732
7 Ga0065707_10063178 3300005295 Unclassified 625
8 Ga0070676_10926800 3300005328 Unclassified 650
9 Ga0070670_100060306 3300005331 Bacteria 3257
10 Ga0070666_10178775 3300005335 Unclassified 1487
11 Ga0070689_100047157 3300005340 Bacteria 3322
12 Ga0070689_100591091 3300005340 Unclassified 960
13 Ga0070668_100008283 3300005347 Bacteria 7716
14 Ga0070668_100103841 3300005347 Unclassified 2255
15 Ga0070668_101268942 3300005347 Bacteria 669
16 Ga0070669_100032142 3300005353 Bacteria 3790
17 Ga0070669_101339710 3300005353 Unclassified 620
18 Ga0070675_100150306 3300005354 Bacteria 1996
19 Ga0070671_100041285 3300005355 Bacteria 3833
20 Ga0070671_100100374 3300005355 Bacteria 2428
21 Ga0070671_100469024 3300005355 Bacteria 1081
22 Ga0070673_100187250 3300005364 Unclassified 1775
23 Ga0070673_101272891 3300005364 Unclassified 690
24 Ga0070688_100114199 3300005365 Unclassified 1800
25 Ga0070688_100762603 3300005365 Unclassified 754
26 Ga0070688_101042685 3300005365 Unclassified 651
27 Ga0070667_100109276 3300005367 Bacteria 2396
28 Ga0070667_102192685 3300005367 Unclassified 520
29 Ga0070709_10252823 3300005434 Bacteria 1270
30 Ga0070709_10504464 3300005434 Unclassified 919
31 Ga0070714_100113385 3300005435 Bacteria 2404
32 Ga0070714_100986426 3300005435 Unclassified 819
33 Ga0070713_100373874 3300005436 Bacteria 1326
34 Ga0070713_102377233 3300005436 Unclassified 512
35 Ga0070710_10139238 3300005437 Bacteria 1486
36 Ga0070710_10324646 3300005437 Unclassified 1011
37 Ga0070710_10518370 3300005437 Bacteria 818
38 Ga0070710_10599793 3300005437 Unclassified 766
39 Ga0070710_11424999 3300005437 Unclassified 518
40 Ga0070711_100200866 3300005439 Bacteria 1538
41 Ga0070711_100349063 3300005439 Unclassified 1189
42 Ga0070711_100366514 3300005439 Unclassified 1161
43 Ga0070711_100618811 3300005439 Unclassified 905
44 Ga0070705_100345957 3300005440 Bacteria 1082
45 Ga0070705_101663547 3300005440 Unclassified 539
46 Ga0070694_100175862 3300005444 Bacteria 1580
47 Ga0070708_100004119 3300005445 Bacteria 11411
48 Ga0070708_100193746 3300005445 Unclassified 1901
49 Ga0070708_100267026 3300005445 Unclassified 1609
50 Ga0070708_100350455 3300005445 Bacteria 1391
51 Ga0070708_100422672 3300005445 Unclassified 1257
52 Ga0070708_100449834 3300005445 Unclassified 1215
53 Ga0070708_100910614 3300005445 Unclassified 826
54 Ga0070708_101234205 3300005445 Unclassified 699
55 Ga0070708_101274003 3300005445 Unclassified 687
56 Ga0070663_101556018 3300005455 Unclassified 589
57 Ga0070662_100230825 3300005457 Unclassified 1480
58 Ga0068867_101198966 3300005459 Unclassified 697
59 Ga0070706_100000012 3300005467 Bacteria 195040
60 Ga0070706_100008143 3300005467 Bacteria 9778
61 Ga0070706_100094219 3300005467 Unclassified 2779
62 Ga0070706_100631624 3300005467 Unclassified 994
63 Ga0070706_100848886 3300005467 Unclassified 844
64 Ga0070706_100930194 3300005467 Bacteria 803
65 Ga0070706_100982107 3300005467 Unclassified 779
66 Ga0070707_100002059 3300005468 Bacteria 19267
67 Ga0070707_100002852 3300005468 Bacteria 16454
68 Ga0070707_100045262 3300005468 Bacteria 4212
69 Ga0070707_100074633 3300005468 Bacteria 3270
70 Ga0070707_100084158 3300005468 Bacteria 3073
71 Ga0070707_100240623 3300005468 Unclassified 1762
72 Ga0070707_100730472 3300005468 Unclassified 953
73 Ga0070707_101925599 3300005468 Unclassified 559
74 Ga0070698_100013365 3300005471 Bacteria 8691
75 Ga0070698_100017848 3300005471 Bacteria 7476
76 Ga0070698_100065392 3300005471 Bacteria 3662
77 Ga0070698_100105072 3300005471 Bacteria 2794
78 Ga0070698_100470598 3300005471 Bacteria 1193
79 Ga0070699_100013795 3300005518 Bacteria 6951
80 Ga0070699_100469114 3300005518 Unclassified 1142
81 Ga0070699_100745312 3300005518 Unclassified 896
82 Ga0070699_100903610 3300005518 Bacteria 809
83 Ga0070679_100157711 3300005530 Bacteria 2244
84 Ga0070697_100004210 3300005536 Bacteria 11022
85 Ga0070697_100010757 3300005536 Bacteria 7144
86 Ga0070697_100021032 3300005536 Bacteria 5166
