F383844
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 168 | 280 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300044673|Ga0453683_0260725|Ga0453683_0260725_611_1003 |
| Length | 130 |
| Sequence | MLAKRVFAITATNLSLSNIPEDEMSDLASRECIPCRGGVPPLKGEELTNLLTEVRGWEVVNEHHLKKVHKFANFREAQEFVNRVGDLAEEQGHHPDICFGWGRAEITIWTHKIDGLTESDFILAAKIDRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 139 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 140 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 141 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 142 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 149 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 150 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 151 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 152 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 153 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 154 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 155 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 156 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 158 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 159 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 160 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 161 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 162 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 163 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 164 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 99.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_11623092 | 3300005328 | Unclassified | 500 |
| 2 | Ga0070690_100278715 | 3300005330 | Bacteria | 1192 |
| 3 | Ga0070690_100514821 | 3300005330 | Bacteria | 897 |
| 4 | Ga0070670_100033772 | 3300005331 | Bacteria | 4405 |
| 5 | Ga0070670_100507217 | 3300005331 | Bacteria | 1073 |
| 6 | Ga0068869_100107390 | 3300005334 | Bacteria | 2119 |
| 7 | Ga0070666_10018695 | 3300005335 | Bacteria | 4462 |
| 8 | Ga0070680_100124989 | 3300005336 | Unclassified | 2149 |
| 9 | Ga0068868_100015354 | 3300005338 | Bacteria | 5663 |
| 10 | Ga0070660_100455835 | 3300005339 | Unclassified | 1061 |
| 11 | Ga0070689_100118679 | 3300005340 | Bacteria | 2111 |
| 12 | Ga0070689_102009056 | 3300005340 | Unclassified | 529 |
| 13 | Ga0070661_100072148 | 3300005344 | Bacteria | 2541 |
| 14 | Ga0070692_10485391 | 3300005345 | Bacteria | 798 |
| 15 | Ga0070692_10572745 | 3300005345 | Unclassified | 743 |
| 16 | Ga0070669_100007623 | 3300005353 | Bacteria | 7736 |
| 17 | Ga0070669_100194836 | 3300005353 | Unclassified | 1591 |
| 18 | Ga0070675_100170707 | 3300005354 | Bacteria | 1875 |
| 19 | Ga0070671_100012257 | 3300005355 | Bacteria | 6897 |
| 20 | Ga0070674_100194176 | 3300005356 | Bacteria | 1563 |
| 21 | Ga0070673_100475117 | 3300005364 | Bacteria | 1127 |
| 22 | Ga0070688_100078158 | 3300005365 | Bacteria | 2134 |
| 23 | