F383997

General Info

Members Datasets Scaffolds Average Seq Length
280 171 245 230

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919046199|2919048313
Length 282
Sequence PIFLVGLMGSVHCIGMCGGIVGALSSAGPGRAASARTPVTLSASALGAVEPGALSRVIPIQIAGGSTGTVPVFTQDLVRVLSYNLGRLSSYALAGALAGGIAAGLLRGADVLGWLAPAQTAAYVMTNLVLVLLGLYLTQWWTGMTRIEQLGSGLWARLRPHAARLVPVDTPQKALLLGSLWGWLPCGMVYSALLTALMAGSAVQGALTMLAFGAGTLPVLLAAGLSGARLRQLASRPAVRRAAGVIVLAFGILGLLRAAEIGGMGIARGWIDVFCITPGHGA

Samples

Sample ID Description Type Environment
1 2511231016 Pseudomonas sp. GM50 Isolate Nodule
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
6 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
7 2738541297 Duganella sp. GV083 Isolate Unclassified
8 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
9 2818991436 Collimonas arenae 515 Isolate Unclassified
10 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
11 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
12 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
13 2842711865 Duganella sp. R-73148 Isolate Unclassified
14 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
15 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
16 2857553236 Duganella sp. R-74557 Isolate Unclassified
17 2857558681 Duganella sp. R-74565 Isolate Unclassified
18 2857564685 Duganella sp. R-74599 Isolate Unclassified
19 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
20 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
21 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
22 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
23 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
24 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
25 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
26 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
27 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
28 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
29 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
30 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
34 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
77 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
78 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
79 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
80 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
83 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
166 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
167 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
168 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
169 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
170 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
171 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.5
Metatranscriptomes 0
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 1.07
Rhizoplane 1.07
Rhizosphere 74.64
Stem 0
Stem Tuber 0
Unclassified 16.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1005488 3300002737 Bacteria 2465
2 Ga0055538_1000030 3300003751 Bacteria 200831
3 Ga0055539_1000040 3300003752 Bacteria 200831
4 Ga0055533_1000050 3300003756 Bacteria 200831
5 Ga0055525_1000060 3300003759 Bacteria 200831
6 Ga0055526_1000007 3300003771 Bacteria 321998
7 Ga0055536_1000106 3300003781 Bacteria 73349
8 Ga0055541_1000027 3300003841 Bacteria 200831
9 Ga0065714_10023199 3300005288 Bacteria 2044
10 Ga0065714_10067741 3300005288 Bacteria 5236
11 Ga0065714_10090154 3300005288 Bacteria 1948
12 Ga0065712_10067744 3300005290 Bacteria 68998
13 Ga0070670_100018310 3300005331 Bacteria 6009
14 Ga0068855_100000243 3300005563 Bacteria 68537
15 Ga0068855_100078328 3300005563 Bacteria 3834
16 Ga0068854_100003412 3300005578 Bacteria 9905
17 Ga0068856_100050845 3300005614 Bacteria 4087
18 Ga0105251_10000016 3300009011 Bacteria 146400
19 Ga0105251_10018623 3300009011 Bacteria 3686
20 Ga0105240_10012212 3300009093 Bacteria 11874
21 Ga0105237_10009327 3300009545 Bacteria 10509
22 Ga0105238_10000547 3300009551 Bacteria 39292
23 Ga0105239_10045286 3300010375 Bacteria 4822
24 Ga0157371_10000546 3300013102 Bacteria 44800
25 Ga0182008_10011751 3300014497 Bacteria 4646
26 Ga0182006_1000776 3300015261 Bacteria 21613
27 Ga0182006_1005273 3300015261 Bacteria 6185
28 Ga0182007_10002459 3300015262 Bacteria 9202
29 Ga0182005_1001090 3300015265 Bacteria 11370
30 Ga0182005_1036565 3300015265 Bacteria 1335
31 Ga0182005_1040710 3300015265 Bacteria 1264
32 Ga0213872_10005182 3300021361 Bacteria 6747
33 Ga0209784_100005 3300025224 Bacteria 1040422
34 Ga0209566_100005 3300025225 Bacteria 1040422
