F383971

General Info

Members Datasets Scaffolds Average Seq Length
280 186 560 343

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0175169|Ga0530510_0175169_427_1563
Length 378
Sequence VQLPPLDVDEEQALAGGVPARALRQGALGREQEVYAHAQIMTRALVTEPGIAGSTRVEEVAAGDGDVLLRPIEVGICGTDREIAHGLFGEAPAAGAPLVLGHEVLAVVARDGGGFAAGDLVTSTVRRSCGHCLACGEGAPDSCLTGDYAERGITRLNGFARDLLGEDGDQLIPVPRSLDRLGVLAEPTSICERALRHARAIGGRQPWQLQRALVLGAGAIGTITTLLLRLQGIETWVASLEPEAPLVEAAGAQYAHVDDLGELGAFDLVVECAGNAQLMADALGLLRRSGVACLIGIDGRNQPVTLDGRVLGLDTVVEGRVLFGSVNAHRQDWLAAVEDLAQLDPELLRGLVGLRVPLEQFEDAFAFRGGKATLVIDA

Samples

Sample ID Description Type Environment
1 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 1.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.93
Rhizosphere 85.36
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0530510_0175169 3300061734 Bacteria 1590
2 Ga0070658_10107045 3300005327 Bacteria 2314
3 Ga0070658_10280420 3300005327 Bacteria 1418
4 Ga0070683_100123264 3300005329 Bacteria 2449
5 Ga0070683_100150745 3300005329 Bacteria 2204
6 Ga0070683_100364590 3300005329 Bacteria 1376
7 Ga0070680_100076756 3300005336 Bacteria 2751
8 Ga0070680_100238796 3300005336 Unclassified 1536
9 Ga0070682_100043085 3300005337 Bacteria 2789
10 Ga0070682_100275504 3300005337 Bacteria 1224
11 Ga0068868_100339081 3300005338 Bacteria 1285
12 Ga0070660_100063906 3300005339 Bacteria 2862
13 Ga0070660_100163262 3300005339 Unclassified 1796
14 Ga0070661_100102496 3300005344 Bacteria 2130
15 Ga0070692_10023939 3300005345 Bacteria 2997
16 Ga0070668_100313086 3300005347 Unclassified 1319
17 Ga0070671_100324931 3300005355 Bacteria 1311
18 Ga0070688_100006501 3300005365 Bacteria 6250
19 Ga0070659_100068364 3300005366 Bacteria 2818
20 Ga0070709_10031452 3300005434 Bacteria 3192
21 Ga0070714_100150809 3300005435 Bacteria 2095
22 Ga0070714_100453071 3300005435 Bacteria 1219
23 Ga0070713_100215090 3300005436 Bacteria 1742
24 Ga0070710_10007672 3300005437 Bacteria 5232
25 Ga0070701_10002335 3300005438 Bacteria 7280
26 Ga0070711_100010408 3300005439 Bacteria 5755
27 Ga0070705_100013339 3300005440 Unclassified 4199
28 Ga0070694_100039119 3300005444 Bacteria 3155
29 Ga0070694_100288572 3300005444 Bacteria 1253
30 Ga0070708_100210470 3300005445 Bacteria 1822
31 Ga0070678_100209157 3300005456 Bacteria 1615
32 Ga0070681_10023962 3300005458 Bacteria 6146
33 Ga0070681_10251229 3300005458 Bacteria 1681
34 Ga0070681_10455528 3300005458 Bacteria 1192
35 Ga0068867_100031617 3300005459 Bacteria 3823
36 Ga0070685_10010032 3300005466 Bacteria 4912
37 Ga0070706_100092996 3300005467 Bacteria 2797
38 Ga0070707_100003623 3300005468 Bacteria 14570
39 Ga0070698_100142832 3300005471 Bacteria 2344
40 Ga0070698_100160402 3300005471 Unclassified 2193
41 Ga0070698_100207856 3300005471 Bacteria 1893
42 Ga0070699_100380150 3300005518 Bacteria 1275
43 Ga0070679_100059525 3300005530 Bacteria 3807
44 Ga0070679_100064801 3300005530 Bacteria 3642
45 Ga0070684_100167523 3300005535 Bacteria 1995
46 Ga0070672_100033191 3300005543 Bacteria 3906
47 Ga0070686_100017298 3300005544 Bacteria 4211
48 Ga0070696_100022273 3300005546 Bacteria 4303
49 Ga0070665_100181306 3300005548 Bacteria 2107
50 Ga0070665_100392146 3300005548 Bacteria 1396
51 Ga0068855_100031477 3300005563 Bacteria 6335
52 Ga0068856_100064211 3300005614 Bacteria 3628
53 Ga0068856_100255668 3300005614 Unclassified 1767
54 Ga0070702_100004827 3300005615 Bacteria 6198
55 Ga0068866_10004277 3300005718 Bacteria 5865
56 Ga0068861_100016820 3300005719 Bacteria 5183
57 Ga0081539_10009228 3300005985 Bacteria 8305
58 Ga0070717_10119295 3300006028 Bacteria 2258
59 Ga0097621_100014721 3300006237 Bacteria 5862
60 Ga0068871_100019217 3300006358 Bacteria 5215
61 Ga0075434_100080338 3300006871 Bacteria 3257
62 Ga0105245_10043003 3300009098 Bacteria 4030
63 Ga0105245_10195485 3300009098 Bacteria 1940
64 Ga0114129_10055860 3300009147 Bacteria 5533
65 Ga0105242_10046124 3300009176 Bacteria 3535
66 Ga0105242_10116378 3300009176 Bacteria 2287
67 Ga0105248_10328019 3300009177 Unclassified 1724
68 Ga0105238_10033659 3300009551 Bacteria 5214
69 Ga0105249_10013400 3300009553 Bacteria 7241
70 Ga0105239_10055941 3300010375 Bacteria 4328
71 Ga0105246_10168127 3300011119 Unclassified 1677
72 Ga0157370_10142584 3300013104 Bacteria 2232
73 Ga0157369_10518841 3300013105 Bacteria 1232
74 Ga0157378_10162279 3300013297 Unclassified 2091
75 Ga0157378_10638184 3300013297 Bacteria 1079
76 Ga0163162_10052635 3300013306 Bacteria 4089
77 Ga0157375_10247030 3300013308 Unclassified 1945
78 Ga0182008_10000959 3300014497 Bacteria 20051
79 Ga0157377_10009581 3300014745 Bacteria 4761
80 Ga0182006_1023032 3300015261 Bacteria 2581
81 Ga0182007_10009178 3300015262 Bacteria 4015
82 Ga0206354_10635010 3300020081 Bacteria 6867
83 Ga0206353_10457903 3300020082 Bacteria 2547
84 Ga0206353_11439115 3300020082 Bacteria 2923
85 Ga0207692_10021914 3300025898 Bacteria 2931
86 Ga0207692_10106611 3300025898 Bacteria 1547
87 Ga0207642_10001815 3300025899 Bacteria 6602
88 Ga0207688_10187745 3300025901 Unclassified 1235
89 Ga0207647_10102536 3300025904 Bacteria 1697
90 Ga0207705_10198621 3300025909 Bacteria 1519
91 Ga0207707_10167371 3300025912 Bacteria 1921
92 Ga0207695_10269383 3300025913 Bacteria 1599
93 Ga0207693_10000312 3300025915 Bacteria 45237
94 Ga0207693_10139720 3300025915 Unclassified 1905
95 Ga0207663_10030749 3300025916 Bacteria 3170
96 Ga0207663_10182899 3300025916 Bacteria 1498
97 Ga0207660_10249943 3300025917 Unclassified 1399
98 Ga0207657_10006376 3300025919 Bacteria 12251
99 Ga0207657_10007240 3300025919 Bacteria 11398
100 Ga0207681_10285569 3300025923 Unclassified 1301
101 Ga0207659_10046228 3300025926 Bacteria 3073
102 Ga0207687_10033732 3300025927 Bacteria 3473
103 Ga0207700_10147446 3300025928 Bacteria 1941
104 Ga0207664_10004062 3300025929 Bacteria 9859
105 Ga0207664_10077090 3300025929 Bacteria 2700
106 Ga0207664_10119438 3300025929 Bacteria 2204
107 Ga0207664_10313703 3300025929 Unclassified 1382
108 Ga0207664_10404933 3300025929 Bacteria 1214
109 Ga0207644_10074698 3300025931 Bacteria 2489
110 Ga0207644_10140923 3300025931 Bacteria 1857
111 Ga0207686_10032240 3300025934 Bacteria 3117
112 Ga0207709_10056593 3300025935 Bacteria 2428
113 Ga0207669_10101388 3300025937 Bacteria 1904
114 Ga0207704_10061175 3300025938 Unclassified 2334
115 Ga0207691_10029387 3300025940 Bacteria 5142
116 Ga0207711_10096448 3300025941 Bacteria 2610
117 Ga0207661_10400012 3300025944 Bacteria 1245
118 Ga0207667_10054159 3300025949 Bacteria 4219
119 Ga0207712_10012430 3300025961 Bacteria 5439
120 Ga0207668_10286655 3300025972 Bacteria 1353
121 Ga0207677_10277054 3300026023 Bacteria 1375
122 Ga0207678_10105267 3300026067 Bacteria 2407
123 Ga0207708_10002435 3300026075 Bacteria 13674
124 Ga0207702_10080453 3300026078 Bacteria 2827
125 Ga0207702_10199317 3300026078 Unclassified 1854
126 Ga0207648_10001053 3300026089 Bacteria 30916