87 Ga0070697_100033215 3300005536 Bacteria 4155
88 Ga0070697_100058000 3300005536 Bacteria 3150
89 Ga0070697_100062795 3300005536 Unclassified 3032
90 Ga0070697_100067029 3300005536 Bacteria 2935
91 Ga0070697_100089781 3300005536 Bacteria 2539
92 Ga0070697_100213717 3300005536 Bacteria 1643
93 Ga0070697_100249540 3300005536 Bacteria 1517
94 Ga0070697_100694657 3300005536 Bacteria 897
95 Ga0070697_100699698 3300005536 Bacteria 894
96 Ga0070697_100788442 3300005536 Unclassified 840
97 Ga0070697_101312229 3300005536 Unclassified 646
98 Ga0070672_100008229 3300005543 Bacteria 7126
99 Ga0070695_100103967 3300005545 Bacteria 1917
100 Ga0070693_100746824 3300005547 Bacteria 721
101 Ga0070693_100976467 3300005547 Unclassified 639
102 Ga0070665_100258181 3300005548 Bacteria 1744
103 Ga0070704_100497070 3300005549 Bacteria 1058
104 Ga0070704_101216997 3300005549 Unclassified 687
105 Ga0068855_100770099 3300005563 Bacteria 1025
106 Ga0070702_100027125 3300005615 Bacteria 3087
107 Ga0068864_101427368 3300005618 Unclassified 694
108 Ga0068866_10124196 3300005718 Bacteria 1459
109 Ga0068861_100350170 3300005719 Bacteria 1295
110 Ga0068863_100735348 3300005841 Bacteria 982
111 Ga0068858_100852552 3300005842 Bacteria 890
112 Ga0068860_101724763 3300005843 Unclassified 648
113 Ga0081539_10000710 3300005985 Bacteria 66710
114 Ga0081539_10001036 3300005985 Bacteria 51273
115 Ga0081539_10008904 3300005985 Bacteria 8565
116 Ga0081539_10049135 3300005985 Bacteria 2396
117 Ga0081539_10164903 3300005985 Unclassified 1053
118 Ga0070717_10000538 3300006028 Bacteria 24005
119 Ga0070717_10148705 3300006028 Bacteria 2025
120 Ga0070717_10289249 3300006028 Bacteria 1455
121 Ga0070715_10067872 3300006163 Bacteria 1584
122 Ga0070715_10229867 3300006163 Unclassified 958
123 Ga0070715_11078889 3300006163 Unclassified 504
124 Ga0070716_100018305 3300006173 Unclassified 3647
125 Ga0070716_100125825 3300006173 Bacteria 1612
126 Ga0070712_100173556 3300006175 Bacteria 1674
127 Ga0070712_100596575 3300006175 Unclassified 934
128 Ga0070712_100707116 3300006175 Unclassified 859
129 Ga0070712_100872740 3300006175 Bacteria 775
130 Ga0070712_101421517 3300006175 Unclassified 605
131 Ga0097621_100121248 3300006237 Bacteria 2218
132 Ga0097621_100585027 3300006237 Unclassified 1019
133 Ga0097621_101469395 3300006237 Unclassified 646
134 Ga0068871_100868168 3300006358 Bacteria 835
135 Ga0068871_100968169 3300006358 Bacteria 791
136 Ga0075436_100671947 3300006914 Bacteria 766
137 Ga0099794_10162055 3300007265 Unclassified 1138
138 Ga0099795_10234327 3300007788 Unclassified 786
139 Ga0105245_10113845 3300009098 Bacteria 2519
140 Ga0105245_10285458 3300009098 Bacteria 1615
141 Ga0105245_10770761 3300009098 Unclassified 999
142 Ga0105245_12205174 3300009098 Unclassified 605
143 Ga0105243_11090780 3300009148 Unclassified 806
144 Ga0105242_10002735 3300009176 Bacteria 13799
145 Ga0105242_10086361 3300009176 Bacteria 2633
146 Ga0105237_10257963 3300009545 Bacteria 1746
147 Ga0099796_10014855 3300010159 Bacteria 2260
148 Ga0105239_11464661 3300010375 Unclassified 789
149 Ga0157373_10452062 3300013100 Unclassified 924
150 Ga0157371_10086474 3300013102 Bacteria 2220
151 Ga0157374_10100492 3300013296 Bacteria 2773
152 Ga0157374_11062759 3300013296 Unclassified 829
153 Ga0157374_11420341 3300013296 Unclassified 717
154 Ga0157378_10034971 3300013297 Unclassified 4443
155 Ga0157378_10066801 3300013297 Bacteria 3221
156 Ga0157378_10373084 3300013297 Bacteria 1399
157 Ga0157378_10542265 3300013297 Unclassified 1167
158 Ga0157378_10678848 3300013297 Bacteria 1048
159 Ga0157378_10812335 3300013297 Unclassified 961
160 Ga0157378_10869491 3300013297 Unclassified 931
161 Ga0157378_11123117 3300013297 Bacteria 823
162 Ga0157378_11590855 3300013297 Bacteria 699
163 Ga0163162_10099685 3300013306 Bacteria 2996
164 Ga0157372_10059349 3300013307 Bacteria 4278
165 Ga0157372_10067536 3300013307 Bacteria 4017
166 Ga0157375_10567351 3300013308 Bacteria 1296
