F384075

General Info

Members Datasets Scaffolds Average Seq Length
281 98 562 140

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100023622|Ga0070683_1000236223
Length 156
Sequence MEVRLAPLQARNNLVMPDSVVTVAEVKAFKTQSGNTRFVLRDGEGREYTTFREKIARDAVAAEGRKARITFHEQQRGNFTNVYLDAVEPLEEPEAEGSSEAVEEVAWKTAVDAAPWLLGGEPEEAVQPDELFERLQPFKERVADDIRGEAADEPGD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
61 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
62 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
72 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
92 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
93 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
98 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 3.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.39
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 16.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100023622 3300005329 Bacteria 5500
2 Ga0070683_100151497 3300005329 Bacteria 2199
3 Ga0070680_100046969 3300005336 Bacteria 3514
4 Ga0070680_100262337 3300005336 Bacteria 1461
5 Ga0070682_100034483 3300005337 Bacteria 3083
6 Ga0070682_100054026 3300005337 Bacteria 2519
7 Ga0070660_100019201 3300005339 Bacteria 5004
8 Ga0070660_100275579 3300005339 Bacteria 1376
9 Ga0070661_100121213 3300005344 Bacteria 1959
10 Ga0070661_100974357 3300005344 Bacteria 702
11 Ga0070659_100235879 3300005366 Bacteria 1512
12 Ga0070714_100012344 3300005435 Bacteria 6819
13 Ga0070714_100090723 3300005435 Bacteria 2676
14 Ga0070713_100127091 3300005436 Bacteria 2244
15 Ga0070713_101915238 3300005436 Bacteria 575
16 Ga0070711_100544369 3300005439 Bacteria 962
17 Ga0070711_100897949 3300005439 Bacteria 756
18 Ga0070681_10072630 3300005458 Bacteria 3403
19 Ga0070681_10077307 3300005458 Bacteria 3286
20 Ga0070681_10114150 3300005458 Bacteria 2640
21 Ga0068867_100617506 3300005459 Bacteria 947
22 Ga0070679_100118137 3300005530 Bacteria 2636
23 Ga0070679_100378990 3300005530 Bacteria 1361
24 Ga0070679_100387266 3300005530 Bacteria 1344
25 Ga0068855_100058227 3300005563 Bacteria 4526
26 Ga0068855_101302481 3300005563 Unclassified 752
27 Ga0068857_100233432 3300005577 Bacteria 1683
28 Ga0068856_100200477 3300005614 Bacteria 2010
29 Ga0068856_100396667 3300005614 Unclassified 1399
30 Ga0068852_100098001 3300005616 Bacteria 2639
31 Ga0068852_102026449 3300005616 Unclassified 598
32 Ga0081539_10002453 3300005985 Bacteria 26142
33 Ga0081539_10008907 3300005985 Bacteria 8562
34 Ga0070717_10003402 3300006028 Bacteria 11383
35 Ga0070712_100031539 3300006175 Bacteria 3572
36 Ga0105240_10398041 3300009093 Bacteria 1552
37 Ga0105240_10582009 3300009093 Bacteria 1235
38 Ga0105240_11101835 3300009093 Bacteria 845
39 Ga0105241_10568658 3300009174 Bacteria 1020
40 Ga0105237_10779861 3300009545 Bacteria 963
41 Ga0105238_10168631 3300009551 Bacteria 2165
42 Ga0105238_10507434 3300009551 Unclassified 1207
43 Ga0157370_10287081 3300013104 Bacteria 1520
44 Ga0157369_10190051 3300013105 Bacteria 2158
45 Ga0157369_11341651 3300013105 Unclassified 729
46 Ga0157372_10050443 3300013307 Bacteria 4629
47 Ga0157372_10479173 3300013307 Bacteria 1451