35 Ga0209674_100009 3300025226 Bacteria 1040422
36 Ga0209563_100012 3300025230 Bacteria 1040422
37 Ga0209026_1002712 3300025250 Bacteria 6377
38 Ga0209677_100006 3300025253 Bacteria 1040422
39 Ga0209564_1000010 3300025295 Bacteria 885399
40 Ga0207655_1002363 3300025728 Bacteria 15401
41 Ga0207713_1000060 3300025735 Bacteria 213145
42 Ga0207695_10000913 3300025913 Bacteria 52943
43 Ga0207671_10073384 3300025914 Bacteria 2555
44 Ga0207671_10135873 3300025914 Bacteria 1891
45 Ga0207694_10002807 3300025924 Bacteria 14066
46 Ga0207650_10000602 3300025925 Bacteria 28766
47 Ga0207667_10000301 3300025949 Bacteria 68551
48 Ga0207702_10036879 3300026078 Bacteria 4090
49 Ga0265330_10017849 3300031235 Bacteria 3265
50 Ga0307413_10542702 3300031824 Bacteria 942
51 Ga0316582_0066306 3300036647 Bacteria 2327
52 Ga0316584_0024229 3300036712 Bacteria 4439
53 Ga0436361_0124286 3300039447 Bacteria 9919
54 Ga0451833_0699836 3300041491 Bacteria 3957
55 Ga0451841_1257103 3300041498 Bacteria 1558
56 Ga0451845_0844382 3300041501 Bacteria 1855
57 Ga0451849_0863919 3300041505 Bacteria 2071
58 Ga0451851_0350842 3300041507 Bacteria 4337
59 Ga0451853_2790300 3300041512 Unclassified 1760
60 Ga0439463_073834 3300042016 Bacteria 874
61 Ga0450910_024015 3300042147 Bacteria 934
62 Ga0495617_000730 3300046452 Bacteria 16239
63 Ga0495617_112360 3300046452 Bacteria 881
64 Ga0495627_000004 3300046453 Bacteria 640612
65 Ga0495592_0012116 3300046454 Bacteria 6542
66 Ga0495592_0169540 3300046454 Bacteria 1496
67 Ga0495590_0002059 3300046457 Bacteria 8437
68 Ga0495591_000323 3300046458 Bacteria 43207
69 Ga0495591_006928 3300046458 Bacteria 4904
70 Ga0495591_010949 3300046458 Bacteria 3467
71 Ga0495591_014506 3300046458 Bacteria 2828
72 Ga0495638_0008678 3300046460 Bacteria 7189
73 Ga0495638_0017123 3300046460 Bacteria 4840
74 Ga0495638_0143454 3300046460 Bacteria 1391
75 Ga0495651_0057012 3300046462 Bacteria 2999
76 Ga0495651_0057221 3300046462 Bacteria 2993
77 Ga0495651_0142958 3300046462 Bacteria 1733
78 Ga0495653_0011049 3300046463 Bacteria 7383
79 Ga0495650_0000309 3300046471 Bacteria 88068
80 Ga0495650_0000462 3300046471 Bacteria 63149
81 Ga0495650_0002329 3300046471 Bacteria 15710
82 Ga0495650_0018116 3300046471 Bacteria 3509
83 Ga0495605_0002498 3300046474 Bacteria 11368
84 Ga0495605_0003589 3300046474 Bacteria 9197
85 Ga0495605_0005263 3300046474 Bacteria 7551
86 Ga0495584_0001723 3300046491 Bacteria 12784
87 Ga0495584_0013033 3300046491 Bacteria 4241
88 Ga0495584_0054026 3300046491 Bacteria 2021
89 Ga0495584_0170326 3300046491 Bacteria 1107
90 Ga0495585_0015566 3300046492 Bacteria 4419
91 Ga0495596_0001071 3300046500 Bacteria 16265
92 Ga0495607_0000746 3300046501 Bacteria 31154
93 Ga0495607_0000792 3300046501 Bacteria 29964
94 Ga0495607_0001116 3300046501 Bacteria 24345
95 Ga0495607_0047980 3300046501 Bacteria 2498
96 Ga0495607_0082845 3300046501 Bacteria 1758
97 Ga0495607_0098463 3300046501 Bacteria 1570
98 Ga0495607_0182920 3300046501 Bacteria 1049
99 Ga0495607_0219650 3300046501 Bacteria 930
100 Ga0495583_0000008 3300046506 Bacteria 411092
101 Ga0495583_0003448 3300046506 Bacteria 12024
102 Ga0495583_0003569 3300046506 Bacteria 11703
103 Ga0495583_0003770 3300046506 Bacteria 11263
104 Ga0495606_0000042 3300046507 Bacteria 215099
105 Ga0495606_0000098 3300046507 Bacteria 151131
106 Ga0495606_0000716 3300046507 Bacteria 51314
107 Ga0495606_0000830 3300046507 Bacteria 46705
108 Ga0495606_0019930 3300046507 Bacteria 4966
109 Ga0495610_0017423 3300046512 Bacteria 4095
110 Ga0495610_0018731 3300046512 Bacteria 3896
111 Ga0495616_0004293 3300046513 Bacteria 9002
112 Ga0495616_0021828 3300046513 Bacteria 3461
113 Ga0495618_0087273 3300046514 Bacteria 1995
114 Ga0495620_0000535 3300046515 Bacteria 24315
115 Ga0495620_0049069 3300046515 Bacteria 1808
116 Ga0495628_0006788 3300046516 Bacteria 9954
117 Ga0495628_0055869 3300046516 Bacteria 3109
118 Ga0495631_0011293 3300046518 Bacteria 4397
119 Ga0495632_0005753 3300046519 Bacteria 8134
120 Ga0495637_0000023 3300046520 Bacteria 172407
121 Ga0495637_0001789 3300046520 Bacteria 12300
122 Ga0495637_0048744 3300046520 Bacteria 1782
123 Ga0495637_0101871 3300046520 Bacteria 1121
124 Ga0495643_0005572 3300046522 Bacteria 8476
125 Ga0495644_0001185 3300046523 Bacteria 10679
126 Ga0495648_0004622 3300046524 Bacteria 11701
127 Ga0495648_0011606 3300046524 Bacteria 6621
128 Ga0495648_0014385 3300046524 Bacteria 5796
129 Ga0495648_0109749 3300046524 Bacteria 1503
130 Ga0495648_0122279 3300046524 Bacteria 1397