167 Ga0157375_11147370 3300013308 Unclassified 910
168 Ga0163163_10099566 3300014325 Bacteria 2928
169 Ga0157377_10861047 3300014745 Unclassified 674
170 Ga0157379_10190490 3300014968 Bacteria 1853
171 Ga0157376_10145737 3300014969 Bacteria 2129
172 Ga0157376_10372292 3300014969 Bacteria 1373
173 Ga0157376_11893531 3300014969 Unclassified 633
174 Ga0213875_10078673 3300021388 Unclassified 1538
175 Ga0213875_10217964 3300021388 Unclassified 899
176 Ga0207673_1017564 3300025290 Bacteria 956
177 Ga0207697_10006579 3300025315 Bacteria 5244
178 Ga0207692_10395941 3300025898 Bacteria 860
179 Ga0207688_10002365 3300025901 Bacteria 10147
180 Ga0207647_10222456 3300025904 Bacteria 1088
181 Ga0207685_10327812 3300025905 Unclassified 766
182 Ga0207645_10002801 3300025907 Bacteria 13548
183 Ga0207684_10000028 3300025910 Bacteria 306450
184 Ga0207684_10003057 3300025910 Bacteria 16580
185 Ga0207684_10030448 3300025910 Bacteria 4594
186 Ga0207684_10032147 3300025910 Bacteria 4462
187 Ga0207684_10068460 3300025910 Bacteria 3017
188 Ga0207684_10076553 3300025910 Unclassified 2844
189 Ga0207646_10004616 3300025922 Bacteria 14886
190 Ga0207646_10020596 3300025922 Bacteria 6109
191 Ga0207646_10046665 3300025922 Bacteria 3886
192 Ga0207646_10115684 3300025922 Unclassified 2409
193 Ga0207646_10282681 3300025922 Bacteria 1499
194 Ga0207646_10342621 3300025922 Bacteria 1350
195 Ga0207646_10514642 3300025922 Unclassified 1078
196 Ga0207646_10728307 3300025922 Unclassified 886
197 Ga0207681_10082286 3300025923 Unclassified 2275
198 Ga0207681_10350678 3300025923 Bacteria 1181
199 Ga0207681_10652177 3300025923 Bacteria 873
200 Ga0207650_10077551 3300025925 Bacteria 2512
201 Ga0207687_10163030 3300025927 Bacteria 1713
202 Ga0207687_10411324 3300025927 Unclassified 1114
203 Ga0207700_10045143 3300025928 Bacteria 3249
204 Ga0207664_10106906 3300025929 Bacteria 2321
205 Ga0207644_10098714 3300025931 Bacteria 2190
206 Ga0207644_10134839 3300025931 Bacteria 1894
207 Ga0207706_10006891 3300025933 Bacteria 10507
208 Ga0207706_10217966 3300025933 Unclassified 1672
209 Ga0207686_10052544 3300025934 Bacteria 2544
210 Ga0207686_10168328 3300025934 Bacteria 1543
211 Ga0207670_10123863 3300025936 Bacteria 1883
212 Ga0207670_10406404 3300025936 Unclassified 1090
213 Ga0207669_10147779 3300025937 Bacteria 1641
214 Ga0207669_10389234 3300025937 Unclassified 1089
215 Ga0207704_10140919 3300025938 Bacteria 1686
216 Ga0207665_10010103 3300025939 Bacteria 6198
217 Ga0207665_10125941 3300025939 Bacteria 1814
218 Ga0207665_10203435 3300025939 Bacteria 1444
219 Ga0207665_10287472 3300025939 Unclassified 1225
220 Ga0207665_10748467 3300025939 Bacteria 770
221 Ga0207691_10000861 3300025940 Bacteria 30154
222 Ga0207689_11312552 3300025942 Bacteria 608
223 Ga0207667_10367825 3300025949 Bacteria 1466
224 Ga0207651_10181626 3300025960 Bacteria 1669
225 Ga0207658_10114194 3300025986 Unclassified 2141
226 Ga0207658_10115228 3300025986 Bacteria 2132
227 Ga0207658_11994307 3300025986 Unclassified 528
228 Ga0207677_10032232 3300026023 Bacteria 3366
229 Ga0207677_10174778 3300026023 Bacteria 1683
230 Ga0207677_10382591 3300026023 Bacteria 1188
231 Ga0207648_10660681 3300026089 Bacteria 966
232 Ga0207648_10936414 3300026089 Unclassified 810
233 Ga0207675_100484603 3300026118 Bacteria 1229
234 Ga0207683_10013132 3300026121 Bacteria 7065
235 Ga0268266_10254821 3300028379 Bacteria 1624
236 Ga0268265_11072581 3300028380 Bacteria 799
237 Ga0307513_10013707 3300031456 Bacteria 9941
238 Ga0373944_0080907 3300035089 Unclassified 1073
239 Ga0373923_0367655 3300035111 Unclassified 689
240 Ga0373943_0054519 3300035170 Bacteria 1978
241 Ga0373943_0491528 3300035170 Unclassified 716
242 Ga0373946_0420253 3300035171 Unclassified 677
243 Ga0373955_0339776 3300035172 Bacteria 908
244 Ga0373924_0146046 3300035410 Bacteria 1033
245 Ga0373935_0065687 3300035692 Bacteria 2329
246 Ga0373927_0202300 3300035695 Bacteria 1304
247 Ga0373927_0499945 3300035695 Unclassified 803