127 Ga0207675_100025243 3300026118 Bacteria 5531
128 Ga0207683_10002928 3300026121 Bacteria 14878
129 Ga0207698_10402484 3300026142 Unclassified 1308
130 Ga0268266_10042559 3300028379 Bacteria 3880
131 Ga0268264_10049172 3300028381 Bacteria 3507
132 Ga0307416_100154845 3300032002 Bacteria 2108
133 Ga0373945_0018902 3300035116 Bacteria 2348
134 Ga0373943_0000926 3300035170 Bacteria 12923
135 Ga0373946_0006776 3300035171 Bacteria 4164
136 Ga0373947_0000964 3300035725 Bacteria 17550
137 Ga0373925_0008025 3300037068 Bacteria 7689
138 Ga0395899_0058154 3300037312 Bacteria 2852
139 Ga0395900_0000672 3300037418 Bacteria 45487
140 Ga0395900_0048522 3300037418 Bacteria 4374
141 Ga0395900_0067152 3300037418 Bacteria 3684
142 Ga0395900_0235669 3300037418 Bacteria 1838
143 Ga0395900_0251815 3300037418 Bacteria 1767
144 Ga0395898_0017657 3300037466 Bacteria 7284
145 Ga0395898_0027597 3300037466 Bacteria 5695
146 Ga0395898_0081088 3300037466 Bacteria 3129
147 Ga0395905_0015952 3300037471 Bacteria 7139
148 Ga0395905_0091266 3300037471 Bacteria 2856
149 Ga0395905_0201433 3300037471 Bacteria 1866
150 Ga0395901_0009214 3300038443 Bacteria 10001
151 Ga0395901_0011712 3300038443 Bacteria 8889
152 Ga0395901_0503732 3300038443 Bacteria 1232
153 Ga0436365_0958503 3300039437 Bacteria 2432
154 Ga0436365_1125480 3300039437 Bacteria 2887
155 Ga0466966_0032715 3300044684 Bacteria 3368
156 Ga0466961_0045431 3300044693 Bacteria 2810
157 Ga0466961_0096599 3300044693 Bacteria 1863
158 Ga0466961_0160152 3300044693 Bacteria 1403
159 Ga0466963_0011729 3300044694 Bacteria 5343
160 Ga0466963_0050035 3300044694 Bacteria 2765
161 Ga0466964_0011612 3300044706 Bacteria 3330
162 Ga0466957_0006434 3300044842 Bacteria 6633
163 Ga0466957_0030369 3300044842 Bacteria 3226
164 Ga0466957_0159518 3300044842 Bacteria 1464
165 Ga0466959_0043660 3300045049 Bacteria 3304
166 Ga0466958_0091078 3300045836 Bacteria 1887
167 Ga0466958_0193664 3300045836 Bacteria 1292
168 Ga0466967_0003267 3300045976 Bacteria 10504
169 Ga0466967_0003522 3300045976 Bacteria 10237
170 Ga0466967_0003563 3300045976 Bacteria 10205
171 Ga0466967_0006237 3300045976 Bacteria 8407
172 Ga0466967_0042554 3300045976 Bacteria 3926
173 Ga0466967_0052270 3300045976 Bacteria 3585
174 Ga0466967_0179613 3300045976 Bacteria 1996
175 Ga0466967_0309378 3300045976 Bacteria 1522
176 Ga0466967_0408591 3300045976 Bacteria 1322
177 Ga0495603_0005672 3300046455 Bacteria 7459
178 Ga0495629_0000547 3300046459 Bacteria 30968
179 Ga0495641_0001092 3300046461 Bacteria 23346
180 Ga0495651_0035154 3300046462 Bacteria 3903
181 Ga0495653_0006922 3300046463 Bacteria 9316
182 Ga0495582_0008645 3300046473 Bacteria 5615
183 Ga0495605_0051271 3300046474 Bacteria 2010
184 Ga0495605_0076555 3300046474 Unclassified 1571
185 Ga0495639_0005662 3300046475 Bacteria 5375
186 Ga0495662_0001066 3300046476 Bacteria 13475
187 Ga0495585_0167267 3300046492 Bacteria 1138
188 Ga0495616_0058094 3300046513 Bacteria 1906
189 Ga0495630_0261695 3300046517 Bacteria 1321
190 Ga0495642_0013316 3300046528 Bacteria 3180
191 Ga0495642_0098723 3300046528 Bacteria 1241
192 Ga0495652_0052587 3300046529 Bacteria 3473
193 Ga0495665_0002230 3300046531 Bacteria 10490
194 Ga0495640_0209145 3300046533 Bacteria 1234
195 Ga0495640_0226421 3300046533 Bacteria 1177
196 Ga0495586_0056158 3300046535 Bacteria 2135
197 Ga0495587_0026566 3300046536 Bacteria 3530
198 Ga0495587_0081906 3300046536 Bacteria 1870