131 Ga0495648_0143559 3300046524 Bacteria 1253
132 Ga0495648_0288478 3300046524 Bacteria 774
133 Ga0495663_0000588 3300046525 Bacteria 12752
134 Ga0495642_0014472 3300046528 Bacteria 3057
135 Ga0495652_0012599 3300046529 Bacteria 7622
136 Ga0495652_0020635 3300046529 Bacteria 5856
137 Ga0495652_0049152 3300046529 Bacteria 3611
138 Ga0495654_0008102 3300046530 Bacteria 5826
139 Ga0495654_0008573 3300046530 Bacteria 5636
140 Ga0495654_0010131 3300046530 Bacteria 5139
141 Ga0495654_0012601 3300046530 Bacteria 4539
142 Ga0495654_0036744 3300046530 Bacteria 2460
143 Ga0495654_0079474 3300046530 Bacteria 1540
144 Ga0495654_0150266 3300046530 Bacteria 1031
145 Ga0495609_0000367 3300046538 Bacteria 38923
146 Ga0495609_0000377 3300046538 Bacteria 38049
147 Ga0495609_0014528 3300046538 Bacteria 3699
148 Ga0495597_0000081 3300046542 Bacteria 84083
149 Ga0495597_0007586 3300046542 Bacteria 5496
150 Ga0495597_0038787 3300046542 Bacteria 2134
151 Ga0495597_0086982 3300046542 Bacteria 1330
152 Ga0495645_0036889 3300046543 Bacteria 3563
153 Ga0495645_0172098 3300046543 Bacteria 1490
154 Ga0495622_0007031 3300046557 Bacteria 5224
155 Ga0495622_0140984 3300046557 Bacteria 1094
156 Ga0495633_0000086 3300046558 Bacteria 124357
157 Ga0495633_0005060 3300046558 Bacteria 8212
158 Ga0495656_0150854 3300046615 Bacteria 1122
159 Ga0495668_0008763 3300046616 Bacteria 6275
160 Ga0495668_0109971 3300046616 Bacteria 1507
161 Ga0495611_0003379 3300046648 Bacteria 7042
162 Ga0495611_0048065 3300046648 Bacteria 1916
163 Ga0495625_0000010 3300046660 Bacteria 381775
164 Ga0495625_0000931 3300046660 Bacteria 39360
165 Ga0495625_0018475 3300046660 Bacteria 5442
166 Ga0495625_0370755 3300046660 Bacteria 900
167 Ga0495635_0050100 3300046663 Bacteria 2879
168 Ga0495659_0066861 3300046664 Bacteria 1339
169 Ga0495661_0000020 3300046665 Bacteria 196901
170 Ga0495661_0221385 3300046665 Bacteria 980
171 Ga0495599_0001500 3300046678 Bacteria 13428
172 Ga0495623_0039783 3300046679 Bacteria 3003
173 Ga0495670_0005286 3300046691 Bacteria 6352
174 Ga0495671_0027437 3300046692 Bacteria 2941
175 Ga0495671_0040124 3300046692 Bacteria 2361
176 Ga0495671_0061408 3300046692 Bacteria 1853
177 Ga0495671_0112019 3300046692 Bacteria 1332
178 Ga0495649_0001778 3300046694 Bacteria 15894
179 Ga0495649_0046108 3300046694 Bacteria 2374
180 Ga0495600_0003119 3300046809 Bacteria 9706
181 Ga0495660_0000965 3300046810 Bacteria 21003
182 Ga0495660_0001009 3300046810 Bacteria 20477
183 Ga0495660_0017886 3300046810 Bacteria 4077
184 Ga0495660_0169583 3300046810 Bacteria 1064
185 Ga0495604_0036583 3300047317 Bacteria 3870
186 Ga0495636_0004311 3300047318 Bacteria 5583
187 Ga0495636_0012002 3300047318 Bacteria 3433
188 Ga0495672_0009776 3300047320 Bacteria 6909
189 Ga0495672_0051359 3300047320 Bacteria 2429
190 Ga0495676_0000002 3300047321 Bacteria 373918
191 Ga0495683_0202779 3300047323 Bacteria 893
192 Ga0495687_002294 3300047443 Bacteria 15643
193 Ga0495679_014091 3300047446 Bacteria 2976
194 Ga0495673_0000008 3300047469 Bacteria 752462
195 Ga0495673_0000009 3300047469 Bacteria 731993
196 Ga0495673_0000012 3300047469 Bacteria 656908
197 Ga0495673_0002666 3300047469 Bacteria 12327
198 Ga0495673_0004334 3300047469 Bacteria 8925
199 Ga0495673_0006709 3300047469 Bacteria 6734
200 Ga0495673_0013703 3300047469 Bacteria 4245
201 Ga0495673_0062536 3300047469 Bacteria 1589
202 Ga0495681_0040743 3300047470 Bacteria 2259
203 Ga0495686_0050635 3300047472 Bacteria 2609
204 Ga0495602_0089333 3300048088 Bacteria 2562
205 Ga0495602_0342303 3300048088 Bacteria 1081
206 Ga0495615_0000220 3300048090 Bacteria 12788
207 Ga0495626_0000007 3300048091 Bacteria 276374
208 Ga0495626_0005643 3300048091 Bacteria 7248
209 Ga0495626_0107165 3300048091 Bacteria 1213
210 Ga0496102_0058565 3300048905 Bacteria 3520
211 Ga0496102_0521249 3300048905 Bacteria 1111
212 Ga0496110_0201737 3300048913 Bacteria 1807
213 Ga0496116_0026856 3300048919 Bacteria 4200
214 Ga0496116_0050818 3300048919 Bacteria 2759
215 Ga0496117_0080405 3300048920 Bacteria 2144
216 Ga0496117_0293171 3300048920 Bacteria 865
217 Ga0496119_0185719 3300048922 Bacteria 1087
218 Ga0496120_0114398 3300048923 Bacteria 1404
219 Ga0496121_0023825 3300048924 Bacteria 5876
220 Ga0496121_0133866 3300048924 Bacteria 1850
221 Ga0496122_0010195 3300048925 Bacteria 9737
222 Ga0496122_0030236 3300048925 Bacteria 4545
223 Ga0496122_0036180 3300048925 Bacteria 3999
224 Ga0496123_0000127 3300048926 Bacteria 154927
225 Ga0496123_0006961 3300048926 Bacteria 10800
