F384086

General Info

Members Datasets Scaffolds Average Seq Length
281 180 562 219

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100142077|Ga0068869_1001420772
Length 238
Sequence VTVTRAPATLRANWLTGFGGRISVLMIPVRVCLVICLAVPVAAQSPDRLTGKNVSIKQITFKGRSAIQLIAAPDADNATSYAVVKDVSFRDGVIEVDLAGQPAAGAGEGARGFIGIAFRLQGDGRYEYIYLRPTNGRADDQLRRNHSTQYSAYPDFDFARSRKEAPEKYESYVDLQPGVWTKYKIEVEGRKARLYVNGTEQPCLIVNDMKLEPRAGSVALWVGPGTEGYFANLKVVAK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
133 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
134 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 4.27
Rhizosphere 91.81
Stem 0
Stem Tuber 0
Unclassified 29.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100142077 3300005334 Unclassified 1854
2 rootL2_10060320 3300003322 Bacteria 1399
3 Ga0065712_10070420 3300005290 Bacteria 6025
4 Ga0065715_10325436 3300005293 Bacteria 994
5 Ga0065707_10264346 3300005295 Bacteria 1089
6 Ga0070676_10004675 3300005328 Bacteria 7236
7 Ga0070690_100632167 3300005330 Unclassified 816
8 Ga0070670_100002121 3300005331 Bacteria 16269
9 Ga0070677_10009783 3300005333 Bacteria 3261
10 Ga0070677_10010559 3300005333 Bacteria 3162
11 Ga0068868_100728566 3300005338 Bacteria 889
12 Ga0070660_100032885 3300005339 Unclassified 3906
13 Ga0070689_100086314 3300005340 Unclassified 2468
14 Ga0070689_100237859 3300005340 Unclassified 1499
15 Ga0070687_100251708 3300005343 Bacteria 1098
16 Ga0070668_100729055 3300005347 Bacteria 876
17 Ga0070669_100049384 3300005353 Unclassified 3071
18 Ga0070669_100120998 3300005353 Bacteria 1997
19 Ga0070675_100006782 3300005354 Bacteria 8797
20 Ga0070675_100050845 3300005354 Bacteria 3404
21 Ga0070675_100472793 3300005354 Unclassified 1126
22 Ga0070671_100027645 3300005355 Bacteria 4671
23 Ga0070674_100102164 3300005356 Unclassified 2091
24 Ga0070674_100116743 3300005356 Bacteria 1969
25 Ga0070673_100019093 3300005364 Bacteria 4917
26 Ga0070673_100049093 3300005364 Unclassified 3294
27 Ga0070673_100100410 3300005364 Unclassified 2382
28 Ga0070659_100020753 3300005366 Unclassified 4995
29 Ga0070667_100043267 3300005367 Bacteria 3779
30 Ga0070667_100053637 3300005367 Bacteria 3403
31 Ga0070667_100202068 3300005367 Unclassified 1764
32 Ga0070667_100564062 3300005367 Unclassified 1047
33 Ga0070701_10085748 3300005438 Unclassified 1715
34 Ga0070711_100162506 3300005439 Unclassified 1694
35 Ga0070700_100045798 3300005441 Bacteria 2699
36 Ga0070700_100061012 3300005441 Bacteria 2378
37 Ga0070708_100000280 3300005445 Bacteria 38345
38 Ga0070708_100250250 3300005445 Unclassified 1665
39 Ga0070663_100039926 3300005455 Unclassified 3283
40 Ga0070663_100450914 3300005455 Bacteria 1060
41 Ga0070678_100062567 3300005456 Bacteria 2749
42 Ga0070678_100202767 3300005456 Bacteria 1638
43 Ga0068867_100028341 3300005459 Bacteria 4032
44 Ga0070706_100211176 3300005467 Unclassified 1812
45 Ga0070707_100005050 3300005468 Bacteria 12376
46 Ga0070707_100268422 3300005468 Unclassified 1659
47 Ga0070698_100053049 3300005471 Bacteria 4122
48 Ga0070698_100070971 3300005471 Unclassified 3493
49 Ga0070698_100291767 3300005471 Bacteria 1562
50 Ga0070698_100556367 3300005471 Bacteria 1087
51 Ga0070699_100018105 3300005518 Bacteria 6051