248 Ga0373947_0053762 3300035725 Unclassified 2429
249 Ga0373947_0147747 3300035725 Unclassified 1512
250 Ga0373937_0070735 3300036401 Bacteria 3218
251 Ga0373925_0040387 3300037068 Bacteria 3454
252 Ga0395900_0096416 3300037418 Bacteria 3039
253 Ga0436364_0941594 3300037853 Bacteria 1783
254 Ga0436364_1177641 3300037853 Bacteria 2348
255 Ga0451853_0846236 3300041512 Unclassified 1123
256 Ga0495651_0019333 3300046462 Bacteria 5280
257 Ga0495630_0093650 3300046517 Bacteria 2271
258 Ga0495652_0173870 3300046529 Bacteria 1660
259 Ga0495640_0234841 3300046533 Bacteria 1152
260 Ga0495586_0630476 3300046535 Bacteria 619
261 Ga0495621_0037264 3300046539 Bacteria 1691
262 Ga0495645_0184460 3300046543 Bacteria 1427
263 Ga0495588_0493913 3300046674 Bacteria 642
264 Ga0495623_0288890 3300046679 Bacteria 910
265 Ga0495613_0287169 3300046689 Bacteria 1141
266 Ga0495624_0181369 3300046690 Unclassified 1283
267 Ga0495604_0216959 3300047317 Bacteria 1319
268 Ga0496100_0017778 3300048903 Bacteria 4205
269 Ga0496101_0001941 3300048904 Bacteria 12525
270 Ga0496102_0044189 3300048905 Bacteria 4042
271 Ga0496103_0028192 3300048906 Bacteria 3406
272 Ga0496106_0002667 3300048909 Bacteria 13285
273 Ga0496107_0012424 3300048910 Bacteria 5945
274 Ga0496108_0035982 3300048911 Bacteria 4118
275 Ga0496112_0312693 3300048915 Unclassified 1516
276 Ga0496113_0288505 3300048916 Bacteria 1313
277 Ga0496115_0004034 3300048918 Bacteria 10601
278 nmdc:mga0rr50_305660_c1 3300050513 Bacteria 1331
279 nmdc:mga08x19_153166_c1 3300050514 Bacteria 1562
280 nmdc:mga08x19_33599_c1 3300050514 Bacteria 3237
281 nmdc:mga08x19_957312_c1 3300050514 Unclassified 608

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10748467 Ga0207665_107484672 135
2 3300005468 Ga0070707_101925599 Ga0070707_1019255991 149
3 3300035172 Ga0373955_0339776 Ga0373955_0339776_407_862 151
4 3300035410 Ga0373924_0146046 Ga0373924_0146046_280_735 151
5 3300036401 Ga0373937_0070735 Ga0373937_0070735_1983_2438 151
6 3300046462 Ga0495651_0019333 Ga0495651_0019333_637_1092 151
7 3300046517 Ga0495630_0093650 Ga0495630_0093650_1162_1617 151
8 3300046529 Ga0495652_0173870 Ga0495652_0173870_148_603 151
9 3300046533 Ga0495640_0234841 Ga0495640_0234841_617_1072 151
10 3300046543 Ga0495645_0184460 Ga0495645_0184460_187_642 151
11 3300046679 Ga0495623_0288890 Ga0495623_0288890_47_502 151
12 3300046689 Ga0495613_0287169 Ga0495613_0287169_635_1090 151
13 3300047317 Ga0495604_0216959 Ga0495604_0216959_105_560 151
14 3300005445 Ga0070708_100004119 Ga0070708_10000411911 153
15 3300025910 Ga0207684_10068460 Ga0207684_100684604 153
16 3300037418 Ga0395900_0096416 Ga0395900_0096416_1395_1856 153
17 3300000545 CNXas_1000153 CNXas_10001536 154
18 3300002239 JGI24034J26672_10068646 JGI24034J26672_100686462 154
19 3300003203 JGI25406J46586_10000090 JGI25406J46586_1000009030 154
20 3300005290 Ga0065712_10116465 Ga0065712_101164652 154
21 3300005295 Ga0065707_10063178 Ga0065707_100631781 154
22 3300005328 Ga0070676_10926800 Ga0070676_109268001 154
23 3300005331 Ga0070670_100060306 Ga0070670_1000603063 154
24 3300005335 Ga0070666_10178775 Ga0070666_101787752 154
25 3300005340 Ga0070689_100047157 Ga0070689_1000471571 154
26 3300005340 Ga0070689_100591091 Ga0070689_1005910911 154
27 3300005347 Ga0070668_100008283 Ga0070668_1000082833 154
28 3300005347 Ga0070668_101268942 Ga0070668_1012689421 154
29 3300005353 Ga0070669_100032142 Ga0070669_1000321422 154
30 3300005353 Ga0070669_101339710 Ga0070669_1013397102 154
31 3300005354 Ga0070675_100150306 Ga0070675_1001503062 154
32 3300005355 Ga0070671_100100374 Ga0070671_1001003744 154
33 3300005364 Ga0070673_100187250 Ga0070673_1001872502 154
34 3300005364 Ga0070673_101272891 Ga0070673_1012728912 154
35 3300005365 Ga0070688_100114199 Ga0070688_1001141993 154
36 3300005365 Ga0070688_100762603 Ga0070688_1007626032 154
37 3300005365 Ga0070688_101042685 Ga0070688_1010426851 154
38 3300005367 Ga0070667_100109276 Ga0070667_1001092763 154
39 3300005367 Ga0070667_102192685 Ga0070667_1021926851 154
