F384142

General Info

Members Datasets Scaffolds Average Seq Length
281 173 562 148

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100427963|Ga0070706_1004279632
Length 170
Sequence VWWGKIGRKLLSYSIVTVEEIRELIQLVAETGVAELEVQRGENRVRIRRTFGGETHDVAVPEQQAGARTAPSSGAPHLKPAAEPEGSPEKDLIMVKSPIVGTFYESASPGSPPFVRVGETVQPGKVLCIIESMKLMNEIEAEIGGVIVSKLVPNAQPVEYGEALFAIRPV

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 1.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.07
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100427963 3300005467 Bacteria 1232
2 JGI24737J22298_10194938 3300001990 Bacteria 598
3 Ga0070658_10001745 3300005327 Bacteria 18322
4 Ga0070658_10237871 3300005327 Bacteria 1543
5 Ga0070683_100223551 3300005329 Bacteria 1789
6 Ga0070683_101827977 3300005329 Bacteria 584
7 Ga0070666_10141149 3300005335 Bacteria 1678
8 Ga0070666_10427075 3300005335 Bacteria 955
9 Ga0070666_11033554 3300005335 Bacteria 610
10 Ga0070680_100001662 3300005336 Bacteria 16265
11 Ga0070680_100238224 3300005336 Bacteria 1538
12 Ga0070680_100263372 3300005336 Bacteria 1459
13 Ga0068868_100524639 3300005338 Bacteria 1040
14 Ga0070660_100381869 3300005339 Bacteria 1163
15 Ga0070660_100527301 3300005339 Bacteria 984
16 Ga0070691_10127587 3300005341 Bacteria 1286
17 Ga0070671_100794109 3300005355 Bacteria 824
18 Ga0070659_100019523 3300005366 Bacteria 5138
19 Ga0070659_100080439 3300005366 Bacteria 2602
20 Ga0070659_100333928 3300005366 Bacteria 1269
21 Ga0070667_101111751 3300005367 Unclassified 739
22 Ga0070714_100111493 3300005435 Bacteria 2423
23 Ga0070714_100688535 3300005435 Bacteria 986
24 Ga0070713_100088069 3300005436 Bacteria 2664
25 Ga0070713_101184703 3300005436 Bacteria 739
26 Ga0070711_100047053 3300005439 Bacteria 2943
27 Ga0070708_100239454 3300005445 Bacteria 1704
28 Ga0070681_10038786 3300005458 Bacteria 4776
29 Ga0070681_10200307 3300005458 Bacteria 1915
30 Ga0070681_10226330 3300005458 Bacteria 1785
31 Ga0070681_10669235 3300005458 Bacteria 953
32 Ga0070681_10740266 3300005458 Bacteria 899
33 Ga0070681_11222204 3300005458 Bacteria 673
34 Ga0068867_100928281 3300005459 Bacteria 785
35 Ga0070706_100972172 3300005467 Bacteria 783
36 Ga0070698_100538463 3300005471 Bacteria 1107
37 Ga0070679_100083321 3300005530 Bacteria 3186
38 Ga0070679_100345437 3300005530 Bacteria 1436
39 Ga0070679_100579207 3300005530 Bacteria 1066
40 Ga0070684_100946663 3300005535 Bacteria 808
41 Ga0070697_100134099 3300005536 Bacteria 2079
42 Ga0070697_100201579 3300005536 Bacteria 1692
43 Ga0070672_100501596 3300005543 Bacteria 1050
44 Ga0070686_100175923 3300005544 Bacteria 1517
45 Ga0070695_100028677 3300005545 Bacteria 3455
46 Ga0070693_100451595 3300005547 Bacteria 902
47 Ga0070693_101456305 3300005547 Bacteria 534
48 Ga0070665_100087156 3300005548 Bacteria 3127
49 Ga0070665_100651096 3300005548 Bacteria 1067
50 Ga0068855_100012411 3300005563 Bacteria 10290
51 Ga0068855_100054922 3300005563 Bacteria 4680
52 Ga0068855_100264020 3300005563 Bacteria 1917
53 Ga0068855_101079274 3300005563 Bacteria 840
54 Ga0070664_100181812 3300005564 Bacteria 1869
55 Ga0068856_100008542 3300005614 Bacteria 9954