52 Ga0070699_100111167 3300005518 Bacteria 2406
53 Ga0070699_100160383 3300005518 Bacteria 1990
54 Ga0070699_100498069 3300005518 Bacteria 1106
55 Ga0070684_100008770 3300005535 Bacteria 7928
56 Ga0070697_100648163 3300005536 Unclassified 930
57 Ga0070672_100150607 3300005543 Unclassified 1924
58 Ga0070686_100079721 3300005544 Bacteria 2165
59 Ga0068855_100132841 3300005563 Unclassified 2841
60 Ga0070664_100006221 3300005564 Bacteria 9644
61 Ga0070664_100304184 3300005564 Unclassified 1441
62 Ga0070664_100347105 3300005564 Unclassified 1349
63 Ga0070664_101140354 3300005564 Bacteria 735
64 Ga0068857_100366696 3300005577 Bacteria 1336
65 Ga0068857_100682376 3300005577 Bacteria 975
66 Ga0068854_100065874 3300005578 Bacteria 2635
67 Ga0068859_100034925 3300005617 Bacteria 5044
68 Ga0068859_100144768 3300005617 Bacteria 2451
69 Ga0068864_100039198 3300005618 Bacteria 4049
70 Ga0068864_100108541 3300005618 Unclassified 2470
71 Ga0068866_10399671 3300005718 Bacteria 886
72 Ga0068861_100043599 3300005719 Bacteria 3369
73 Ga0068863_100035925 3300005841 Bacteria 4719
74 Ga0068858_100317705 3300005842 Bacteria 1488
75 Ga0068860_100067568 3300005843 Bacteria 3396
76 Ga0068860_100265325 3300005843 Bacteria 1674
77 Ga0068862_100048695 3300005844 Bacteria 3618
78 Ga0081455_10010855 3300005937 Bacteria 9196
79 Ga0081455_10055327 3300005937 Bacteria 3375
80 Ga0070716_100350271 3300006173 Unclassified 1045
81 Ga0070712_100294075 3300006175 Unclassified 1312
82 Ga0075367_10017697 3300006178 Bacteria 3917
83 Ga0075366_10066096 3300006195 Bacteria 2151
84 Ga0097621_100436178 3300006237 Bacteria 1178
85 Ga0075370_10212491 3300006353 Unclassified 1142
86 Ga0068871_100030125 3300006358 Bacteria 4270
87 Ga0075428_100082525 3300006844 Bacteria 3507
88 Ga0075428_100291409 3300006844 Bacteria 1755
89 Ga0075428_100395310 3300006844 Bacteria 1482
90 Ga0075428_100463258 3300006844 Bacteria 1357
91 Ga0075430_100132671 3300006846 Bacteria 2076
92 Ga0075431_100170367 3300006847 Bacteria 2237
93 Ga0075431_100674647 3300006847 Unclassified 1012
94 Ga0075433_10000279 3300006852 Bacteria 30281
95 Ga0075434_100002170 3300006871 Bacteria 17107
96 Ga0075434_100003985 3300006871 Bacteria 13225
97 Ga0075434_100005935 3300006871 Bacteria 11177
98 Ga0075434_100470504 3300006871 Bacteria 1278
99 Ga0075429_100056844 3300006880 Bacteria 3406
100 Ga0075429_100245579 3300006880 Unclassified 1567
101 Ga0075436_100001199 3300006914 Bacteria 17620
102 Ga0097620_100034925 3300006931 Bacteria 5044
103 Ga0097620_100144767 3300006931 Bacteria 2451
104 Ga0075435_100000043 3300007076 Bacteria 64194
105 Ga0075435_100005133 3300007076 Bacteria 9102
106 Ga0075435_100005993 3300007076 Bacteria 8555
107 Ga0105240_10160996 3300009093 Unclassified 2665
108 Ga0111539_10004944 3300009094 Bacteria 17336
109 Ga0111539_10039995 3300009094 Bacteria 5647
110 Ga0111539_11353735 3300009094 Unclassified 826
111 Ga0105245_10241809 3300009098 Bacteria 1750
112 Ga0105247_10291574 3300009101 Bacteria 1129
113 Ga0105247_10478655 3300009101 Bacteria 903
114 Ga0114129_10021189 3300009147 Bacteria 9231
115 Ga0114129_10059051 3300009147 Bacteria 5364
116 Ga0114129_10138953 3300009147 Bacteria 3331
117 Ga0114129_10229044 3300009147 Bacteria 2503