199 Ga0495645_0115776 3300046543 Bacteria 1893
200 Ga0495667_0027445 3300046559 Bacteria 3836
201 Ga0495667_0037622 3300046559 Bacteria 3224
202 Ga0495635_0035795 3300046663 Bacteria 3442
203 Ga0495647_0020050 3300046681 Bacteria 2397
204 Ga0495658_0006501 3300046683 Bacteria 5742
205 Ga0495658_0156489 3300046683 Bacteria 1403
206 Ga0495613_0007338 3300046689 Bacteria 8211
207 Ga0495624_0004077 3300046690 Bacteria 10744
208 Ga0495589_0064491 3300046794 Bacteria 1796
209 Ga0495600_0209629 3300046809 Bacteria 1249
210 Ga0495581_0001128 3300047315 Bacteria 14618
211 Ga0495581_0016915 3300047315 Bacteria 4238
212 Ga0495604_0018135 3300047317 Bacteria 5634
213 Ga0495674_0031597 3300047319 Bacteria 4809
214 Ga0495674_0094624 3300047319 Bacteria 2548
215 Ga0495674_0537195 3300047319 Unclassified 932
216 Ga0495676_0002201 3300047321 Bacteria 17271
217 Ga0495676_0022347 3300047321 Bacteria 5504
218 Ga0495680_0008704 3300047322 Bacteria 9201
219 Ga0495680_0011638 3300047322 Bacteria 7774
220 Ga0495675_0016952 3300047444 Bacteria 4610
221 Ga0495677_0033476 3300047445 Bacteria 1873
222 Ga0495684_0003390 3300047471 Bacteria 12505
223 Ga0495684_0139653 3300047471 Bacteria 1817
224 Ga0495593_0002220 3300047673 Bacteria 11642
225 Ga0495614_0001086 3300048089 Bacteria 11639
226 Ga0496100_0005559 3300048903 Bacteria 6802
227 Ga0496100_0007193 3300048903 Bacteria 6119
228 Ga0496100_0013465 3300048903 Bacteria 4718
229 Ga0496101_0002659 3300048904 Bacteria 10971
230 Ga0496101_0014792 3300048904 Bacteria 5248
231 Ga0496101_0073635 3300048904 Unclassified 2509
232 Ga0496102_0012383 3300048905 Bacteria 7380
233 Ga0496102_0141059 3300048905 Bacteria 2260
234 Ga0496102_0271332 3300048905 Bacteria 1599
235 Ga0496103_0007477 3300048906 Bacteria 6510
236 Ga0496103_0041945 3300048906 Bacteria 2814
237 Ga0496103_0068720 3300048906 Bacteria 2214
238 Ga0496103_0097522 3300048906 Bacteria 1858
239 Ga0496104_0036273 3300048907 Bacteria 4609
240 Ga0496104_0363447 3300048907 Bacteria 1360
241 Ga0496104_0428737 3300048907 Bacteria 1234
242 Ga0496105_0022310 3300048908 Bacteria 5127
243 Ga0496105_0030982 3300048908 Bacteria 4385
244 Ga0496105_0212070 3300048908 Bacteria 1578
245 Ga0496106_0014025 3300048909 Bacteria 5924
246 Ga0496106_0056745 3300048909 Bacteria 2960
247 Ga0496107_0001090 3300048910 Bacteria 16317
248 Ga0496107_0014755 3300048910 Bacteria 5471
249 Ga0496107_0016165 3300048910 Bacteria 5236
250 Ga0496107_0086317 3300048910 Bacteria 2290
251 Ga0496109_0036621 3300048912 Unclassified 4429
252 Ga0496110_0233293 3300048913 Bacteria 1674
253 Ga0496110_0262516 3300048913 Bacteria 1572
254 Ga0496111_0131826 3300048914 Archaea 1850
255 Ga0496112_0048338 3300048915 Bacteria 4171
256 Ga0496112_0069694 3300048915 Bacteria 3473
257 Ga0496112_0098921 3300048915 Bacteria 2886
258 Ga0496112_0266326 3300048915 Unclassified 1662
259 Ga0496113_0170927 3300048916 Bacteria 1721
260 Ga0496113_0181904 3300048916 Bacteria 1667
261 Ga0496114_0065068 3300048917 Bacteria 3054
262 Ga0496114_0067534 3300048917 Bacteria 2999
263 Ga0496114_0123932 3300048917 Bacteria 2225
264 Ga0496115_0001106 3300048918 Bacteria 19452
265 Ga0501067_0024304 3300049583 Bacteria 3361
266 Ga0501067_0038923 3300049583 Bacteria 2640
267 Ga0501067_0062538 3300049583 Bacteria 2060
268 Ga0501069_0022671 3300049585 Bacteria 3419
269 Ga0501070_0069767 3300049586 Bacteria 2910
270 Ga0501072_0002984 3300049588 Bacteria 12752
271 Ga0501073_0093239 3300049589 Bacteria 2092