226 Ga0496124_0002234 3300048927 Bacteria 25761
227 Ga0496124_0011321 3300048927 Bacteria 8924
228 Ga0496125_0000720 3300048928 Bacteria 54770
229 Ga0496126_0018447 3300048929 Bacteria 6913
230 Ga0495678_000012 3300049459 Bacteria 333905
231 Ga0495678_000302 3300049459 Bacteria 53782
232 Ga0495678_003637 3300049459 Bacteria 9371
233 Ga0495678_004550 3300049459 Bacteria 7977
234 Ga0495678_009962 3300049459 Bacteria 4653
235 Ga0495678_016334 3300049459 Bacteria 3396
236 Ga0495678_096044 3300049459 Bacteria 1035
237 Ga0495682_0000462 3300049460 Bacteria 28046
238 Ga0495682_0078902 3300049460 Bacteria 1184
239 Ga0501083_0092380 3300049744 Bacteria 1998
240 Ga0495601_0039901 3300053077 Bacteria 2940
241 Ga0500572_074551 3300053111 Bacteria 1054
242 Ga0500595_000896 3300053119 Bacteria 16961
243 Ga0500574_000193 3300053141 Bacteria 7168
244 Ga0500586_000282 3300053145 Bacteria 10232
245 Ga0500586_007893 3300053145 Bacteria 2868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0000746 Ga0495607_0000746_26467_27165 175
2 3300046557 Ga0495622_0140984 Ga0495622_0140984_531_1079 180
3 3300046518 Ga0495631_0011293 Ga0495631_0011293_3659_4354 190
4 3300046530 Ga0495654_0008573 Ga0495654_0008573_2857_3552 190
5 3300047320 Ga0495672_0051359 Ga0495672_0051359_907_1602 190
6 3300009011 Ga0105251_10000016 Ga0105251_1000001626 191
7 3300015265 Ga0182005_1040710 Ga0182005_10407101 191
8 3300025735 Ga0207713_1000060 Ga0207713_100006086 191
9 3300042016 Ga0439463_073834 Ga0439463_073834_56_739 191
10 3300046452 Ga0495617_112360 Ga0495617_112360_95_778 191
11 3300046458 Ga0495591_000323 Ga0495591_000323_38511_39194 191
12 3300046458 Ga0495591_014506 Ga0495591_014506_192_875 191
13 3300046471 Ga0495650_0000309 Ga0495650_0000309_3713_4396 191
14 3300046474 Ga0495605_0003589 Ga0495605_0003589_6891_7574 191
15 3300046491 Ga0495584_0013033 Ga0495584_0013033_3229_3912 191
16 3300046492 Ga0495585_0015566 Ga0495585_0015566_1186_1869 191
17 3300046500 Ga0495596_0001071 Ga0495596_0001071_5427_6110 191
18 3300046501 Ga0495607_0000792 Ga0495607_0000792_7894_8577 191
19 3300046501 Ga0495607_0047980 Ga0495607_0047980_861_1544 191
20 3300046501 Ga0495607_0219650 Ga0495607_0219650_135_818 191
21 3300046506 Ga0495583_0003770 Ga0495583_0003770_1639_2322 191
22 3300046507 Ga0495606_0000042 Ga0495606_0000042_50431_51114 191
23 3300046507 Ga0495606_0000098 Ga0495606_0000098_66079_66762 191
24 3300046512 Ga0495610_0018731 Ga0495610_0018731_2055_2738 191
25 3300046513 Ga0495616_0021828 Ga0495616_0021828_1577_2260 191
26 3300046515 Ga0495620_0000535 Ga0495620_0000535_20043_20726 191
27 3300046515 Ga0495620_0049069 Ga0495620_0049069_857_1540 191
28 3300046520 Ga0495637_0000023 Ga0495637_0000023_72996_73679 191
29 3300046520 Ga0495637_0001789 Ga0495637_0001789_3306_4001 191
30 3300046524 Ga0495648_0011606 Ga0495648_0011606_1510_2193 191
31 3300046524 Ga0495648_0109749 Ga0495648_0109749_360_1043 191
32 3300046524 Ga0495648_0122279 Ga0495648_0122279_301_984 191
33 3300046530 Ga0495654_0010131 Ga0495654_0010131_3713_4396 191
34 3300046530 Ga0495654_0012601 Ga0495654_0012601_157_840 191
35 3300046530 Ga0495654_0079474 Ga0495654_0079474_486_1169 191
36 3300046538 Ga0495609_0000367 Ga0495609_0000367_29318_30001 191
37 3300046542 Ga0495597_0086982 Ga0495597_0086982_528_1211 191
38 3300046557 Ga0495622_0007031 Ga0495622_0007031_2004_2687 191
39 3300046616 Ga0495668_0008763 Ga0495668_0008763_1234_1917 191
40 3300046616 Ga0495668_0109971 Ga0495668_0109971_168_851 191
41 3300046648 Ga0495611_0003379 Ga0495611_0003379_3976_4659 191
42 3300046660 Ga0495625_0000010 Ga0495625_0000010_203643_204326 191
43 3300046665 Ga0495661_0000020 Ga0495661_0000020_80905_81588 191
44 3300046665 Ga0495661_0221385 Ga0495661_0221385_178_873 191
45 3300046692 Ga0495671_0040124 Ga0495671_0040124_237_920 191
46 3300046692 Ga0495671_0112019 Ga0495671_0112019_481_1164 191
47 3300046694 Ga0495649_0046108 Ga0495649_0046108_344_1027 191
48 3300046810 Ga0495660_0017886 Ga0495660_0017886_209_904 191
49 3300047321 Ga0495676_0000002 Ga0495676_0000002_176611_177294 191
50 3300047446 Ga0495679_014091 Ga0495679_014091_670_1353 191
51 3300047469 Ga0495673_0006709 Ga0495673_0006709_80_763 191
52 3300047469 Ga0495673_0013703 Ga0495673_0013703_1948_2631 191
53 3300047469 Ga0495673_0062536 Ga0495673_0062536_334_1017 191
54 3300047470 Ga0495681_0040743 Ga0495681_0040743_1186_1869 191
55 3300047472 Ga0495686_0050635 Ga0495686_0050635_1898_2581 191
56 3300048091 Ga0495626_0000007 Ga0495626_0000007_179229_179912 191