118 Ga0114129_10537554 3300009147 Unclassified 1522
119 Ga0114129_10562904 3300009147 Unclassified 1481
120 Ga0105243_10021021 3300009148 Bacteria 4952
121 Ga0105243_11290942 3300009148 Bacteria 747
122 Ga0105243_11467029 3300009148 Unclassified 705
123 Ga0105241_10421011 3300009174 Unclassified 1175
124 Ga0105242_10054900 3300009176 Bacteria 3258
125 Ga0105242_10528462 3300009176 Bacteria 1127
126 Ga0105248_10033207 3300009177 Bacteria 5764
127 Ga0105248_10917334 3300009177 Bacteria 989
128 Ga0105237_10045534 3300009545 Unclassified 4414
129 Ga0105237_10981015 3300009545 Bacteria 852
130 Ga0105249_10024231 3300009553 Bacteria 5453
131 Ga0105249_10525479 3300009553 Unclassified 1231
132 Ga0105246_10118323 3300011119 Unclassified 1959
133 Ga0105246_10325276 3300011119 Unclassified 1251
134 Ga0157373_10139649 3300013100 Unclassified 1704
135 Ga0157369_10020841 3300013105 Bacteria 7328
136 Ga0157374_10103187 3300013296 Unclassified 2736
137 Ga0157378_10090360 3300013297 Bacteria 2783
138 Ga0157372_10561081 3300013307 Unclassified 1331
139 Ga0157375_10053125 3300013308 Bacteria 3985
140 Ga0157375_10175630 3300013308 Bacteria 2291
141 Ga0163163_10000410 3300014325 Bacteria 40406
142 Ga0163163_10003257 3300014325 Bacteria 13770
143 Ga0163163_10023914 3300014325 Bacteria 5808
144 Ga0157380_10035571 3300014326 Bacteria 3848
145 Ga0157377_10140008 3300014745 Bacteria 1486
146 Ga0157377_10187671 3300014745 Unclassified 1304
147 Ga0157379_10128312 3300014968 Bacteria 2282
148 Ga0157376_10803631 3300014969 Bacteria 953
149 Ga0213876_10186853 3300021384 Bacteria 1102
150 Ga0207666_1021460 3300025271 Bacteria 952
151 Ga0207682_10008875 3300025893 Bacteria 3976
152 Ga0207682_10023824 3300025893 Bacteria 2421
153 Ga0207680_10019082 3300025903 Bacteria 3662
154 Ga0207680_10674954 3300025903 Unclassified 740
155 Ga0207645_10010248 3300025907 Bacteria 6441
156 Ga0207645_10043201 3300025907 Bacteria 2884
157 Ga0207684_10223056 3300025910 Unclassified 1626
158 Ga0207695_10040702 3300025913 Bacteria 4979
159 Ga0207671_10232153 3300025914 Bacteria 1447
160 Ga0207663_10433208 3300025916 Unclassified 1011
161 Ga0207662_10020937 3300025918 Bacteria 3733
162 Ga0207662_10371730 3300025918 Bacteria 964
163 Ga0207657_10178404 3300025919 Unclassified 1718
164 Ga0207649_10091566 3300025920 Bacteria 1992
165 Ga0207646_10006690 3300025922 Bacteria 11880
166 Ga0207646_10183214 3300025922 Bacteria 1891
167 Ga0207681_10030769 3300025923 Unclassified 3502
168 Ga0207681_10034832 3300025923 Unclassified 3313
169 Ga0207659_10322778 3300025926 Bacteria 1274
170 Ga0207659_10441417 3300025926 Unclassified 1095
171 Ga0207644_10010941 3300025931 Bacteria 5995
172 Ga0207690_10270586 3300025932 Unclassified 1320
173 Ga0207706_10318903 3300025933 Unclassified 1353
174 Ga0207686_10029804 3300025934 Bacteria 3223
175 Ga0207670_10018356 3300025936 Bacteria 4251
176 Ga0207669_10007271 3300025937 Bacteria 5109
177 Ga0207669_10099982 3300025937 Unclassified 1914
178 Ga0207669_10463793 3300025937 Unclassified 1006
179 Ga0207691_10087985 3300025940 Unclassified 2786
180 Ga0207691_10116341 3300025940 Unclassified 2373
181 Ga0207711_10014017 3300025941 Bacteria 6659
182 Ga0207711_10031828 3300025941 Bacteria 4456