272 Ga0501083_0086726 3300049744 Bacteria 2070
273 nmdc:mga0n895_44562_c1 3300050512 Bacteria 4326
274 nmdc:mga0rr50_101050_c1 3300050513 Bacteria 2266
275 Ga0495601_0039793 3300053077 Bacteria 2944
276 Ga0495619_0002699 3300053085 Bacteria 11604
277 Ga0495619_0004000 3300053085 Bacteria 9451
278 Ga0501084_0266574 3300054114 Bacteria 1446
279 Ga0466962_0045200 3300061719 Bacteria 2105
280 Ga0530510_0006566 3300061734 Bacteria 8106
281 Ga0530510_0175169
282 Ga0070658_10107045
283 Ga0070658_10280420
284 Ga0070683_100123264
285 Ga0070683_100150745
286 Ga0070683_100364590
287 Ga0070680_100076756
288 Ga0070680_100238796
289 Ga0070682_100043085
290 Ga0070682_100275504
291 Ga0068868_100339081
292 Ga0070660_100063906
293 Ga0070660_100163262
294 Ga0070661_100102496
295 Ga0070692_10023939
296 Ga0070668_100313086
297 Ga0070671_100324931
298 Ga0070688_100006501
299 Ga0070659_100068364
300 Ga0070709_10031452
301 Ga0070714_100150809
302 Ga0070714_100453071
303 Ga0070713_100215090
304 Ga0070710_10007672
305 Ga0070701_10002335
306 Ga0070711_100010408
307 Ga0070705_100013339
308 Ga0070694_100039119
309 Ga0070694_100288572
310 Ga0070708_100210470
311 Ga0070678_100209157
312 Ga0070681_10023962
313 Ga0070681_10251229
314 Ga0070681_10455528
315 Ga0068867_100031617
316 Ga0070685_10010032
317 Ga0070706_100092996
318 Ga0070707_100003623
319 Ga0070698_100142832
320 Ga0070698_100160402
321 Ga0070698_100207856
322 Ga0070699_100380150
323 Ga0070679_100059525
324 Ga0070679_100064801
325 Ga0070684_100167523
326 Ga0070672_100033191
327 Ga0070686_100017298
328 Ga0070696_100022273
329 Ga0070665_100181306
330 Ga0070665_100392146
331 Ga0068855_100031477
332 Ga0068856_100064211
333 Ga0068856_100255668
334 Ga0070702_100004827
335 Ga0068866_10004277
336 Ga0068861_100016820
337 Ga0081539_10009228
338 Ga0070717_10119295
339 Ga0097621_100014721
340 Ga0068871_100019217
341 Ga0075434_100080338
342 Ga0105245_10043003
343 Ga0105245_10195485
344 Ga0114129_10055860
345 Ga0105242_10046124
346 Ga0105242_10116378
347 Ga0105248_10328019
348 Ga0105238_10033659
349 Ga0105249_10013400
350 Ga0105239_10055941
351 Ga0105246_10168127
352 Ga0157370_10142584
353 Ga0157369_10518841
354 Ga0157378_10162279
355 Ga0157378_10638184
356 Ga0163162_10052635
357 Ga0157375_10247030
358 Ga0182008_10000959
359 Ga0157377_10009581
360 Ga0182006_1023032
361 Ga0182007_10009178
362 Ga0206354_10635010
363 Ga0206353_10457903
364 Ga0206353_11439115
365 Ga0207692_10021914
366 Ga0207692_10106611
367 Ga0207642_10001815
368 Ga0207688_10187745
369 Ga0207647_10102536
370 Ga0207705_10198621
371 Ga0207707_10167371
372 Ga0207695_10269383
373 Ga0207693_10000312
374 Ga0207693_10139720
375 Ga0207663_10030749
376 Ga0207663_10182899
377 Ga0207660_10249943
378 Ga0207657_10006376
379 Ga0207657_10007240
380 Ga0207681_10285569
381 Ga0207659_10046228
382 Ga0207687_10033732
383 Ga0207700_10147446
384 Ga0207664_10004062
385 Ga0207664_10077090
386 Ga0207664_10119438
387 Ga0207664_10313703
388 Ga0207664_10404933
389 Ga0207644_10074698
390 Ga0207644_10140923
391 Ga0207686_10032240
392 Ga0207709_10056593
393 Ga0207669_10101388
394 Ga0207704_10061175
395 Ga0207691_10029387
396 Ga0207711_10096448
397 Ga0207661_10400012
398 Ga0207667_10054159
399 Ga0207712_10012430
400 Ga0207668_10286655
401 Ga0207677_10277054
402 Ga0207678_10105267
403 Ga0207708_10002435
404 Ga0207702_10080453
405 Ga0207702_10199317
406 Ga0207648_10001053
407 Ga0207675_100025243