56 Ga0068856_100112701 3300005614 Bacteria 2718
57 Ga0068856_100500668 3300005614 Bacteria 1236
58 Ga0068856_101774787 3300005614 Bacteria 629
59 Ga0068852_100019515 3300005616 Bacteria 5368
60 Ga0068852_100055629 3300005616 Bacteria 3416
61 Ga0068859_100173727 3300005617 Bacteria 2236
62 Ga0070717_11677421 3300006028 Bacteria 575
63 Ga0097621_100852242 3300006237 Bacteria 847
64 Ga0068871_100208458 3300006358 Bacteria 1690
65 Ga0075428_101019396 3300006844 Bacteria 876
66 Ga0075434_101777015 3300006871 Bacteria 624
67 Ga0075436_100089219 3300006914 Bacteria 2142
68 Ga0097620_100173726 3300006931 Bacteria 2236
69 Ga0075435_100727905 3300007076 Bacteria 863
70 Ga0105240_10000395 3300009093 Bacteria 81541
71 Ga0105240_10131079 3300009093 Bacteria 3007
72 Ga0105240_10381299 3300009093 Bacteria 1592
73 Ga0105240_10657508 3300009093 Bacteria 1148
74 Ga0111539_10216396 3300009094 Bacteria 2231
75 Ga0105245_10147982 3300009098 Bacteria 2217
76 Ga0105241_11289915 3300009174 Bacteria 695
77 Ga0105248_10061865 3300009177 Bacteria 4204
78 Ga0105248_10240778 3300009177 Bacteria 2037
79 Ga0105248_10863941 3300009177 Unclassified 1021
80 Ga0105248_11139605 3300009177 Bacteria 882
81 Ga0105237_10014542 3300009545 Bacteria 8224
82 Ga0105237_10617148 3300009545 Bacteria 1091
83 Ga0105237_10918661 3300009545 Bacteria 882
84 Ga0105238_10387160 3300009551 Bacteria 1390
85 Ga0105238_10532811 3300009551 Bacteria 1178
86 Ga0105238_11223800 3300009551 Bacteria 776
87 Ga0105239_11534476 3300010375 Bacteria 770
88 Ga0157373_10346755 3300013100 Bacteria 1059
89 Ga0157371_10608115 3300013102 Bacteria 813
90 Ga0157370_10003418 3300013104 Bacteria 18642
91 Ga0157370_10080077 3300013104 Bacteria 3076
92 Ga0157369_10035087 3300013105 Bacteria 5501
93 Ga0157369_10099022 3300013105 Bacteria 3108
94 Ga0157369_10283007 3300013105 Bacteria 1727
95 Ga0157369_10296532 3300013105 Bacteria 1682
96 Ga0157369_10327103 3300013105 Bacteria 1593
97 Ga0157369_10358677 3300013105 Bacteria 1514
98 Ga0157369_10574531 3300013105 Bacteria 1164
99 Ga0157369_10583512 3300013105 Bacteria 1154
100 Ga0157369_10768959 3300013105 Bacteria 990
101 Ga0157374_10235621 3300013296 Bacteria 1799
102 Ga0157374_11554548 3300013296 Bacteria 685
103 Ga0157378_10179956 3300013297 Bacteria 1988
104 Ga0163162_12091399 3300013306 Bacteria 649
105 Ga0157372_10074949 3300013307 Bacteria 3817
106 Ga0157372_10425901 3300013307 Bacteria 1547
107 Ga0157376_10644996 3300014969 Bacteria 1059
108 Ga0163161_11027818 3300017792 Bacteria 705
109 Ga0197907_10607706 3300020069 Bacteria 590
110 Ga0206355_1191074 3300020076 Bacteria 941
111 Ga0206355_1382695 3300020076 Bacteria 875
112 Ga0206350_11315019 3300020080 Bacteria 627
113 Ga0224712_10500965 3300022467 Bacteria 587
114 Ga0207645_10277873 3300025907 Bacteria 1112
115 Ga0207705_10053308 3300025909 Bacteria 2913
116 Ga0207705_10176446 3300025909 Bacteria 1611
117 Ga0207705_10339512 3300025909 Bacteria 1156
118 Ga0207684_10170813 3300025910 Bacteria 1874
119 Ga0207654_10579806 3300025911 Bacteria 799
120 Ga0207707_10061325 3300025912 Bacteria 3272