57 3300048905 Ga0496102_0521249 Ga0496102_0521249_110_793 191
58 3300048920 Ga0496117_0080405 Ga0496117_0080405_222_905 191
59 3300048920 Ga0496117_0293171 Ga0496117_0293171_149_832 191
60 3300048924 Ga0496121_0023825 Ga0496121_0023825_1732_2415 191
61 3300048925 Ga0496122_0010195 Ga0496122_0010195_8986_9669 191
62 3300048926 Ga0496123_0000127 Ga0496123_0000127_145313_145996 191
63 3300048927 Ga0496124_0002234 Ga0496124_0002234_8483_9166 191
64 3300049459 Ga0495678_000302 Ga0495678_000302_3313_4008 191
65 3300049459 Ga0495678_003637 Ga0495678_003637_4880_5563 191
66 3300049460 Ga0495682_0000462 Ga0495682_0000462_7815_8498 191
67 3300046458 Ga0495591_006928 Ga0495591_006928_472_1155 192
68 3300046491 Ga0495584_0170326 Ga0495584_0170326_356_1039 192
69 3300046501 Ga0495607_0182920 Ga0495607_0182920_83_766 192
70 3300046810 Ga0495660_0169583 Ga0495660_0169583_21_713 194
71 3300025728 Ga0207655_1002363 Ga0207655_100236311 195
72 3300048913 Ga0496110_0201737 Ga0496110_0201737_104_787 195
73 3300048927 Ga0496124_0011321 Ga0496124_0011321_776_1459 195
74 iso_pu_bacteria 640427133 640487784 197
75 3300046524 Ga0495648_0288478 Ga0495648_0288478_25_636 199
76 3300046538 Ga0495609_0000377 Ga0495609_0000377_25203_25994 201
77 3300048919 Ga0496116_0050818 Ga0496116_0050818_989_1780 201
78 3300046458 Ga0495591_010949 Ga0495591_010949_693_1439 202
79 3300046501 Ga0495607_0082845 Ga0495607_0082845_824_1570 202
80 3300046506 Ga0495583_0003569 Ga0495583_0003569_3651_4397 202
81 3300046522 Ga0495643_0005572 Ga0495643_0005572_3637_4383 202
82 3300046524 Ga0495648_0004622 Ga0495648_0004622_3950_4696 202
83 3300046692 Ga0495671_0027437 Ga0495671_0027437_1313_2059 202
84 3300047469 Ga0495673_0002666 Ga0495673_0002666_4204_4950 202
85 3300049459 Ga0495678_009962 Ga0495678_009962_2164_2910 202
86 3300046810 Ga0495660_0001009 Ga0495660_0001009_19694_20377 204
87 3300046460 Ga0495638_0008678 Ga0495638_0008678_2384_3019 207
88 3300046462 Ga0495651_0057012 Ga0495651_0057012_2290_2988 210
89 3300046462 Ga0495651_0057221 Ga0495651_0057221_2284_2982 210
90 3300042147 Ga0450910_024015 Ga0450910_024015_269_919 212
91 3300046474 Ga0495605_0005263 Ga0495605_0005263_3285_3968 213
92 3300046507 Ga0495606_0019930 Ga0495606_0019930_433_1116 213
93 3300005331 Ga0070670_100018310 Ga0070670_1000183102 214
94 3300025925 Ga0207650_10000602 Ga0207650_100006029 214
95 3300046491 Ga0495584_0054026 Ga0495584_0054026_634_1317 214
96 3300046501 Ga0495607_0098463 Ga0495607_0098463_390_1073 214
97 3300046520 Ga0495637_0048744 Ga0495637_0048744_287_970 214
98 3300046691 Ga0495670_0005286 Ga0495670_0005286_3582_4265 214
99 3300046692 Ga0495671_0061408 Ga0495671_0061408_783_1466 214
100 3300047323 Ga0495683_0202779 Ga0495683_0202779_44_727 214
101 3300048091 Ga0495626_0107165 Ga0495626_0107165_223_906 214
102 3300049459 Ga0495678_016334 Ga0495678_016334_2090_2773 214
103 3300031824 Ga0307413_10542702 Ga0307413_105427022 216
104 iso_pu_bacteria 2511231016 2511324669 219
105 iso_pu_bacteria 2623620446 2624493310 219
106 iso_pu_bacteria 2826581358 2826583320 219
107 iso_pu_bacteria 2842815866 2842817356 219
108 iso_pu_bacteria 2842849001 2842850434 219
109 iso_pu_bacteria 2860867994 2860871760 219
110 iso_pu_bacteria 2919697872 2919699415 219
111 iso_pu_bacteria 8019775933 8019776314 219
112 iso_pu_bacteria 8056155041 8056156547 219
113 3300046810 Ga0495660_0000965 Ga0495660_0000965_15780_16565 220
114 3300013102 Ga0157371_10000546 Ga0157371_1000054636 221
115 3300049459 Ga0495678_000012 Ga0495678_000012_310857_311648 222
116 3300003781 Ga0055536_1000106 Ga0055536_100010611 223
117 3300005288 Ga0065714_10023199 Ga0065714_100231993 223
118 3300005288 Ga0065714_10067741 Ga0065714_100677412 223
119 3300005288 Ga0065714_10090154 Ga0065714_100901542 223
120 3300005290 Ga0065712_10067744 Ga0065712_1006774438 223
121 3300015265 Ga0182005_1036565 Ga0182005_10365652 223
122 3300046452 Ga0495617_000730 Ga0495617_000730_7828_8511 223
123 3300046457 Ga0495590_0002059 Ga0495590_0002059_7609_8292 223
124 3300046471 Ga0495650_0018116 Ga0495650_0018116_331_1014 223
125 3300046474 Ga0495605_0002498 Ga0495605_0002498_4023_4706 223
126 3300046491 Ga0495584_0001723 Ga0495584_0001723_5650_6333 223
127 3300046501 Ga0495607_0001116 Ga0495607_0001116_7272_7955 223
128 3300046513 Ga0495616_0004293 Ga0495616_0004293_727_1410 223
129 3300046519 Ga0495632_0005753 Ga0495632_0005753_1041_1724 223
130 3300046520 Ga0495637_0101871 Ga0495637_0101871_160_843 223
131 3300046524 Ga0495648_0143559 Ga0495648_0143559_156_839 223