408 Ga0207683_10002928
409 Ga0207698_10402484
410 Ga0268266_10042559
411 Ga0268264_10049172
412 Ga0307416_100154845
413 Ga0373945_0018902
414 Ga0373943_0000926
415 Ga0373946_0006776
416 Ga0373947_0000964
417 Ga0373925_0008025
418 Ga0395899_0058154
419 Ga0395900_0000672
420 Ga0395900_0048522
421 Ga0395900_0067152
422 Ga0395900_0235669
423 Ga0395900_0251815
424 Ga0395898_0017657
425 Ga0395898_0027597
426 Ga0395898_0081088
427 Ga0395905_0015952
428 Ga0395905_0091266
429 Ga0395905_0201433
430 Ga0395901_0009214
431 Ga0395901_0011712
432 Ga0395901_0503732
433 Ga0436365_0958503
434 Ga0436365_1125480
435 Ga0466966_0032715
436 Ga0466961_0045431
437 Ga0466961_0096599
438 Ga0466961_0160152
439 Ga0466963_0011729
440 Ga0466963_0050035
441 Ga0466964_0011612
442 Ga0466957_0006434
443 Ga0466957_0030369
444 Ga0466957_0159518
445 Ga0466959_0043660
446 Ga0466958_0091078
447 Ga0466958_0193664
448 Ga0466967_0003267
449 Ga0466967_0003522
450 Ga0466967_0003563
451 Ga0466967_0006237
452 Ga0466967_0042554
453 Ga0466967_0052270
454 Ga0466967_0179613
455 Ga0466967_0309378
456 Ga0466967_0408591
457 Ga0495603_0005672
458 Ga0495629_0000547
459 Ga0495641_0001092
460 Ga0495651_0035154
461 Ga0495653_0006922
462 Ga0495582_0008645
463 Ga0495605_0051271
464 Ga0495605_0076555
465 Ga0495639_0005662
466 Ga0495662_0001066
467 Ga0495585_0167267
468 Ga0495616_0058094
469 Ga0495630_0261695
470 Ga0495642_0013316
471 Ga0495642_0098723
472 Ga0495652_0052587
473 Ga0495665_0002230
474 Ga0495640_0209145
475 Ga0495640_0226421
476 Ga0495586_0056158
477 Ga0495587_0026566
478 Ga0495587_0081906
479 Ga0495645_0115776
480 Ga0495667_0027445
481 Ga0495667_0037622
482 Ga0495635_0035795
483 Ga0495647_0020050
484 Ga0495658_0006501
485 Ga0495658_0156489
486 Ga0495613_0007338
487 Ga0495624_0004077
488 Ga0495589_0064491
489 Ga0495600_0209629
490 Ga0495581_0001128
491 Ga0495581_0016915
492 Ga0495604_0018135
493 Ga0495674_0031597
494 Ga0495674_0094624
495 Ga0495674_0537195
496 Ga0495676_0002201
497 Ga0495676_0022347
498 Ga0495680_0008704
499 Ga0495680_0011638
500 Ga0495675_0016952
501 Ga0495677_0033476
502 Ga0495684_0003390
503 Ga0495684_0139653
504 Ga0495593_0002220
505 Ga0495614_0001086
506 Ga0496100_0005559
507 Ga0496100_0007193
508 Ga0496100_0013465
509 Ga0496101_0002659
510 Ga0496101_0014792
511 Ga0496101_0073635
512 Ga0496102_0012383
513 Ga0496102_0141059
514 Ga0496102_0271332
515 Ga0496103_0007477
516 Ga0496103_0041945
517 Ga0496103_0068720
518 Ga0496103_0097522
519 Ga0496104_0036273
520 Ga0496104_0363447
521 Ga0496104_0428737
522 Ga0496105_0022310
523 Ga0496105_0030982
524 Ga0496105_0212070
525 Ga0496106_0014025
526 Ga0496106_0056745
527 Ga0496107_0001090
528 Ga0496107_0014755
529 Ga0496107_0016165
530 Ga0496107_0086317
531 Ga0496109_0036621
532 Ga0496110_0233293
533 Ga0496110_0262516
534 Ga0496111_0131826
535 Ga0496112_0048338
536 Ga0496112_0069694
537 Ga0496112_0098921
538 Ga0496112_0266326
539 Ga0496113_0170927
540 Ga0496113_0181904
541 Ga0496114_0065068
542 Ga0496114_0067534
543 Ga0496114_0123932
544 Ga0496115_0001106
545 Ga0501067_0024304
546 Ga0501067_0038923
547 Ga0501067_0062538
548 Ga0501069_0022671
549 Ga0501070_0069767
550 Ga0501072_0002984
551 Ga0501073_0093239
552 Ga0501083_0086726
553 nmdc:mga0n895_44562_c1
554 nmdc:mga0rr50_101050_c1
555 Ga0495601_0039793
556 Ga0495619_0002699
557 Ga0495619_0004000
558 Ga0501084_0266574
559 Ga0466962_0045200
560 Ga0530510_0006566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