40 3300005434 Ga0070709_10252823 Ga0070709_102528231 154
41 3300005434 Ga0070709_10504464 Ga0070709_105044642 154
42 3300005435 Ga0070714_100986426 Ga0070714_1009864262 154
43 3300005436 Ga0070713_100373874 Ga0070713_1003738741 154
44 3300005436 Ga0070713_102377233 Ga0070713_1023772331 154
45 3300005437 Ga0070710_10139238 Ga0070710_101392382 154
46 3300005437 Ga0070710_10324646 Ga0070710_103246462 154
47 3300005437 Ga0070710_10518370 Ga0070710_105183702 154
48 3300005437 Ga0070710_11424999 Ga0070710_114249991 154
49 3300005439 Ga0070711_100200866 Ga0070711_1002008662 154
50 3300005439 Ga0070711_100349063 Ga0070711_1003490632 154
51 3300005439 Ga0070711_100366514 Ga0070711_1003665142 154
52 3300005439 Ga0070711_100618811 Ga0070711_1006188112 154
53 3300005440 Ga0070705_100345957 Ga0070705_1003459571 154
54 3300005440 Ga0070705_101663547 Ga0070705_1016635471 154
55 3300005444 Ga0070694_100175862 Ga0070694_1001758622 154
56 3300005445 Ga0070708_100910614 Ga0070708_1009106142 154
57 3300005455 Ga0070663_101556018 Ga0070663_1015560181 154
58 3300005459 Ga0068867_101198966 Ga0068867_1011989661 154
59 3300005467 Ga0070706_100008143 Ga0070706_1000081433 154
60 3300005467 Ga0070706_100848886 Ga0070706_1008488861 154
61 3300005468 Ga0070707_100084158 Ga0070707_1000841582 154
62 3300005471 Ga0070698_100105072 Ga0070698_1001050721 154
63 3300005518 Ga0070699_100013795 Ga0070699_1000137954 154
64 3300005530 Ga0070679_100157711 Ga0070679_1001577114 154
65 3300005536 Ga0070697_100062795 Ga0070697_1000627954 154
66 3300005536 Ga0070697_100249540 Ga0070697_1002495402 154
67 3300005536 Ga0070697_100694657 Ga0070697_1006946572 154
68 3300005543 Ga0070672_100008229 Ga0070672_1000082294 154
69 3300005547 Ga0070693_100746824 Ga0070693_1007468241 154
70 3300005548 Ga0070665_100258181 Ga0070665_1002581814 154
71 3300005549 Ga0070704_100497070 Ga0070704_1004970702 154
72 3300005563 Ga0068855_100770099 Ga0068855_1007700992 154
73 3300005615 Ga0070702_100027125 Ga0070702_1000271251 154
74 3300005718 Ga0068866_10124196 Ga0068866_101241962 154
75 3300005719 Ga0068861_100350170 Ga0068861_1003501702 154
76 3300005841 Ga0068863_100735348 Ga0068863_1007353482 154
77 3300005842 Ga0068858_100852552 Ga0068858_1008525522 154
78 3300005843 Ga0068860_101724763 Ga0068860_1017247631 154
79 3300005985 Ga0081539_10001036 Ga0081539_1000103635 154
80 3300006028 Ga0070717_10148705 Ga0070717_101487054 154
81 3300006163 Ga0070715_10067872 Ga0070715_100678722 154
82 3300006163 Ga0070715_10229867 Ga0070715_102298672 154
83 3300006163 Ga0070715_11078889 Ga0070715_110788891 154
84 3300006173 Ga0070716_100018305 Ga0070716_1000183052 154
85 3300006173 Ga0070716_100125825 Ga0070716_1001258252 154
86 3300006175 Ga0070712_100173556 Ga0070712_1001735563 154
87 3300006175 Ga0070712_100596575 Ga0070712_1005965751 154
88 3300006175 Ga0070712_101421517 Ga0070712_1014215171 154
89 3300006237 Ga0097621_100121248 Ga0097621_1001212483 154
90 3300006237 Ga0097621_100585027 Ga0097621_1005850272 154
91 3300006237 Ga0097621_101469395 Ga0097621_1014693951 154
92 3300006358 Ga0068871_100868168 Ga0068871_1008681682 154
93 3300006358 Ga0068871_100968169 Ga0068871_1009681692 154
94 3300007788 Ga0099795_10234327 Ga0099795_102343272 154
95 3300009098 Ga0105245_10113845 Ga0105245_101138453 154
96 3300009098 Ga0105245_10285458 Ga0105245_102854581 154
97 3300009148 Ga0105243_11090780 Ga0105243_110907802 154
98 3300009176 Ga0105242_10002735 Ga0105242_1000273513 154
99 3300009176 Ga0105242_10086361 Ga0105242_100863613 154
100 3300010159 Ga0099796_10014855 Ga0099796_100148552 154
101 3300013100 Ga0157373_10452062 Ga0157373_104520622 154
102 3300013102 Ga0157371_10086474 Ga0157371_100864744 154
103 3300013296 Ga0157374_11420341 Ga0157374_114203412 154
104 3300013297 Ga0157378_10678848 Ga0157378_106788482 154
105 3300013297 Ga0157378_10869491 Ga0157378_108694912 154
106 3300013297 Ga0157378_11123117 Ga0157378_111231171 154
107 3300013306 Ga0163162_10099685 Ga0163162_100996853 154
108 3300013307 Ga0157372_10059349 Ga0157372_100593492 154
109 3300013308 Ga0157375_10567351 Ga0157375_105673512 154
110 3300013308 Ga0157375_11147370 Ga0157375_111473702 154
111 3300014325 Ga0163163_10099566 Ga0163163_100995662 154
112 3300014745 Ga0157377_10861047 Ga0157377_108610471 154
113 3300014968 Ga0157379_10190490 Ga0157379_101904902 154
114 3300014969 Ga0157376_10145737 Ga0157376_101457373 154
115 3300014969 Ga0157376_10372292 Ga0157376_103722922 154
116 3300014969 Ga0157376_11893531 Ga0157376_118935312 154
117 3300021388 Ga0213875_10078673 Ga0213875_100786733 154
118 3300021388 Ga0213875_10217964 Ga0213875_102179642 154
119 3300025290 Ga0207673_1017564 Ga0207673_10175642 154
120 3300025315 Ga0207697_10006579 Ga0207697_100065794 154
121 3300025898 Ga0207692_10395941 Ga0207692_103959412 154
122 3300025901 Ga0207688_10002365 Ga0207688_100023654 154
123 3300025904 Ga0207647_10222456 Ga0207647_102224562 154
124 3300025905 Ga0207685_10327812 Ga0207685_103278122 154
125 3300025907 Ga0207645_10002801 Ga0207645_1000280112 154
126 3300025910 Ga0207684_10032147 Ga0207684_100321474 154
127 3300025922 Ga0207646_10115684 Ga0207646_101156844 154
128 3300025923 Ga0207681_10350678 Ga0207681_103506782 154
129 3300025923 Ga0207681_10652177 Ga0207681_106521772 154
130 3300025925 Ga0207650_10077551 Ga0207650_100775512 154
131 3300025927 Ga0207687_10411324 Ga0207687_104113242 154
132 3300025928 Ga0207700_10045143 Ga0207700_100451433 154
133 3300025931 Ga0207644_10134839 Ga0207644_101348393 154
134 3300025933 Ga0207706_10006891 Ga0207706_100068916 154
135 3300025934 Ga0207686_10052544 Ga0207686_100525443 154
136 3300025934 Ga0207686_10168328 Ga0207686_101683282 154
137 3300025936 Ga0207670_10123863 Ga0207670_101238633 154
138 3300025936 Ga0207670_10406404 Ga0207670_104064042 154
139 3300025937 Ga0207669_10147779 Ga0207669_101477792 154
140 3300025938 Ga0207704_10140919 Ga0207704_101409192 154
141 3300025939 Ga0207665_10010103 Ga0207665_100101031 154
142 3300025939 Ga0207665_10125941 Ga0207665_101259412 154
143 3300025939 Ga0207665_10203435 Ga0207665_102034351 154
144 3300025940 Ga0207691_10000861 Ga0207691_1000086124 154
145 3300025942 Ga0207689_11312552 Ga0207689_113125522 154
146 3300025949 Ga0207667_10367825 Ga0207667_103678252 154
147 3300025960 Ga0207651_10181626 Ga0207651_101816262 154
148 3300025986 Ga0207658_10115228 Ga0207658_101152283 154
149 3300025986 Ga0207658_11994307 Ga0207658_119943071 154
150 3300026023 Ga0207677_10032232 Ga0207677_100322323 154
151 3300026089 Ga0207648_10936414 Ga0207648_109364142 154
152 3300026118 Ga0207675_100484603 Ga0207675_1004846032 154
153 3300026121 Ga0207683_10013132 Ga0207683_100131323 154
154 3300028379 Ga0268266_10254821 Ga0268266_102548212 154
155 3300028380 Ga0268265_11072581 Ga0268265_110725812 154
156 3300031456 Ga0307513_10013707 Ga0307513_100137073 154
157 3300035089 Ga0373944_0080907 Ga0373944_0080907_569_1033 154
158 3300035111 Ga0373923_0367655 Ga0373923_0367655_202_666 154
159 3300035170 Ga0373943_0054519 Ga0373943_0054519_114_578 154
160 3300035170 Ga0373943_0491528 Ga0373943_0491528_62_526 154
161 3300035171 Ga0373946_0420253 Ga0373946_0420253_127_591 154
162 3300035695 Ga0373927_0499945 Ga0373927_0499945_322_786 154
163 3300035725 Ga0373947_0053762 Ga0373947_0053762_427_891 154
164 3300035725 Ga0373947_0147747 Ga0373947_0147747_960_1424 154
165 3300037068 Ga0373925_0040387 Ga0373925_0040387_820_1284 154
166 3300037853 Ga0436364_0941594 Ga0436364_0941594_528_998 154
167 3300037853 Ga0436364_1177641 Ga0436364_1177641_1828_2298 154
168 3300041512 Ga0451853_0846236 Ga0451853_0846236_382_846 154
169 3300046539 Ga0495621_0037264 Ga0495621_0037264_413_877 154
170 3300046674 Ga0495588_0493913 Ga0495588_0493913_21_485 154
171 3300046690 Ga0495624_0181369 Ga0495624_0181369_466_930 154
172 3300048903 Ga0496100_0017778 Ga0496100_0017778_1091_1555 154
173 3300048904 Ga0496101_0001941 Ga0496101_0001941_2643_3107 154