183 Ga0207689_10009059 3300025942 Bacteria 8620
184 Ga0207667_10057857 3300025949 Unclassified 4068
185 Ga0207651_10044602 3300025960 Unclassified 2969
186 Ga0207651_10056574 3300025960 Unclassified 2700
187 Ga0207651_10076193 3300025960 Bacteria 2397
188 Ga0207712_10017885 3300025961 Bacteria 4612
189 Ga0207640_10219246 3300025981 Unclassified 1455
190 Ga0207658_10074542 3300025986 Bacteria 2579
191 Ga0207658_10175119 3300025986 Unclassified 1771
192 Ga0207658_10189591 3300025986 Bacteria 1708
193 Ga0207658_10703307 3300025986 Bacteria 913
194 Ga0207677_10225585 3300026023 Bacteria 1506
195 Ga0207677_10636128 3300026023 Bacteria 940
196 Ga0207703_10082677 3300026035 Bacteria 2681
197 Ga0207703_10465000 3300026035 Bacteria 1183
198 Ga0207703_11124969 3300026035 Unclassified 754
199 Ga0207708_10084484 3300026075 Bacteria 2441
200 Ga0207708_10112769 3300026075 Bacteria 2112
201 Ga0207708_10236180 3300026075 Bacteria 1469
202 Ga0207702_10016354 3300026078 Bacteria 6141
203 Ga0207641_10006715 3300026088 Bacteria 9640
204 Ga0207648_10010953 3300026089 Bacteria 8566
205 Ga0207674_10408057 3300026116 Bacteria 1313
206 Ga0207683_10088037 3300026121 Bacteria 2762
207 Ga0209813_10045543 3300027866 Unclassified 1352
208 Ga0207428_10016303 3300027907 Bacteria 6394
209 Ga0207428_10024197 3300027907 Bacteria 5101
210 Ga0268265_10042475 3300028380 Bacteria 3374
211 Ga0268265_10968115 3300028380 Unclassified 839
212 Ga0268264_10196031 3300028381 Bacteria 1844
213 Ga0307405_10147694 3300031731 Unclassified 1649
214 Ga0307411_10152730 3300032005 Bacteria 1718
215 Ga0373930_0003454 3300034816 Unclassified 2507
216 Ga0373948_0003647 3300034817 Bacteria 2384
217 Ga0373958_0002089 3300034819 Unclassified 2764
218 Ga0373938_0005946 3300034957 Bacteria 2090
219 Ga0373928_0008029 3300035084 Bacteria 2043
220 Ga0373929_0002987 3300035085 Bacteria 3077
221 Ga0373940_0010722 3300035088 Bacteria 2163
222 Ga0373949_0000491 3300035090 Bacteria 13446
223 Ga0373951_0000442 3300035091 Bacteria 12077
224 Ga0373945_0071004 3300035116 Unclassified 1318
225 Ga0373960_0000257 3300035121 Bacteria 10019
226 Ga0373960_0013842 3300035121 Unclassified 2032
227 Ga0373942_0001161 3300035207 Bacteria 6989
228 Ga0373961_0001563 3300035241 Bacteria 6560
229 Ga0373962_0015010 3300035242 Bacteria 1980
230 Ga0373947_0035678 3300035725 Bacteria 2945
231 Ga0395898_0441524 3300037466 Unclassified 1240
232 Ga0436365_1327625 3300039437 Bacteria 2647
233 Ga0436363_0815205 3300039450 Bacteria 8060
234 Ga0451576_0030975 3300045051 Bacteria 5707
235 Ga0451576_0656389 3300045051 Unclassified 1102
236 Ga0495594_0019774 3300046499 Bacteria 3582
237 Ga0495586_0034841 3300046535 Bacteria 2704
238 Ga0495684_0332073 3300047471 Unclassified 1084
239 Ga0495593_0395784 3300047673 Unclassified 691
240 Ga0496101_0299910 3300048904 Bacteria 1258
241 Ga0496102_0002617 3300048905 Bacteria 15301
242 Ga0496103_0183117 3300048906 Bacteria 1346
243 Ga0496104_0982943 3300048907 Unclassified 748
244 Ga0496106_0587605 3300048909 Bacteria 892
245 Ga0496107_0463839 3300048910 Bacteria 940
246 Ga0496109_0005224 3300048912 Bacteria 10842
247 Ga0496110_0004831 3300048913 Bacteria 10502
248 Ga0496111_0055681 3300048914 Bacteria 2861