179

377

0.92

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

63

176

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 0.9704 164 195
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9395 164 197
3wid-assembly1.cif.gz_C structure of a glucose dehydrogenase t277f mutant in complex with nadp 0.9258 2 329
2vwg-assembly1.cif.gz_A haloferax mediterranei glucose dehydrogenase in complex with nadp, zn and gluconolactone. 0.9239 1 333
2vwg-assembly1.cif.gz_A haloferax mediterranei glucose dehydrogenase in complex with nadp, zn and gluconolactone. 0.9213 1 333
ID Description Score Start End Superfamily
af_A0A1D6FI70_73_317_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9687 166 195 3.50.50.60
af_Q5I0K1_8_223_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9537 166 196 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9528 166 196 3.50.50.60
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.943 164 197 3.50.50.60
af_A0A0P0V2P7_13_181_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9404 166 197 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1Q7UL62-F1-model_v4 Glucose dehydrogenase 0.9609 1 307 GO:0016491
AF-A0A521S1I1-F1-model_v4 Glucose dehydrogenase 0.9601 1 330 GO:0016491
AF-A0A7Y3P9Y8-F1-model_v4 Glucose 1-dehydrogenase 0.9601 1 292 GO:0016491
AF-A0A366LQ45-F1-model_v4 Theronine dehydrogenase 0.9593 1 329 GO:0016491
AF-A0A2V7KWE2-F1-model_v4 Glucose dehydrogenase 0.9571 1 331 GO:0016491

Map