132 3300046528 Ga0495642_0014472 Ga0495642_0014472_550_1233 223
133 3300046530 Ga0495654_0036744 Ga0495654_0036744_1145_1828 223
134 3300046542 Ga0495597_0007586 Ga0495597_0007586_4436_5119 223
135 3300046543 Ga0495645_0172098 Ga0495645_0172098_72_755 223
136 3300046648 Ga0495611_0048065 Ga0495611_0048065_867_1550 223
137 3300046660 Ga0495625_0370755 Ga0495625_0370755_52_735 223
138 3300046664 Ga0495659_0066861 Ga0495659_0066861_584_1267 223
139 3300046694 Ga0495649_0001778 Ga0495649_0001778_7765_8448 223
140 3300047318 Ga0495636_0012002 Ga0495636_0012002_986_1669 223
141 3300047320 Ga0495672_0009776 Ga0495672_0009776_3555_4238 223
142 3300047443 Ga0495687_002294 Ga0495687_002294_5731_6414 223
143 3300047469 Ga0495673_0004334 Ga0495673_0004334_878_1561 223
144 3300048091 Ga0495626_0005643 Ga0495626_0005643_5634_6317 223
145 3300049459 Ga0495678_004550 Ga0495678_004550_831_1514 223
146 3300049460 Ga0495682_0078902 Ga0495682_0078902_164_847 223
147 iso_pu_bacteria 8056148874 8056150346 223
148 3300005563 Ga0068855_100078328 Ga0068855_1000783281 225
149 3300005578 Ga0068854_100003412 Ga0068854_10000341210 225
150 3300009093 Ga0105240_10012212 Ga0105240_100122125 225
151 3300009545 Ga0105237_10009327 Ga0105237_100093279 225
152 3300009551 Ga0105238_10000547 Ga0105238_1000054737 225
153 3300010375 Ga0105239_10045286 Ga0105239_100452862 225
154 3300025913 Ga0207695_10000913 Ga0207695_1000091331 225
155 3300025914 Ga0207671_10135873 Ga0207671_101358732 225
156 3300025924 Ga0207694_10002807 Ga0207694_100028079 225
157 3300015261 Ga0182006_1000776 Ga0182006_100077617 226
158 3300048924 Ga0496121_0133866 Ga0496121_0133866_139_987 226
159 3300041491 Ga0451833_0699836 Ga0451833_0699836_1020_1745 227
160 3300041498 Ga0451841_1257103 Ga0451841_1257103_313_1038 227
161 3300041501 Ga0451845_0844382 Ga0451845_0844382_309_1034 227
162 3300041507 Ga0451851_0350842 Ga0451851_0350842_43_768 227
163 3300041512 Ga0451853_2790300 Ga0451853_2790300_744_1469 227
164 3300049744 Ga0501083_0092380 Ga0501083_0092380_329_1039 227
165 3300046512 Ga0495610_0017423 Ga0495610_0017423_3134_3865 228
166 3300053145 Ga0500586_000282 Ga0500586_000282_411_1142 228
167 3300031235 Ga0265330_10017849 Ga0265330_100178495 229
168 3300036647 Ga0316582_0066306 Ga0316582_0066306_702_1412 229
169 3300046558 Ga0495633_0005060 Ga0495633_0005060_3421_4152 229
170 iso_pu_bacteria 2728369097 2729148873 229
171 3300041505 Ga0451849_0863919 Ga0451849_0863919_1207_1935 230
172 3300046507 Ga0495606_0000830 Ga0495606_0000830_34304_35041 230
173 3300046543 Ga0495645_0036889 Ga0495645_0036889_2496_3275 230
174 iso_pu_bacteria 651053060 651175729 230
175 3300046460 Ga0495638_0017123 Ga0495638_0017123_3118_3906 233
176 3300046471 Ga0495650_0002329 Ga0495650_0002329_13075_13863 233
177 3300046660 Ga0495625_0000931 Ga0495625_0000931_31109_31897 233
178 3300047469 Ga0495673_0000012 Ga0495673_0000012_300342_301100 233
179 3300048922 Ga0496119_0185719 Ga0496119_0185719_260_1054 233
180 3300048923 Ga0496120_0114398 Ga0496120_0114398_133_927 233
181 3300048925 Ga0496122_0030236 Ga0496122_0030236_1182_1976 233
182 3300048926 Ga0496123_0006961 Ga0496123_0006961_7415_8209 233
183 3300048929 Ga0496126_0018447 Ga0496126_0018447_3193_3951 233
184 3300046529 Ga0495652_0020635 Ga0495652_0020635_3600_4391 234
185 3300046660 Ga0495625_0018475 Ga0495625_0018475_2954_3763 234
186 3300046679 Ga0495623_0039783 Ga0495623_0039783_1918_2709 234
187 3300048088 Ga0495602_0089333 Ga0495602_0089333_95_886 234
188 iso_pu_bacteria 2857558681 2857558874 234
189 3300046542 Ga0495597_0000081 Ga0495597_0000081_79870_80625 235
190 3300046663 Ga0495635_0050100 Ga0495635_0050100_157_981 235
191 iso_pu_bacteria 2923510766 2923512772 235
192 3300046525 Ga0495663_0000588 Ga0495663_0000588_8542_9294 236
193 3300046542 Ga0495597_0038787 Ga0495597_0038787_417_1169 236
194 3300046615 Ga0495656_0150854 Ga0495656_0150854_69_821 236
195 3300048090 Ga0495615_0000220 Ga0495615_0000220_8971_9723 236
196 3300048919 Ga0496116_0026856 Ga0496116_0026856_192_1022 236
197 3300049459 Ga0495678_096044 Ga0495678_096044_144_935 236
198 3300003771 Ga0055526_1000007 Ga0055526_1000007216 237
199 3300025295 Ga0209564_1000010 Ga0209564_1000010459 237
200 3300046460 Ga0495638_0143454 Ga0495638_0143454_30_830 237
201 3300046471 Ga0495650_0000462 Ga0495650_0000462_7996_8796 237
202 3300046506 Ga0495583_0000008 Ga0495583_0000008_342337_343089 237
203 3300046507 Ga0495606_0000716 Ga0495606_0000716_3477_4301 237