249 Ga0496112_0033056 3300048915 Bacteria 5024
250 Ga0496112_0148349 3300048915 Bacteria 2313
251 Ga0496115_0197890 3300048918 Unclassified 1660
252 Ga0501067_0475753 3300049583 Bacteria 698
253 Ga0501069_0151451 3300049585 Bacteria 1333
254 Ga0501071_0967349 3300049587 Bacteria 657
255 nmdc:mga00v17_22548_c1 3300050491 Bacteria 3634
256 nmdc:mga0k408_254185_c1 3300050493 Bacteria 1049
257 nmdc:mga07m45_32720_c1 3300050496 Bacteria 2884
258 nmdc:mga05p37_106206_c1 3300050507 Unclassified 3454
259 nmdc:mga05p37_375907_c1 3300050507 Bacteria 1666
260 nmdc:mga05p37_455204_c1 3300050507 Bacteria 1480
261 nmdc:mga09592_36007_c1 3300050508 Bacteria 4145
262 nmdc:mga09592_369920_c1 3300050508 Unclassified 1240
263 nmdc:mga09592_4426_c1 3300050508 Bacteria 11376
264 nmdc:mga0qj67_171828_c1 3300050509 Bacteria 1760
265 nmdc:mga06r32_1189171_c1 3300050510 Bacteria 709
266 nmdc:mga06r32_36689_c1 3300050510 Bacteria 4635
267 nmdc:mga06r32_839118_c1 3300050510 Unclassified 878
268 nmdc:mga08y16_27383_c1 3300050511 Bacteria 6006
269 nmdc:mga08y16_3573_c1 3300050511 Bacteria 16147
270 nmdc:mga08y16_892550_c1 3300050511 Unclassified 875
271 nmdc:mga0n895_11716_c1 3300050512 Bacteria 7837
272 nmdc:mga0n895_1690_c1 3300050512 Bacteria 16667
273 nmdc:mga0n895_9_c1 3300050512 Bacteria 119566
274 nmdc:mga0rr50_1628_c1 3300050513 Bacteria 12344
275 nmdc:mga0rr50_42420_c1 3300050513 Bacteria 3322
276 nmdc:mga0rr50_62_c1 3300050513 Bacteria 64188
277 nmdc:mga0rr50_9146_c1 3300050513 Bacteria 6207
278 nmdc:mga0rr50_956031_c1 3300050513 Bacteria 730
279 nmdc:mga08x19_1371_c1 3300050514 Bacteria 15084
280 nmdc:mga0a205_4479_c1 3300050515 Bacteria 12539
281 nmdc:mga0a205_86622_c1 3300050515 Unclassified 3025
282 Ga0068869_100142077
283 rootL2_10060320
284 Ga0065712_10070420
285 Ga0065715_10325436
286 Ga0065707_10264346
287 Ga0070676_10004675
288 Ga0070690_100632167
289 Ga0070670_100002121
290 Ga0070677_10009783
291 Ga0070677_10010559
292 Ga0068868_100728566
293 Ga0070660_100032885
294 Ga0070689_100086314
295 Ga0070689_100237859
296 Ga0070687_100251708
297 Ga0070668_100729055
298 Ga0070669_100049384
299 Ga0070669_100120998
300 Ga0070675_100006782
301 Ga0070675_100050845
302 Ga0070675_100472793
303 Ga0070671_100027645
304 Ga0070674_100102164
305 Ga0070674_100116743
306 Ga0070673_100019093
307 Ga0070673_100049093
308 Ga0070673_100100410
309 Ga0070659_100020753
310 Ga0070667_100043267
311 Ga0070667_100053637
312 Ga0070667_100202068
313 Ga0070667_100564062
314 Ga0070701_10085748
315 Ga0070711_100162506
316 Ga0070700_100045798
317 Ga0070700_100061012
318 Ga0070708_100000280
319 Ga0070708_100250250
320 Ga0070663_100039926
321 Ga0070663_100450914
322 Ga0070678_100062567
323 Ga0070678_100202767
324 Ga0068867_100028341
325 Ga0070706_100211176
326 Ga0070707_100005050
327 Ga0070707_100268422
328 Ga0070698_100053049
329 Ga0070698_100070971
330 Ga0070698_100291767
331 Ga0070698_100556367
332 Ga0070699_100018105
333 Ga0070699_100111167
334 Ga0070699_100160383
335 Ga0070699_100498069
336 Ga0070684_100008770
337 Ga0070697_100648163
338 Ga0070672_100150607
339 Ga0070686_100079721
340 Ga0068855_100132841
341 Ga0070664_100006221
342 Ga0070664_100304184
343 Ga0070664_100347105
344 Ga0070664_101140354