174 3300048905 Ga0496102_0044189 Ga0496102_0044189_1876_2340 154
175 3300048906 Ga0496103_0028192 Ga0496103_0028192_207_671 154
176 3300048909 Ga0496106_0002667 Ga0496106_0002667_9789_10253 154
177 3300048910 Ga0496107_0012424 Ga0496107_0012424_831_1295 154
178 3300048911 Ga0496108_0035982 Ga0496108_0035982_484_948 154
179 3300048916 Ga0496113_0288505 Ga0496113_0288505_585_1049 154
180 3300048918 Ga0496115_0004034 Ga0496115_0004034_1726_2190 154
181 3300050513 nmdc:mga0rr50_305660_c1 nmdc:mga0rr50_305660_c1_484_948 154
182 2162886012 MBSR1b_contig_380009 MBSR1b_0576.00001730 155
183 3300005293 Ga0065715_10564032 Ga0065715_105640321 155
184 3300005347 Ga0070668_100103841 Ga0070668_1001038412 155
185 3300005355 Ga0070671_100041285 Ga0070671_1000412855 155
186 3300005355 Ga0070671_100469024 Ga0070671_1004690242 155
187 3300005435 Ga0070714_100113385 Ga0070714_1001133852 155
188 3300005437 Ga0070710_10599793 Ga0070710_105997932 155
189 3300005445 Ga0070708_100193746 Ga0070708_1001937463 155
190 3300005445 Ga0070708_100267026 Ga0070708_1002670261 155
191 3300005445 Ga0070708_100350455 Ga0070708_1003504552 155
192 3300005445 Ga0070708_100422672 Ga0070708_1004226722 155
193 3300005445 Ga0070708_100449834 Ga0070708_1004498342 155
194 3300005445 Ga0070708_101234205 Ga0070708_1012342051 155
195 3300005445 Ga0070708_101274003 Ga0070708_1012740032 155
196 3300005457 Ga0070662_100230825 Ga0070662_1002308252 155
197 3300005467 Ga0070706_100000012 Ga0070706_10000001234 155
198 3300005467 Ga0070706_100094219 Ga0070706_1000942193 155
199 3300005467 Ga0070706_100631624 Ga0070706_1006316243 155
200 3300005467 Ga0070706_100930194 Ga0070706_1009301941 155
201 3300005467 Ga0070706_100982107 Ga0070706_1009821071 155
202 3300005468 Ga0070707_100002059 Ga0070707_1000020594 155
203 3300005468 Ga0070707_100002852 Ga0070707_1000028527 155
204 3300005468 Ga0070707_100045262 Ga0070707_1000452625 155
205 3300005468 Ga0070707_100074633 Ga0070707_1000746333 155
206 3300005468 Ga0070707_100240623 Ga0070707_1002406232 155
207 3300005468 Ga0070707_100730472 Ga0070707_1007304722 155
208 3300005471 Ga0070698_100013365 Ga0070698_1000133656 155
209 3300005471 Ga0070698_100017848 Ga0070698_1000178486 155
210 3300005471 Ga0070698_100065392 Ga0070698_1000653926 155
211 3300005471 Ga0070698_100470598 Ga0070698_1004705981 155
212 3300005518 Ga0070699_100469114 Ga0070699_1004691142 155
213 3300005518 Ga0070699_100745312 Ga0070699_1007453122 155
214 3300005518 Ga0070699_100903610 Ga0070699_1009036102 155
215 3300005536 Ga0070697_100004210 Ga0070697_1000042101 155
216 3300005536 Ga0070697_100010757 Ga0070697_1000107574 155
217 3300005536 Ga0070697_100021032 Ga0070697_1000210322 155
218 3300005536 Ga0070697_100033215 Ga0070697_1000332153 155
219 3300005536 Ga0070697_100058000 Ga0070697_1000580002 155
220 3300005536 Ga0070697_100067029 Ga0070697_1000670292 155
221 3300005536 Ga0070697_100089781 Ga0070697_1000897813 155
222 3300005536 Ga0070697_100213717 Ga0070697_1002137172 155
223 3300005536 Ga0070697_100699698 Ga0070697_1006996981 155
224 3300005536 Ga0070697_100788442 Ga0070697_1007884422 155
225 3300005536 Ga0070697_101312229 Ga0070697_1013122291 155
226 3300005545 Ga0070695_100103967 Ga0070695_1001039671 155
227 3300005547 Ga0070693_100976467 Ga0070693_1009764671 155
228 3300005549 Ga0070704_101216997 Ga0070704_1012169972 155
229 3300005618 Ga0068864_101427368 Ga0068864_1014273681 155
230 3300005985 Ga0081539_10000710 Ga0081539_1000071053 155
231 3300005985 Ga0081539_10008904 Ga0081539_100089043 155
232 3300005985 Ga0081539_10049135 Ga0081539_100491352 155
233 3300005985 Ga0081539_10164903 Ga0081539_101649031 155
234 3300006028 Ga0070717_10000538 Ga0070717_1000053823 155
235 3300006028 Ga0070717_10289249 Ga0070717_102892492 155
236 3300006175 Ga0070712_100707116 Ga0070712_1007071162 155
237 3300006175 Ga0070712_100872740 Ga0070712_1008727401 155
238 3300006914 Ga0075436_100671947 Ga0075436_1006719472 155
239 3300007265 Ga0099794_10162055 Ga0099794_101620552 155
240 3300009098 Ga0105245_10770761 Ga0105245_107707612 155
241 3300009098 Ga0105245_12205174 Ga0105245_122051741 155
242 3300009545 Ga0105237_10257963 Ga0105237_102579632 155
243 3300010375 Ga0105239_11464661 Ga0105239_114646612 155
244 3300013296 Ga0157374_10100492 Ga0157374_101004922 155
245 3300013296 Ga0157374_11062759 Ga0157374_110627591 155
246 3300013297 Ga0157378_10034971 Ga0157378_100349712 155
247 3300013297 Ga0157378_10066801 Ga0157378_100668012 155
248 3300013297 Ga0157378_10373084 Ga0157378_103730842 155
249 3300013297 Ga0157378_10542265 Ga0157378_105422651 155
250 3300013297 Ga0157378_10812335 Ga0157378_108123352 155
251 3300013297 Ga0157378_11590855 Ga0157378_115908552 155
252 3300013307 Ga0157372_10067536 Ga0157372_100675364 155
253 3300025910 Ga0207684_10000028 Ga0207684_10000028163 155
254 3300025910 Ga0207684_10003057 Ga0207684_100030572 155
255 3300025910 Ga0207684_10030448 Ga0207684_100304484 155
256 3300025910 Ga0207684_10076553 Ga0207684_100765533 155
257 3300025922 Ga0207646_10004616 Ga0207646_100046169 155
258 3300025922 Ga0207646_10020596 Ga0207646_100205966 155
259 3300025922 Ga0207646_10046665 Ga0207646_100466653 155
260 3300025922 Ga0207646_10282681 Ga0207646_102826813 155
261 3300025922 Ga0207646_10342621 Ga0207646_103426211 155
262 3300025922 Ga0207646_10514642 Ga0207646_105146422 155
263 3300025922 Ga0207646_10728307 Ga0207646_107283072 155
264 3300025923 Ga0207681_10082286 Ga0207681_100822863 155
265 3300025927 Ga0207687_10163030 Ga0207687_101630302 155
266 3300025929 Ga0207664_10106906 Ga0207664_101069062 155
267 3300025931 Ga0207644_10098714 Ga0207644_100987142 155
268 3300025933 Ga0207706_10217966 Ga0207706_102179662 155
269 3300025937 Ga0207669_10389234 Ga0207669_103892341 155
270 3300025939 Ga0207665_10287472 Ga0207665_102874721 155
271 3300025986 Ga0207658_10114194 Ga0207658_101141942 155
272 3300026023 Ga0207677_10174778 Ga0207677_101747782 155
273 3300026023 Ga0207677_10382591 Ga0207677_103825911 155
274 3300026089 Ga0207648_10660681 Ga0207648_106606812 155
275 3300035692 Ga0373935_0065687 Ga0373935_0065687_1096_1563 155
276 3300035695 Ga0373927_0202300 Ga0373927_0202300_701_1168 155
277 3300046535 Ga0495586_0630476 Ga0495586_0630476_35_502 155
278 3300048915 Ga0496112_0312693 Ga0496112_0312693_997_1464 155
279 3300050514 nmdc:mga08x19_153166_c1 nmdc:mga08x19_153166_c1_238_714 155
280 3300050514 nmdc:mga08x19_33599_c1 nmdc:mga08x19_33599_c1_2084_2566 155
281 3300050514 nmdc:mga08x19_957312_c1 nmdc:mga08x19_957312_c1_112_588 155

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.8265 15 135
4hnr-assembly1.cif.gz_A high resolution structure of chemotaxis response regulator chey4 of vibrio cholerae 0.8263 14 134
1m5t-assembly1.cif.gz_A crystal structure of the response regulator divk 0.8241 15 135
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.8232 15 135
1m5u-assembly1.cif.gz_A crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form 0.8222 15 135
ID Description Score Start End Superfamily
3c97A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8745 16 64 3.40.50.2300
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8345 17 101 3.40.50.2300
4hnrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8263 14 134 3.40.50.2300
1m5uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8222 15 135 3.40.50.2300
af_P38684_4_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8145 17 101 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V8I6I8-F1-model_v4 Response regulatory domain-containing protein 0.945 28 139
AF-A0A3N5SJ96-F1-model_v4 Response regulator 0.9281 14 153 GO:0000160
AF-A0A832DBV9-F1-model_v4 Response regulatory domain-containing protein 0.9274 12 133
AF-A0A2N2LP17-F1-model_v4 Response regulatory domain-containing protein 0.9272 14 125
AF-A0A2V6PRV4-F1-model_v4 Response regulatory domain-containing protein 0.9244 12 153

Feature Viewer

pLDDT pTM Quality
79.1 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map