121 Ga0207707_10168047 3300025912 Bacteria 1917
122 Ga0207707_10187660 3300025912 Bacteria 1804
123 Ga0207695_10002408 3300025913 Bacteria 27693
124 Ga0207695_10081287 3300025913 Bacteria 3279
125 Ga0207695_11153976 3300025913 Bacteria 655
126 Ga0207671_10486103 3300025914 Bacteria 984
127 Ga0207671_10571581 3300025914 Bacteria 901
128 Ga0207663_10101080 3300025916 Bacteria 1937
129 Ga0207660_10261422 3300025917 Bacteria 1369
130 Ga0207657_10028603 3300025919 Bacteria 5081
131 Ga0207657_10098325 3300025919 Bacteria 2432
132 Ga0207657_10378680 3300025919 Bacteria 1115
133 Ga0207652_10183560 3300025921 Bacteria 1880
134 Ga0207652_10463976 3300025921 Bacteria 1141
135 Ga0207694_10943837 3300025924 Bacteria 730
136 Ga0207650_10844961 3300025925 Bacteria 777
137 Ga0207687_11449990 3300025927 Bacteria 590
138 Ga0207700_10034112 3300025928 Bacteria 3650
139 Ga0207700_11629029 3300025928 Bacteria 571
140 Ga0207664_10173739 3300025929 Bacteria 1846
141 Ga0207664_10593123 3300025929 Bacteria 995
142 Ga0207664_10858314 3300025929 Bacteria 816
143 Ga0207690_10012048 3300025932 Bacteria 5170
144 Ga0207690_10087350 3300025932 Bacteria 2194
145 Ga0207690_10609810 3300025932 Bacteria 892
146 Ga0207665_10484806 3300025939 Bacteria 953
147 Ga0207661_11633666 3300025944 Bacteria 589
148 Ga0207679_10277178 3300025945 Bacteria 1437
149 Ga0207667_10023611 3300025949 Bacteria 6769
150 Ga0207667_10253785 3300025949 Bacteria 1799
151 Ga0207667_10493945 3300025949 Bacteria 1242
152 Ga0207712_10979014 3300025961 Bacteria 750
153 Ga0207658_10384986 3300025986 Bacteria 1229
154 Ga0207677_10503172 3300026023 Bacteria 1048
155 Ga0207677_10551092 3300026023 Bacteria 1005
156 Ga0207703_11525485 3300026035 Bacteria 643
157 Ga0207639_10438699 3300026041 Bacteria 1183
158 Ga0207702_10004270 3300026078 Bacteria 12748
159 Ga0207702_10027341 3300026078 Bacteria 4737
160 Ga0207702_10265966 3300026078 Bacteria 1616
161 Ga0207641_10620629 3300026088 Bacteria 1060
162 Ga0207648_10947106 3300026089 Bacteria 805
163 Ga0207674_10830013 3300026116 Bacteria 892
164 Ga0207698_10075892 3300026142 Bacteria 2688
165 Ga0207698_10231778 3300026142 Bacteria 1677
166 Ga0207698_11021102 3300026142 Bacteria 838
167 Ga0207698_12451239 3300026142 Bacteria 532
168 Ga0268266_10034325 3300028379 Bacteria 4315
169 Ga0268266_10064713 3300028379 Bacteria 3160
170 Ga0268266_10193423 3300028379 Bacteria 1858
171 Ga0265330_10212315 3300031235 Bacteria 817
172 Ga0265329_10083241 3300031242 Bacteria 1013
173 Ga0265316_10009149 3300031344 Bacteria 9127
174 Ga0265316_10017953 3300031344 Bacteria 6096
175 Ga0373932_0000014 3300035112 Bacteria 60783
176 Ga0373945_0313873 3300035116 Bacteria 674
177 Ga0373953_0053496 3300035117 Bacteria 1636
178 Ga0373954_0019110 3300035118 Bacteria 3089
179 Ga0373954_0042149 3300035118 Bacteria 2128
180 Ga0373955_0149085 3300035172 Bacteria 1376
181 Ga0373924_0120466 3300035410 Bacteria 1138
182 Ga0373935_1379898 3300035692 Bacteria 527
183 Ga0373927_0002158 3300035695 Bacteria 14460
184 Ga0373937_0085457 3300036401 Bacteria 2920
185 Ga0373937_0124112 3300036401 Bacteria 2408
186 Ga0373937_0181627 3300036401 Bacteria 1975