345 Ga0068857_100366696
346 Ga0068857_100682376
347 Ga0068854_100065874
348 Ga0068859_100034925
349 Ga0068859_100144768
350 Ga0068864_100039198
351 Ga0068864_100108541
352 Ga0068866_10399671
353 Ga0068861_100043599
354 Ga0068863_100035925
355 Ga0068858_100317705
356 Ga0068860_100067568
357 Ga0068860_100265325
358 Ga0068862_100048695
359 Ga0081455_10010855
360 Ga0081455_10055327
361 Ga0070716_100350271
362 Ga0070712_100294075
363 Ga0075367_10017697
364 Ga0075366_10066096
365 Ga0097621_100436178
366 Ga0075370_10212491
367 Ga0068871_100030125
368 Ga0075428_100082525
369 Ga0075428_100291409
370 Ga0075428_100395310
371 Ga0075428_100463258
372 Ga0075430_100132671
373 Ga0075431_100170367
374 Ga0075431_100674647
375 Ga0075433_10000279
376 Ga0075434_100002170
377 Ga0075434_100003985
378 Ga0075434_100005935
379 Ga0075434_100470504
380 Ga0075429_100056844
381 Ga0075429_100245579
382 Ga0075436_100001199
383 Ga0097620_100034925
384 Ga0097620_100144767
385 Ga0075435_100000043
386 Ga0075435_100005133
387 Ga0075435_100005993
388 Ga0105240_10160996
389 Ga0111539_10004944
390 Ga0111539_10039995
391 Ga0111539_11353735
392 Ga0105245_10241809
393 Ga0105247_10291574
394 Ga0105247_10478655
395 Ga0114129_10021189
396 Ga0114129_10059051
397 Ga0114129_10138953
398 Ga0114129_10229044
399 Ga0114129_10537554
400 Ga0114129_10562904
401 Ga0105243_10021021
402 Ga0105243_11290942
403 Ga0105243_11467029
404 Ga0105241_10421011
405 Ga0105242_10054900
406 Ga0105242_10528462
407 Ga0105248_10033207
408 Ga0105248_10917334
409 Ga0105237_10045534
410 Ga0105237_10981015
411 Ga0105249_10024231
412 Ga0105249_10525479
413 Ga0105246_10118323
414 Ga0105246_10325276
415 Ga0157373_10139649
416 Ga0157369_10020841
417 Ga0157374_10103187
418 Ga0157378_10090360
419 Ga0157372_10561081
420 Ga0157375_10053125
421 Ga0157375_10175630
422 Ga0163163_10000410
423 Ga0163163_10003257
424 Ga0163163_10023914
425 Ga0157380_10035571
426 Ga0157377_10140008
427 Ga0157377_10187671
428 Ga0157379_10128312
429 Ga0157376_10803631
430 Ga0213876_10186853
431 Ga0207666_1021460
432 Ga0207682_10008875
433 Ga0207682_10023824
434 Ga0207680_10019082
435 Ga0207680_10674954
436 Ga0207645_10010248
437 Ga0207645_10043201
438 Ga0207684_10223056
439 Ga0207695_10040702
440 Ga0207671_10232153
441 Ga0207663_10433208
442 Ga0207662_10020937
443 Ga0207662_10371730
444 Ga0207657_10178404
445 Ga0207649_10091566
446 Ga0207646_10006690
447 Ga0207646_10183214
448 Ga0207681_10030769
449 Ga0207681_10034832
450 Ga0207659_10322778
451 Ga0207659_10441417
452 Ga0207644_10010941
453 Ga0207690_10270586
454 Ga0207706_10318903
455 Ga0207686_10029804
456 Ga0207670_10018356
457 Ga0207669_10007271
458 Ga0207669_10099982
459 Ga0207669_10463793
460 Ga0207691_10087985
461 Ga0207691_10116341
462 Ga0207711_10014017
463 Ga0207711_10031828
464 Ga0207689_10009059
465 Ga0207667_10057857
466 Ga0207651_10044602
467 Ga0207651_10056574
468 Ga0207651_10076193
469 Ga0207712_10017885
470 Ga0207640_10219246
471 Ga0207658_10074542
472 Ga0207658_10175119
473 Ga0207658_10189591
474 Ga0207658_10703307
475 Ga0207677_10225585
476 Ga0207677_10636128
477 Ga0207703_10082677
478 Ga0207703_10465000
479 Ga0207703_11124969
480 Ga0207708_10084484
481 Ga0207708_10112769
482 Ga0207708_10236180