204 3300046514 Ga0495618_0087273 Ga0495618_0087273_878_1702 237
205 3300046524 Ga0495648_0014385 Ga0495648_0014385_1276_2076 237
206 3300046530 Ga0495654_0008102 Ga0495654_0008102_3262_4062 237
207 3300046538 Ga0495609_0014528 Ga0495609_0014528_2890_3645 237
208 3300046558 Ga0495633_0000086 Ga0495633_0000086_13596_14351 237
209 3300047469 Ga0495673_0000008 Ga0495673_0000008_474399_475172 237
210 3300046506 Ga0495583_0003448 Ga0495583_0003448_3140_3898 239
211 3300047318 Ga0495636_0004311 Ga0495636_0004311_2399_3157 239
212 3300047469 Ga0495673_0000009 Ga0495673_0000009_420091_420891 239
213 3300048905 Ga0496102_0058565 Ga0496102_0058565_2647_3405 239
214 3300048925 Ga0496122_0036180 Ga0496122_0036180_2913_3713 239
215 3300053145 Ga0500586_007893 Ga0500586_007893_1537_2337 239
216 3300021361 Ga0213872_10005182 Ga0213872_100051824 240
217 3300039447 Ga0436361_0124286 Ga0436361_0124286_2320_3177 240
218 3300046523 Ga0495644_0001185 Ga0495644_0001185_2945_3736 240
219 3300003751 Ga0055538_1000030 Ga0055538_1000030159 241
220 3300003752 Ga0055539_1000040 Ga0055539_1000040159 241
221 3300003756 Ga0055533_1000050 Ga0055533_1000050159 241
222 3300003759 Ga0055525_1000060 Ga0055525_1000060159 241
223 3300003841 Ga0055541_1000027 Ga0055541_1000027159 241
224 3300005563 Ga0068855_100000243 Ga0068855_10000024350 241
225 3300015261 Ga0182006_1005273 Ga0182006_10052731 241
226 3300025224 Ga0209784_100005 Ga0209784_100005767 241
227 3300025225 Ga0209566_100005 Ga0209566_100005767 241
228 3300025226 Ga0209674_100009 Ga0209674_100009767 241
229 3300025230 Ga0209563_100012 Ga0209563_100012767 241
230 3300025253 Ga0209677_100006 Ga0209677_100006767 241
231 3300025949 Ga0207667_10000301 Ga0207667_1000030149 241
232 3300046453 Ga0495627_000004 Ga0495627_000004_270840_271625 241
233 3300046530 Ga0495654_0150266 Ga0495654_0150266_219_1013 241
234 3300025914 Ga0207671_10073384 Ga0207671_100733841 242
235 iso_pu_bacteria 2842711865 2842715722 243
236 3300014497 Ga0182008_10011751 Ga0182008_100117515 244
237 3300015265 Ga0182005_1001090 Ga0182005_10010907 244
238 3300036712 Ga0316584_0024229 Ga0316584_0024229_1195_1950 244
239 3300046463 Ga0495653_0011049 Ga0495653_0011049_2985_3809 244
240 3300046529 Ga0495652_0049152 Ga0495652_0049152_2095_2919 244
241 3300047317 Ga0495604_0036583 Ga0495604_0036583_1306_2130 244
242 3300053119 Ga0500595_000896 Ga0500595_000896_14355_15179 244
243 3300053141 Ga0500574_000193 Ga0500574_000193_2804_3628 244
244 iso_pu_bacteria 2738541297 2738826319 244
245 iso_pu_bacteria 2857553236 2857558458 245
246 3300015262 Ga0182007_10002459 Ga0182007_100024599 246
247 iso_pu_bacteria 2521172590 2521559101 246
248 iso_pu_bacteria 2551306416 2553003913 246
249 iso_pu_bacteria 2818991449 2819615611 246
250 iso_pu_bacteria 2904439833 2904444836 246
251 iso_pu_bacteria 2904530477 2904532348 246
252 iso_pu_bacteria 2904584206 2904584790 246
253 iso_pu_bacteria 2904589729 2904591312 246
254 iso_pu_bacteria 2904601388 2904605145 246
255 iso_pu_bacteria 2919079590 2919081161 246
256 iso_pu_bacteria 2928130867 2928132773 246
257 iso_pu_bacteria 2765235838 2765570304 247
258 iso_pu_bacteria 2839094727 2839096752 247
259 3300046454 Ga0495592_0169540 Ga0495592_0169540_578_1360 248
260 3300046462 Ga0495651_0142958 Ga0495651_0142958_123_905 248
261 3300046516 Ga0495628_0055869 Ga0495628_0055869_757_1539 248
262 3300046529 Ga0495652_0012599 Ga0495652_0012599_4870_5652 248
263 3300048088 Ga0495602_0342303 Ga0495602_0342303_279_1061 248
264 iso_pu_bacteria 2919046199 2919048313 248
265 iso_pu_bacteria 2857564685 2857569741 249
266 3300025250 Ga0209026_1002712 Ga0209026_10027122 250
267 iso_pu_bacteria 2818991436 2819541445 250
268 3300046454 Ga0495592_0012116 Ga0495592_0012116_4336_5160 253
269 3300046516 Ga0495628_0006788 Ga0495628_0006788_3556_4380 253
270 3300046678 Ga0495599_0001500 Ga0495599_0001500_3268_4092 253
271 3300046809 Ga0495600_0003119 Ga0495600_0003119_921_1745 253
272 3300053077 Ga0495601_0039901 Ga0495601_0039901_1634_2458 253
273 3300053111 Ga0500572_074551 Ga0500572_074551_14_838 253
274 3300005614 Ga0068856_100050845 Ga0068856_1000508452 254
275 3300009011 Ga0105251_10018623 Ga0105251_100186234 254
276 3300026078 Ga0207702_10036879 Ga0207702_100368793 254
277 3300048928 Ga0496125_0000720 Ga0496125_0000720_24571_25362 254
278 iso_pu_bacteria 2548876994 2550692780 263
279 iso_pu_bacteria 2884811622 2884815862 263
280 3300002737 JGI25162J39368_1005488 JGI25162J39368_10054882 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13386