187 Ga0373937_0644530 3300036401 Bacteria 1005
188 Ga0373937_0698787 3300036401 Bacteria 961
189 Ga0373925_0031793 3300037068 Bacteria 3882
190 Ga0373925_0160393 3300037068 Bacteria 1771
191 Ga0373925_0203806 3300037068 Bacteria 1574
192 Ga0395900_0067944 3300037418 Bacteria 3662
193 Ga0395900_0074492 3300037418 Bacteria 3490
194 Ga0395898_0874594 3300037466 Bacteria 837
195 Ga0436364_0680646 3300037853 Bacteria 811
196 Ga0436364_0706243 3300037853 Bacteria 651
197 Ga0395901_0127269 3300038443 Bacteria 2677
198 Ga0395901_0227354 3300038443 Bacteria 1949
199 Ga0436365_1338147 3300039437 Bacteria 1394
200 Ga0436360_0574236 3300039438 Bacteria 856
201 Ga0466963_0503210 3300044694 Bacteria 855
202 Ga0453684_0067882 3300044712 Bacteria 4532
203 Ga0466959_0302364 3300045049 Bacteria 1095
204 Ga0466967_0184652 3300045976 Bacteria 1969
205 Ga0466967_0247477 3300045976 Bacteria 1702
206 Ga0466967_1285872 3300045976 Bacteria 729
207 Ga0495592_0006920 3300046454 Bacteria 8473
208 Ga0495651_0031606 3300046462 Bacteria 4128
209 Ga0495653_0157022 3300046463 Bacteria 1583
210 Ga0495580_0069131 3300046472 Bacteria 2468
211 Ga0495580_0322415 3300046472 Bacteria 1050
212 Ga0495580_0444294 3300046472 Unclassified 871
213 Ga0495580_0637807 3300046472 Bacteria 701
214 Ga0495662_0055664 3300046476 Bacteria 1910
215 Ga0495664_0011157 3300046477 Bacteria 5057
216 Ga0495664_0494471 3300046477 Bacteria 731
217 Ga0495608_0219399 3300046511 Bacteria 1194
218 Ga0495618_0189456 3300046514 Bacteria 1305
219 Ga0495628_0008573 3300046516 Bacteria 8758
220 Ga0495628_0300160 3300046516 Bacteria 1189
221 Ga0495642_0076858 3300046528 Bacteria 1402
222 Ga0495642_0217051 3300046528 Bacteria 835
223 Ga0495652_0055974 3300046529 Bacteria 3352
224 Ga0495665_0318137 3300046531 Bacteria 795
225 Ga0495640_0084291 3300046533 Bacteria 2108
226 Ga0495586_0661011 3300046535 Bacteria 604
227 Ga0495587_0012870 3300046536 Bacteria 5261
228 Ga0495587_0173539 3300046536 Bacteria 1224
229 Ga0495645_0002964 3300046543 Bacteria 11494
230 Ga0495645_0176376 3300046543 Bacteria 1467
231 Ga0495667_0029390 3300046559 Bacteria 3700
232 Ga0495667_0088638 3300046559 Bacteria 2005
233 Ga0495634_0030051 3300046642 Bacteria 3756
234 Ga0495635_0020810 3300046663 Bacteria 4570
235 Ga0495599_0024776 3300046678 Bacteria 3752
236 Ga0495623_0054053 3300046679 Bacteria 2534
237 Ga0495646_0151922 3300046680 Bacteria 1287
238 Ga0495658_0215238 3300046683 Bacteria 1201
239 Ga0495613_0141444 3300046689 Bacteria 1719
240 Ga0495613_0687126 3300046689 Bacteria 675
241 Ga0495600_0052258 3300046809 Bacteria 2668
242 Ga0495604_0017030 3300047317 Bacteria 5812
243 Ga0495604_0050745 3300047317 Bacteria 3220
244 Ga0495674_0017998 3300047319 Bacteria 6577
245 Ga0495674_0037812 3300047319 Bacteria 4336
246 Ga0495674_0224310 3300047319 Bacteria 1552
247 Ga0495674_0520421 3300047319 Bacteria 950
248 Ga0495680_0091977 3300047322 Bacteria 2273
249 Ga0495675_0017739 3300047444 Bacteria 4513
250 Ga0495675_0281539 3300047444 Bacteria 991
251 Ga0495684_0088975 3300047471 Bacteria 2340
252 Ga0495684_0275060 3300047471 Bacteria 1217