48 Ga0157372_10979191 3300013307 Unclassified 980
49 Ga0182008_10029630 3300014497 Bacteria 2764
50 Ga0182008_10042748 3300014497 Bacteria 2257
51 Ga0182008_10089192 3300014497 Bacteria 1519
52 Ga0182006_1109798 3300015261 Bacteria 969
53 Ga0182005_1081773 3300015265 Bacteria 892
54 Ga0197907_11269122 3300020069 Bacteria 1304
55 Ga0206356_10293505 3300020070 Bacteria 1977
56 Ga0206350_11564348 3300020080 Bacteria 857
57 Ga0206354_10927268 3300020081 Bacteria 2104
58 Ga0206354_11580265 3300020081 Bacteria 754
59 Ga0206353_11313186 3300020082 Bacteria 4597
60 Ga0213874_10310747 3300021377 Bacteria 595
61 Ga0213874_10355767 3300021377 Unclassified 562
62 Ga0224712_10158259 3300022467 Unclassified 1008
63 Ga0224712_10352182 3300022467 Bacteria 696
64 Ga0207705_10311472 3300025909 Unclassified 1208
65 Ga0207707_10021454 3300025912 Bacteria 5646
66 Ga0207695_10490176 3300025913 Bacteria 1111
67 Ga0207693_10020256 3300025915 Bacteria 5291
68 Ga0207663_10412153 3300025916 Unclassified 1035
69 Ga0207663_11640395 3300025916 Bacteria 517
70 Ga0207660_10200556 3300025917 Bacteria 1558
71 Ga0207660_10262862 3300025917 Bacteria 1365
72 Ga0207657_10006656 3300025919 Bacteria 11959
73 Ga0207657_10011480 3300025919 Bacteria 8795
74 Ga0207652_10008146 3300025921 Bacteria 8415
75 Ga0207694_10094726 3300025924 Bacteria 2359
76 Ga0207664_10193233 3300025929 Bacteria 1753
77 Ga0207664_10246161 3300025929 Bacteria 1558
78 Ga0207664_10343299 3300025929 Unclassified 1320
79 Ga0207690_10363536 3300025932 Bacteria 1147
80 Ga0207661_10488206 3300025944 Unclassified 1125
81 Ga0207702_10288642 3300026078 Unclassified 1553
82 Ga0207702_11906058 3300026078 Unclassified 585
83 Ga0207674_10149006 3300026116 Bacteria 2297
84 Ga0207698_11644506 3300026142 Bacteria 658
85 Ga0307412_10456613 3300031911 Bacteria 1054
86 Ga0307409_100844829 3300031995 Unclassified 926
87 Ga0373936_0079802 3300035113 Bacteria 1361
88 Ga0373935_0088260 3300035692 Bacteria 2026
89 Ga0373935_0141033 3300035692 Bacteria 1628
90 Ga0373927_0542567 3300035695 Bacteria 769
91 Ga0395900_0317769 3300037418 Bacteria 1538
92 Ga0395900_0703509 3300037418 Unclassified 944
93 Ga0395900_0918501 3300037418 Bacteria 798
94 Ga0395898_0309602 3300037466 Unclassified 1506
95 Ga0395898_0960876 3300037466 Bacteria 791
96 Ga0395901_1058977 3300038443 Bacteria 784
97 Ga0395901_1288195 3300038443 Bacteria 693
98 Ga0436363_0157424 3300039450 Bacteria 1103
99 Ga0436363_0511607 3300039450 Bacteria 752
100 Ga0451789_0911576 3300041443 Bacteria 660
101 Ga0451793_1033667 3300041452 Bacteria 510
102 Ga0451853_3193520 3300041512 Bacteria 738
103 Ga0466969_0001028 3300044656 Bacteria 15062
104 Ga0466969_0004072 3300044656 Bacteria 7750
105 Ga0466972_0064843 3300044658 Bacteria 1748
106 Ga0466965_0035497 3300044683 Unclassified 2443
107 Ga0466965_0042504 3300044683 Unclassified 2242
108 Ga0466965_0047666 3300044683 Bacteria 2122
109 Ga0466965_0092322 3300044683 Bacteria 1541
110 Ga0466965_0261094 3300044683 Unclassified 931
111 Ga0466965_0555469 3300044683 Unclassified 649
112 Ga0466966_0000914 3300044684 Bacteria 18776
113 Ga0466966_0172808 3300044684 Bacteria 1312
114 Ga0466966_0518856 3300044684 Bacteria 717