483 Ga0207702_10016354
484 Ga0207641_10006715
485 Ga0207648_10010953
486 Ga0207674_10408057
487 Ga0207683_10088037
488 Ga0209813_10045543
489 Ga0207428_10016303
490 Ga0207428_10024197
491 Ga0268265_10042475
492 Ga0268265_10968115
493 Ga0268264_10196031
494 Ga0307405_10147694
495 Ga0307411_10152730
496 Ga0373930_0003454
497 Ga0373948_0003647
498 Ga0373958_0002089
499 Ga0373938_0005946
500 Ga0373928_0008029
501 Ga0373929_0002987
502 Ga0373940_0010722
503 Ga0373949_0000491
504 Ga0373951_0000442
505 Ga0373945_0071004
506 Ga0373960_0000257
507 Ga0373960_0013842
508 Ga0373942_0001161
509 Ga0373961_0001563
510 Ga0373962_0015010
511 Ga0373947_0035678
512 Ga0395898_0441524
513 Ga0436365_1327625
514 Ga0436363_0815205
515 Ga0451576_0030975
516 Ga0451576_0656389
517 Ga0495594_0019774
518 Ga0495586_0034841
519 Ga0495684_0332073
520 Ga0495593_0395784
521 Ga0496101_0299910
522 Ga0496102_0002617
523 Ga0496103_0183117
524 Ga0496104_0982943
525 Ga0496106_0587605
526 Ga0496107_0463839
527 Ga0496109_0005224
528 Ga0496110_0004831
529 Ga0496111_0055681
530 Ga0496112_0033056
531 Ga0496112_0148349
532 Ga0496115_0197890
533 Ga0501067_0475753
534 Ga0501069_0151451
535 Ga0501071_0967349
536 nmdc:mga00v17_22548_c1
537 nmdc:mga0k408_254185_c1
538 nmdc:mga07m45_32720_c1
539 nmdc:mga05p37_106206_c1
540 nmdc:mga05p37_375907_c1
541 nmdc:mga05p37_455204_c1
542 nmdc:mga09592_36007_c1
543 nmdc:mga09592_369920_c1
544 nmdc:mga09592_4426_c1
545 nmdc:mga0qj67_171828_c1
546 nmdc:mga06r32_1189171_c1
547 nmdc:mga06r32_36689_c1
548 nmdc:mga06r32_839118_c1
549 nmdc:mga08y16_27383_c1
550 nmdc:mga08y16_3573_c1
551 nmdc:mga08y16_892550_c1
552 nmdc:mga0n895_11716_c1
553 nmdc:mga0n895_1690_c1
554 nmdc:mga0n895_9_c1
555 nmdc:mga0rr50_1628_c1
556 nmdc:mga0rr50_42420_c1
557 nmdc:mga0rr50_62_c1
558 nmdc:mga0rr50_9146_c1
559 nmdc:mga0rr50_956031_c1
560 nmdc:mga08x19_1371_c1
561 nmdc:mga0a205_4479_c1
562 nmdc:mga0a205_86622_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.764 27 220
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.738 27 220
5nxb-assembly1.cif.gz_B mouse galactocerebrosidase in complex with saposin a 0.6797 31 221
4ufm-assembly1.cif.gz_A mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj 0.6747 31 221
6y6s-assembly1.cif.gz_A mouse galactocerebrosidase complexed with galacto-noeurostegine gns at ph 6.8 0.6697 23 221
ID Description Score Start End Superfamily
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.764 27 220 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.738 27 220 2.60.120.560
af_Q9VPU6_160_298_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6965 73 221 2.60.120.200
af_Q09581_147_296_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.678 64 221 2.60.120.200
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6731 25 218 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A2V9A3A8-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9556 53 221
AF-A0A418PNR0-F1-model_v4 DUF1080 domain-containing protein 0.9478 33 221
AF-A0A2V8WSB1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9451 132 219
AF-A0A0R1TZZ5-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9449 28 221
AF-A0A2V9A3A8-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9447 53 221

Map