253 Ga0495602_0029971 3300048088 Bacteria 5170
254 Ga0495602_0228302 3300048088 Bacteria 1400
255 Ga0495602_0289139 3300048088 Bacteria 1204
256 Ga0496109_0633093 3300048912 Bacteria 1006
257 Ga0496110_0515608 3300048913 Bacteria 1088
258 Ga0496112_0015168 3300048915 Bacteria 7180
259 Ga0496126_0216671 3300048929 Bacteria 1610
260 Ga0501032_0061087 3300049569 Bacteria 2527
261 Ga0501033_0030270 3300049570 Bacteria 4068
262 Ga0501034_0213039 3300049571 Bacteria 1886
263 Ga0501036_0115298 3300049572 Bacteria 2270
264 Ga0501037_0367723 3300049573 Bacteria 990
265 Ga0501038_0109259 3300049574 Bacteria 2292
266 Ga0501041_1087646 3300049577 Bacteria 515
267 Ga0501043_0207684 3300049579 Bacteria 1518
268 Ga0501047_0012560 3300049581 Bacteria 8021
269 Ga0501068_0472593 3300049584 Bacteria 812
270 Ga0501070_0015022 3300049586 Bacteria 6515
271 Ga0501080_1638698 3300049742 Bacteria 544
272 Ga0501035_0007161 3300049822 Bacteria 10435
273 Ga0501044_0000895 3300049823 Bacteria 36008
274 Ga0501044_0048645 3300049823 Bacteria 4379
275 nmdc:mga0qj67_344050_c1 3300050509 Bacteria 1206
276 nmdc:mga06r32_110260_c1 3300050510 Bacteria 2707
277 nmdc:mga08x19_6999_c1 3300050514 Bacteria 6697
278 Ga0495601_0300735 3300053077 Bacteria 1045
279 Ga0495595_0181037 3300053084 Bacteria 1045
280 Ga0501082_0000545 3300060353 Bacteria 33506
281 Ga0466962_0240559 3300061719 Bacteria 888
282 Ga0070706_100427963
283 JGI24737J22298_10194938
284 Ga0070658_10001745
285 Ga0070658_10237871
286 Ga0070683_100223551
287 Ga0070683_101827977
288 Ga0070666_10141149
289 Ga0070666_10427075
290 Ga0070666_11033554
291 Ga0070680_100001662
292 Ga0070680_100238224
293 Ga0070680_100263372
294 Ga0068868_100524639
295 Ga0070660_100381869
296 Ga0070660_100527301
297 Ga0070691_10127587
298 Ga0070671_100794109
299 Ga0070659_100019523
300 Ga0070659_100080439
301 Ga0070659_100333928
302 Ga0070667_101111751
303 Ga0070714_100111493
304 Ga0070714_100688535
305 Ga0070713_100088069
306 Ga0070713_101184703
307 Ga0070711_100047053
308 Ga0070708_100239454
309 Ga0070681_10038786
310 Ga0070681_10200307
311 Ga0070681_10226330
312 Ga0070681_10669235
313 Ga0070681_10740266
314 Ga0070681_11222204
315 Ga0068867_100928281
316 Ga0070706_100972172
317 Ga0070698_100538463
318 Ga0070679_100083321
319 Ga0070679_100345437
320 Ga0070679_100579207
321 Ga0070684_100946663
322 Ga0070697_100134099
323 Ga0070697_100201579
324 Ga0070672_100501596
325 Ga0070686_100175923
326 Ga0070695_100028677
327 Ga0070693_100451595
328 Ga0070693_101456305
329 Ga0070665_100087156
330 Ga0070665_100651096
331 Ga0068855_100012411
332 Ga0068855_100054922
333 Ga0068855_100264020
334 Ga0068855_101079274
335 Ga0070664_100181812
336 Ga0068856_100008542
337 Ga0068856_100112701
338 Ga0068856_100500668
339 Ga0068856_101774787
340 Ga0068852_100019515
341 Ga0068852_100055629
342 Ga0068859_100173727
343 Ga0070717_11677421
344 Ga0097621_100852242
345 Ga0068871_100208458
346 Ga0075428_101019396
347 Ga0075434_101777015
348 Ga0075436_100089219
349 Ga0097620_100173726
350 Ga0075435_100727905
351 Ga0105240_10000395
352 Ga0105240_10131079
353 Ga0105240_10381299
354 Ga0105240_10657508