115 Ga0466961_0009909 3300044693 Bacteria 6072
116 Ga0466961_0010217 3300044693 Bacteria 5979
117 Ga0466961_0073292 3300044693 Bacteria 2172
118 Ga0466961_0078398 3300044693 Bacteria 2092
119 Ga0466961_0207505 3300044693 Bacteria 1210
120 Ga0466961_0213496 3300044693 Bacteria 1190
121 Ga0466961_0276047 3300044693 Bacteria 1029
122 Ga0466961_0289114 3300044693 Bacteria 1002
123 Ga0466961_0316255 3300044693 Unclassified 952
124 Ga0466961_0630030 3300044693 Unclassified 644
125 Ga0466963_0000927 3300044694 Bacteria 14968
126 Ga0466963_0002193 3300044694 Bacteria 10792
127 Ga0466963_0006689 3300044694 Bacteria 6846
128 Ga0466963_0007605 3300044694 Bacteria 6468
129 Ga0466963_0007732 3300044694 Bacteria 6424
130 Ga0466963_0021030 3300044694 Bacteria 4111
131 Ga0466963_0029565 3300044694 Bacteria 3528
132 Ga0466963_0030594 3300044694 Bacteria 3476
133 Ga0466963_0034235 3300044694 Bacteria 3305
134 Ga0466963_0036783 3300044694 Unclassified 3193
135 Ga0466963_0041085 3300044694 Bacteria 3032
136 Ga0466963_0043687 3300044694 Bacteria 2948
137 Ga0466963_0096580 3300044694 Bacteria 2018
138 Ga0466963_0099492 3300044694 Bacteria 1989
139 Ga0466963_0166942 3300044694 Bacteria 1533
140 Ga0466963_0174830 3300044694 Unclassified 1498
141 Ga0466963_0214636 3300044694 Bacteria 1347
142 Ga0466963_0455217 3300044694 Bacteria 903
143 Ga0466963_0626261 3300044694 Unclassified 759
144 Ga0466963_0732403 3300044694 Unclassified 697
145 Ga0466964_0005129 3300044706 Bacteria 4851
146 Ga0466964_0007675 3300044706 Bacteria 4038
147 Ga0466964_0009967 3300044706 Bacteria 3578
148 Ga0466964_0015545 3300044706 Bacteria 2898
149 Ga0466964_0017577 3300044706 Unclassified 2736
150 Ga0466964_0024920 3300044706 Unclassified 2333
151 Ga0466964_0035087 3300044706 Unclassified 2004
152 Ga0466964_0044626 3300044706 Bacteria 1801
153 Ga0466964_0048279 3300044706 Bacteria 1740
154 Ga0466964_0054104 3300044706 Unclassified 1654
155 Ga0466964_0098332 3300044706 Unclassified 1286
156 Ga0466964_0105169 3300044706 Unclassified 1250
157 Ga0466964_0164668 3300044706 Bacteria 1039
158 Ga0466964_0277723 3300044706 Bacteria 836
159 Ga0466971_0001398 3300044719 Bacteria 10130
160 Ga0466971_0016879 3300044719 Bacteria 3226
161 Ga0466971_0070223 3300044719 Bacteria 1590
162 Ga0466971_0119318 3300044719 Bacteria 1220
163 Ga0466968_0002028 3300044735 Bacteria 7372
164 Ga0466968_0004291 3300044735 Bacteria 5324
165 Ga0466968_0020267 3300044735 Bacteria 2683
166 Ga0466968_0055131 3300044735 Bacteria 1705
167 Ga0466968_0060899 3300044735 Unclassified 1628
168 Ga0466968_0171603 3300044735 Bacteria 1005
169 Ga0466968_0387052 3300044735 Bacteria 684
170 Ga0466968_0652177 3300044735 Unclassified 534
171 Ga0466957_0003407 3300044842 Bacteria 8728
172 Ga0466957_0004281 3300044842 Bacteria 7914
173 Ga0466957_0007506 3300044842 Bacteria 6161
174 Ga0466957_0018295 3300044842 Bacteria 4114
175 Ga0466957_0041118 3300044842 Bacteria 2795
176 Ga0466957_0042999 3300044842 Unclassified 2734
177 Ga0466957_0059703 3300044842 Bacteria 2338
178 Ga0466957_0092021 3300044842 Unclassified 1901
179 Ga0466957_0098024 3300044842 Bacteria 1844
180 Ga0466957_0294549 3300044842 Bacteria 1089