DsbD_2

Cytochrome C biogenesis protein transmembrane region

54

253

0.91

PF13386

DsbD_2

Cytochrome C biogenesis protein transmembrane region

1

49

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ahx-assembly1.cif.gz_A cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.4454 63 239
8ahx-assembly1.cif.gz_A cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.3723 63 239
8acy-assembly1.cif.gz_D x-ray structure of na+-nqr from vibrio cholerae at 3.5 a resolution 0.3363 53 245
8acy-assembly1.cif.gz_D x-ray structure of na+-nqr from vibrio cholerae at 3.5 a resolution 0.3181 53 245
7zc6-assembly1.cif.gz_E na+ - translocating ferredoxin: nad+ reductase (rnf) of c. tetanomorphum 0.3102 53 244
ID Description Score Start End Superfamily
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4406 10 241 1.10.1760.20
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4294 10 241 1.10.1760.20
af_P77179_4_200_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4287 13 206 1.10.1760.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3913 12 236 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3864 14 245 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1G0KNY6-F1-model_v4 Urease accessory protein UreH-like transmembrane domain-containing protein 0.8339 9 253 GO:0016020
AF-A0A3D9KQ50-F1-model_v4 deleted 0.8306 9 256
AF-A0A6I1JNT6-F1-model_v4 coproporphyrinogen dehydrogenase (EC 1.3.98.3) 0.8298 6 238 GO:0004109
GO:0005737
GO:0006782
GO:0016020
GO:0046872
GO:0051539
GO:0051989
AF-A0A3B0WLY6-F1-model_v4 Heavy-metal-associated domain (N-terminus) and membrane-bounded cytochrome biogenesis cycZ-like domain, possible membrane copper tolerance protein 0.8236 6 240 GO:0016020
AF-A0A4R3Y8I0-F1-model_v4 Urease accessory protein UreH-like transmembrane domain-containing protein 0.8216 6 242 GO:0016020

Feature Viewer

pLDDT pTM Quality
66.91 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map