355 Ga0111539_10216396
356 Ga0105245_10147982
357 Ga0105241_11289915
358 Ga0105248_10061865
359 Ga0105248_10240778
360 Ga0105248_10863941
361 Ga0105248_11139605
362 Ga0105237_10014542
363 Ga0105237_10617148
364 Ga0105237_10918661
365 Ga0105238_10387160
366 Ga0105238_10532811
367 Ga0105238_11223800
368 Ga0105239_11534476
369 Ga0157373_10346755
370 Ga0157371_10608115
371 Ga0157370_10003418
372 Ga0157370_10080077
373 Ga0157369_10035087
374 Ga0157369_10099022
375 Ga0157369_10283007
376 Ga0157369_10296532
377 Ga0157369_10327103
378 Ga0157369_10358677
379 Ga0157369_10574531
380 Ga0157369_10583512
381 Ga0157369_10768959
382 Ga0157374_10235621
383 Ga0157374_11554548
384 Ga0157378_10179956
385 Ga0163162_12091399
386 Ga0157372_10074949
387 Ga0157372_10425901
388 Ga0157376_10644996
389 Ga0163161_11027818
390 Ga0197907_10607706
391 Ga0206355_1191074
392 Ga0206355_1382695
393 Ga0206350_11315019
394 Ga0224712_10500965
395 Ga0207645_10277873
396 Ga0207705_10053308
397 Ga0207705_10176446
398 Ga0207705_10339512
399 Ga0207684_10170813
400 Ga0207654_10579806
401 Ga0207707_10061325
402 Ga0207707_10168047
403 Ga0207707_10187660
404 Ga0207695_10002408
405 Ga0207695_10081287
406 Ga0207695_11153976
407 Ga0207671_10486103
408 Ga0207671_10571581
409 Ga0207663_10101080
410 Ga0207660_10261422
411 Ga0207657_10028603
412 Ga0207657_10098325
413 Ga0207657_10378680
414 Ga0207652_10183560
415 Ga0207652_10463976
416 Ga0207694_10943837
417 Ga0207650_10844961
418 Ga0207687_11449990
419 Ga0207700_10034112
420 Ga0207700_11629029
421 Ga0207664_10173739
422 Ga0207664_10593123
423 Ga0207664_10858314
424 Ga0207690_10012048
425 Ga0207690_10087350
426 Ga0207690_10609810
427 Ga0207665_10484806
428 Ga0207661_11633666
429 Ga0207679_10277178
430 Ga0207667_10023611
431 Ga0207667_10253785
432 Ga0207667_10493945
433 Ga0207712_10979014
434 Ga0207658_10384986
435 Ga0207677_10503172
436 Ga0207677_10551092
437 Ga0207703_11525485
438 Ga0207639_10438699
439 Ga0207702_10004270
440 Ga0207702_10027341
441 Ga0207702_10265966
442 Ga0207641_10620629
443 Ga0207648_10947106
444 Ga0207674_10830013
445 Ga0207698_10075892
446 Ga0207698_10231778
447 Ga0207698_11021102
448 Ga0207698_12451239
449 Ga0268266_10034325
450 Ga0268266_10064713
451 Ga0268266_10193423
452 Ga0265330_10212315
453 Ga0265329_10083241
454 Ga0265316_10009149
455 Ga0265316_10017953
456 Ga0373932_0000014
457 Ga0373945_0313873
458 Ga0373953_0053496
459 Ga0373954_0019110
460 Ga0373954_0042149
461 Ga0373955_0149085
462 Ga0373924_0120466
463 Ga0373935_1379898
464 Ga0373927_0002158
465 Ga0373937_0085457
466 Ga0373937_0124112
467 Ga0373937_0181627
468 Ga0373937_0644530
469 Ga0373937_0698787
470 Ga0373925_0031793
471 Ga0373925_0160393
472 Ga0373925_0203806
473 Ga0395900_0067944
474 Ga0395900_0074492
475 Ga0395898_0874594
476 Ga0436364_0680646
477 Ga0436364_0706243
478 Ga0395901_0127269
479 Ga0395901_0227354
480 Ga0436365_1338147
481 Ga0436360_0574236
482 Ga0466963_0503210
483 Ga0453684_0067882
484 Ga0466959_0302364
485 Ga0466967_0184652
486 Ga0466967_0247477
487 Ga0466967_1285872
488 Ga0495592_0006920
489 Ga0495651_0031606
490 Ga0495653_0157022
491 Ga0495580_0069131