181 Ga0466957_0301664 3300044842 Bacteria 1076
182 Ga0466957_0473816 3300044842 Bacteria 865
183 Ga0466957_1343027 3300044842 Bacteria 519
184 Ga0466960_0240120 3300044901 Bacteria 1003
185 Ga0466959_0000296 3300045049 Bacteria 29640
186 Ga0466959_0004963 3300045049 Bacteria 9016
187 Ga0466959_0012854 3300045049 Bacteria 6057
188 Ga0466959_0213143 3300045049 Bacteria 1341
189 Ga0466959_0265276 3300045049 Bacteria 1181
190 Ga0466958_0002810 3300045836 Bacteria 8861
191 Ga0466958_0006418 3300045836 Bacteria 6398
192 Ga0466958_0008491 3300045836 Bacteria 5703
193 Ga0466958_0011610 3300045836 Bacteria 4964
194 Ga0466958_0037632 3300045836 Unclassified 2899
195 Ga0466958_0067910 3300045836 Bacteria 2178
196 Ga0466958_0310671 3300045836 Bacteria 1013
197 Ga0466958_0330841 3300045836 Unclassified 979
198 Ga0466958_0450721 3300045836 Bacteria 833
199 Ga0466958_0525154 3300045836 Bacteria 768
200 Ga0466967_0001798 3300045976 Bacteria 12847
201 Ga0466967_0007571 3300045976 Bacteria 7848
202 Ga0466967_0009811 3300045976 Bacteria 7140
203 Ga0466967_0014493 3300045976 Bacteria 6143
204 Ga0466967_0017277 3300045976 Bacteria 5721
205 Ga0466967_0020423 3300045976 Bacteria 5354
206 Ga0466967_0031889 3300045976 Bacteria 4443
207 Ga0466967_0032700 3300045976 Bacteria 4396
208 Ga0466967_0037886 3300045976 Bacteria 4131
209 Ga0466967_0041541 3300045976 Bacteria 3966
210 Ga0466967_0043227 3300045976 Bacteria 3900
211 Ga0466967_0052372 3300045976 Bacteria 3582
212 Ga0466967_0076649 3300045976 Bacteria 3008
213 Ga0466967_0079213 3300045976 Bacteria 2961
214 Ga0466967_0079264 3300045976 Bacteria 2960
215 Ga0466967_0092607 3300045976 Bacteria 2748
216 Ga0466967_0105314 3300045976 Bacteria 2584
217 Ga0466967_0126630 3300045976 Unclassified 2366
218 Ga0466967_0131920 3300045976 Bacteria 2320
219 Ga0466967_0145458 3300045976 Bacteria 2211
220 Ga0466967_0157388 3300045976 Bacteria 2129
221 Ga0466967_0175688 3300045976 Bacteria 2017
222 Ga0466967_0186065 3300045976 Bacteria 1961
223 Ga0466967_0193240 3300045976 Bacteria 1924
224 Ga0466967_0223475 3300045976 Bacteria 1790
225 Ga0466967_0229016 3300045976 Bacteria 1769
226 Ga0466967_0263434 3300045976 Unclassified 1650
227 Ga0466967_0386079 3300045976 Bacteria 1360
228 Ga0466967_0419230 3300045976 Bacteria 1304
229 Ga0466967_0592201 3300045976 Unclassified 1094
230 Ga0466967_0645529 3300045976 Bacteria 1046
231 Ga0466967_2364425 3300045976 Bacteria 527
232 Ga0495630_0148309 3300046517 Bacteria 1784
233 Ga0495674_1079564 3300047319 Bacteria 612
234 Ga0496100_0088039 3300048903 Bacteria 2113
235 Ga0496100_0373435 3300048903 Bacteria 1082
236 Ga0496100_0521405 3300048903 Bacteria 917
237 Ga0496101_0127315 3300048904 Bacteria 1931
238 Ga0496104_0099968 3300048907 Bacteria 2777
239 Ga0496104_0152435 3300048907 Bacteria 2218
240 Ga0496104_0885852 3300048907 Bacteria 798
241 Ga0496105_0102663 3300048908 Bacteria 2361
242 Ga0496105_0116875 3300048908 Bacteria 2200
243 Ga0496107_0348797 3300048910 Bacteria 1102
244 Ga0496108_0033364 3300048911 Bacteria 4277
245 Ga0496108_0927603 3300048911 Bacteria 746
246 Ga0496109_0053646 3300048912 Bacteria 3677
247 Ga0496109_0169402 3300048912 Bacteria 2048
248 Ga0496109_0231154 3300048912 Bacteria 1740
249 Ga0496109_0277361 3300048912 Bacteria 1580
250 Ga0496109_1008593 3300048912 Bacteria 770
251 Ga0496110_0022960 3300048913 Bacteria 5302
252 Ga0496110_0138096 3300048913 Bacteria 2204
253 Ga0496111_0057905 3300048914 Bacteria 2805
254 Ga0496111_0114609 3300048914 Bacteria 1987
255 Ga0496112_0004702 3300048915 Bacteria 11627
256 Ga0496112_0018598 3300048915 Bacteria 6546
257 Ga0496112_0144652 3300048915 Bacteria 2346
258 Ga0496112_0787723 3300048915 Bacteria 876
259 Ga0496113_0067961 3300048916 Bacteria 2704
260 Ga0496113_0094139 3300048916 Bacteria 2314
261 Ga0496114_0249323 3300048917 Bacteria 1562
262 Ga0496114_0807135 3300048917 Unclassified 817
263 Ga0496115_0183244 3300048918 Bacteria 1731
264 Ga0501067_0056873 3300049583 Bacteria 2166
265 Ga0501067_0149921 3300049583 Unclassified 1299
266 Ga0501067_0429827 3300049583 Bacteria 737
267 Ga0501067_0521088 3300049583 Archaea 665
268 Ga0501069_0025906 3300049585 Bacteria 3209
269 Ga0501069_0049414 3300049585 Bacteria 2338
270 Ga0501069_0098403 3300049585 Bacteria 1659
271 Ga0501070_0742439 3300049586 Bacteria 774
272 Ga0587114_028923 3300059655 Bacteria 835
273 Ga0466962_0000438 3300061719 Bacteria 18116
274 Ga0466962_0005276 3300061719 Bacteria 6208
275 Ga0466962_0011345 3300061719 Bacteria 4291
276 Ga0466962_0027348 3300061719 Bacteria 2737
277 Ga0466962_0045610 3300061719 Bacteria 2095
278 Ga0466962_0090526 3300061719 Bacteria 1466
279 Ga0466962_0147166 3300061719 Unclassified 1142
280 Ga0530510_0332289 3300061734 Bacteria 1140
281 Ga0530510_0374684 3300061734 Bacteria 1071
282 Ga0070683_100023622
283 Ga0070683_100151497
284 Ga0070680_100046969
285 Ga0070680_100262337
286 Ga0070682_100034483
287 Ga0070682_100054026
288 Ga0070660_100019201
289 Ga0070660_100275579
290 Ga0070661_100121213
291 Ga0070661_100974357
292 Ga0070659_100235879
293 Ga0070714_100012344
294 Ga0070714_100090723
295 Ga0070713_100127091
296 Ga0070713_101915238
297 Ga0070711_100544369
298 Ga0070711_100897949
299 Ga0070681_10072630
300 Ga0070681_10077307
301 Ga0070681_10114150
302 Ga0068867_100617506
303 Ga0070679_100118137
304 Ga0070679_100378990
305 Ga0070679_100387266
306 Ga0068855_100058227
307 Ga0068855_101302481
308 Ga0068857_100233432
309 Ga0068856_100200477
310 Ga0068856_100396667
311 Ga0068852_100098001
312 Ga0068852_102026449
313 Ga0081539_10002453
314 Ga0081539_10008907
315 Ga0070717_10003402
316 Ga0070712_100031539
317 Ga0105240_10398041
318 Ga0105240_10582009
319 Ga0105240_11101835
320 Ga0105241_10568658
321 Ga0105237_10779861
322 Ga0105238_10168631
323 Ga0105238_10507434
324 Ga0157370_10287081
325 Ga0157369_10190051
326 Ga0157369_11341651
327 Ga0157372_10050443
328 Ga0157372_10479173
329 Ga0157372_10979191
330 Ga0182008_10029630
331 Ga0182008_10042748
332 Ga0182008_10089192
333 Ga0182006_1109798
334 Ga0182005_1081773
335 Ga0197907_11269122
336 Ga0206356_10293505
337 Ga0206350_11564348
338 Ga0206354_10927268
339 Ga0206354_11580265
340 Ga0206353_11313186
341 Ga0213874_10310747
342 Ga0213874_10355767
343 Ga0224712_10158259
344 Ga0224712_10352182
345 Ga0207705_10311472
346 Ga0207707_10021454
347 Ga0207695_10490176
348 Ga0207693_10020256