492 Ga0495580_0322415
493 Ga0495580_0444294
494 Ga0495580_0637807
495 Ga0495662_0055664
496 Ga0495664_0011157
497 Ga0495664_0494471
498 Ga0495608_0219399
499 Ga0495618_0189456
500 Ga0495628_0008573
501 Ga0495628_0300160
502 Ga0495642_0076858
503 Ga0495642_0217051
504 Ga0495652_0055974
505 Ga0495665_0318137
506 Ga0495640_0084291
507 Ga0495586_0661011
508 Ga0495587_0012870
509 Ga0495587_0173539
510 Ga0495645_0002964
511 Ga0495645_0176376
512 Ga0495667_0029390
513 Ga0495667_0088638
514 Ga0495634_0030051
515 Ga0495635_0020810
516 Ga0495599_0024776
517 Ga0495623_0054053
518 Ga0495646_0151922
519 Ga0495658_0215238
520 Ga0495613_0141444
521 Ga0495613_0687126
522 Ga0495600_0052258
523 Ga0495604_0017030
524 Ga0495604_0050745
525 Ga0495674_0017998
526 Ga0495674_0037812
527 Ga0495674_0224310
528 Ga0495674_0520421
529 Ga0495680_0091977
530 Ga0495675_0017739
531 Ga0495675_0281539
532 Ga0495684_0088975
533 Ga0495684_0275060
534 Ga0495602_0029971
535 Ga0495602_0228302
536 Ga0495602_0289139
537 Ga0496109_0633093
538 Ga0496110_0515608
539 Ga0496112_0015168
540 Ga0496126_0216671
541 Ga0501032_0061087
542 Ga0501033_0030270
543 Ga0501034_0213039
544 Ga0501036_0115298
545 Ga0501037_0367723
546 Ga0501038_0109259
547 Ga0501041_1087646
548 Ga0501043_0207684
549 Ga0501047_0012560
550 Ga0501068_0472593
551 Ga0501070_0015022
552 Ga0501080_1638698
553 Ga0501035_0007161
554 Ga0501044_0000895
555 Ga0501044_0048645
556 nmdc:mga0qj67_344050_c1
557 nmdc:mga06r32_110260_c1
558 nmdc:mga08x19_6999_c1
559 Ga0495601_0300735
560 Ga0495595_0181037
561 Ga0501082_0000545
562 Ga0466962_0240559

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

93

167

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.9805 50 124
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.956 51 124
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.9507 49 124
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.9481 51 124
4rcn-assembly1.cif.gz_B structure and function of a single-chain, multi-domain long-chain acyl-coa carboxylase 0.9461 47 127
ID Description Score Start End Superfamily
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9761 50 124 2.40.50.100
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9599 52 124 2.40.50.100
af_I6YEU0_1051_1127_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9557 51 124 2.40.50.100
2d5dB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9552 51 124 2.40.50.100
af_Q553S7_647_713_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9509 52 122 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3M1WIJ3-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9919 49 127 GO:0003989
GO:0006633
GO:0009317
AF-A0A2V9FF22-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9906 49 127 GO:0003989
GO:0006633
GO:0009317
AF-A0A6N8IKQ7-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9901 47 126 GO:0003989
GO:0006633
GO:0009317
AF-A0A538GAT8-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9889 47 126 GO:0003989
GO:0006633
GO:0009317
AF-A0A6J4LLE9-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9882 49 127 GO:0003989
GO:0006633
GO:0009317

Map