349 Ga0207663_10412153
350 Ga0207663_11640395
351 Ga0207660_10200556
352 Ga0207660_10262862
353 Ga0207657_10006656
354 Ga0207657_10011480
355 Ga0207652_10008146
356 Ga0207694_10094726
357 Ga0207664_10193233
358 Ga0207664_10246161
359 Ga0207664_10343299
360 Ga0207690_10363536
361 Ga0207661_10488206
362 Ga0207702_10288642
363 Ga0207702_11906058
364 Ga0207674_10149006
365 Ga0207698_11644506
366 Ga0307412_10456613
367 Ga0307409_100844829
368 Ga0373936_0079802
369 Ga0373935_0088260
370 Ga0373935_0141033
371 Ga0373927_0542567
372 Ga0395900_0317769
373 Ga0395900_0703509
374 Ga0395900_0918501
375 Ga0395898_0309602
376 Ga0395898_0960876
377 Ga0395901_1058977
378 Ga0395901_1288195
379 Ga0436363_0157424
380 Ga0436363_0511607
381 Ga0451789_0911576
382 Ga0451793_1033667
383 Ga0451853_3193520
384 Ga0466969_0001028
385 Ga0466969_0004072
386 Ga0466972_0064843
387 Ga0466965_0035497
388 Ga0466965_0042504
389 Ga0466965_0047666
390 Ga0466965_0092322
391 Ga0466965_0261094
392 Ga0466965_0555469
393 Ga0466966_0000914
394 Ga0466966_0172808
395 Ga0466966_0518856
396 Ga0466961_0009909
397 Ga0466961_0010217
398 Ga0466961_0073292
399 Ga0466961_0078398
400 Ga0466961_0207505
401 Ga0466961_0213496
402 Ga0466961_0276047
403 Ga0466961_0289114
404 Ga0466961_0316255
405 Ga0466961_0630030
406 Ga0466963_0000927
407 Ga0466963_0002193
408 Ga0466963_0006689
409 Ga0466963_0007605
410 Ga0466963_0007732
411 Ga0466963_0021030
412 Ga0466963_0029565
413 Ga0466963_0030594
414 Ga0466963_0034235
415 Ga0466963_0036783
416 Ga0466963_0041085
417 Ga0466963_0043687
418 Ga0466963_0096580
419 Ga0466963_0099492
420 Ga0466963_0166942
421 Ga0466963_0174830
422 Ga0466963_0214636
423 Ga0466963_0455217
424 Ga0466963_0626261
425 Ga0466963_0732403
426 Ga0466964_0005129
427 Ga0466964_0007675
428 Ga0466964_0009967
429 Ga0466964_0015545
430 Ga0466964_0017577
431 Ga0466964_0024920
432 Ga0466964_0035087
433 Ga0466964_0044626
434 Ga0466964_0048279
435 Ga0466964_0054104
436 Ga0466964_0098332
437 Ga0466964_0105169
438 Ga0466964_0164668
439 Ga0466964_0277723
440 Ga0466971_0001398
441 Ga0466971_0016879
442 Ga0466971_0070223
443 Ga0466971_0119318
444 Ga0466968_0002028
445 Ga0466968_0004291
446 Ga0466968_0020267
447 Ga0466968_0055131
448 Ga0466968_0060899
449 Ga0466968_0171603
450 Ga0466968_0387052
451 Ga0466968_0652177
452 Ga0466957_0003407
453 Ga0466957_0004281
454 Ga0466957_0007506
455 Ga0466957_0018295
456 Ga0466957_0041118
457 Ga0466957_0042999
458 Ga0466957_0059703
459 Ga0466957_0092021
460 Ga0466957_0098024
461 Ga0466957_0294549
462 Ga0466957_0301664
463 Ga0466957_0473816
464 Ga0466957_1343027
465 Ga0466960_0240120
466 Ga0466959_0000296
467 Ga0466959_0004963
468 Ga0466959_0012854
469 Ga0466959_0213143
470 Ga0466959_0265276
471 Ga0466958_0002810
472 Ga0466958_0006418
473 Ga0466958_0008491
474 Ga0466958_0011610
475 Ga0466958_0037632
476 Ga0466958_0067910
477 Ga0466958_0310671
478 Ga0466958_0330841
479 Ga0466958_0450721
480 Ga0466958_0525154
481 Ga0466967_0001798
482 Ga0466967_0007571
483 Ga0466967_0009811
484 Ga0466967_0014493
485 Ga0466967_0017277
486 Ga0466967_0020423
487 Ga0466967_0031889
488 Ga0466967_0032700
489 Ga0466967_0037886
490 Ga0466967_0041541
491 Ga0466967_0043227
492 Ga0466967_0052372
493 Ga0466967_0076649
494 Ga0466967_0079213
495 Ga0466967_0079264
496 Ga0466967_0092607
497 Ga0466967_0105314
498 Ga0466967_0126630
499 Ga0466967_0131920
500 Ga0466967_0145458
501 Ga0466967_0157388
502 Ga0466967_0175688
503 Ga0466967_0186065
504 Ga0466967_0193240
505 Ga0466967_0223475
506 Ga0466967_0229016
507 Ga0466967_0263434
508 Ga0466967_0386079
509 Ga0466967_0419230
510 Ga0466967_0592201
511 Ga0466967_0645529
512 Ga0466967_2364425
513 Ga0495630_0148309
514 Ga0495674_1079564
515 Ga0496100_0088039
516 Ga0496100_0373435
517 Ga0496100_0521405
518 Ga0496101_0127315
519 Ga0496104_0099968
520 Ga0496104_0152435
521 Ga0496104_0885852
522 Ga0496105_0102663
523 Ga0496105_0116875
524 Ga0496107_0348797
525 Ga0496108_0033364
526 Ga0496108_0927603
527 Ga0496109_0053646
528 Ga0496109_0169402
529 Ga0496109_0231154
530 Ga0496109_0277361
531 Ga0496109_1008593
532 Ga0496110_0022960
533 Ga0496110_0138096
534 Ga0496111_0057905
535 Ga0496111_0114609
536 Ga0496112_0004702
537 Ga0496112_0018598
538 Ga0496112_0144652
539 Ga0496112_0787723
540 Ga0496113_0067961
541 Ga0496113_0094139
542 Ga0496114_0249323
543 Ga0496114_0807135
544 Ga0496115_0183244
545 Ga0501067_0056873
546 Ga0501067_0149921
547 Ga0501067_0429827
548 Ga0501067_0521088
549 Ga0501069_0025906
550 Ga0501069_0049414
551 Ga0501069_0098403
552 Ga0501070_0742439
553 Ga0587114_028923
554 Ga0466962_0000438
555 Ga0466962_0005276
556 Ga0466962_0011345
557 Ga0466962_0027348
558 Ga0466962_0045610
559 Ga0466962_0090526
560 Ga0466962_0147166
561 Ga0530510_0332289
562 Ga0530510_0374684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cqm-assembly1.cif.gz_A crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.7849 12 91
3sbf-assembly2.cif.gz_B crystal structure of the mutant p311a of enolase superfamily member from vibrionales bacterium complexed with mg and d-arabinonate 0.7783 19 49
4e4f-assembly1.cif.gz_D crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1 0.7732 20 49
4bwg-assembly2.cif.gz_I structural basis of subtilase cytotoxin subab assembly 0.7667 18 87
3thu-assembly1.cif.gz_A crystal structure of an enolase from sphingomonas sp. ska58 (efi target efi-501683) with bound mg 0.7661 19 49
ID Description Score Start End Superfamily
af_Q54LX4_3_401_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8794 21 49 3.50.50.60
af_Q8AV10_22_90_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8367 22 47 2.40.50.40
af_B7WN56_8_106_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7668 22 47 2.30.29.30
af_Q7KWY3_300_471_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7627 21 49 2.130.10.10
af_O75037_1289_1495_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7623 21 49 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A136K043-F1-model_v4 Uncharacterized protein 0.8685 17 91
AF-A0A3D0W0J9-F1-model_v4 DNA-directed DNA polymerase (EC 2.7.7.7) 0.8125 18 91 GO:0003887
GO:0006260
GO:0008408
AF-A0A3D5RKE7-F1-model_v4 3'-5' exonuclease 0.8052 13 94 GO:0004527
GO:0031125
AF-A0A2V9JEI9-F1-model_v4 Recombinase RecT 0.8036 6 87 GO:0003677
GO:0006259
AF-A0A1M6N2C7-F1-model_v4 3'-5' exoribonuclease 0.8009 18 93 GO:0016787
GO:0031125

Map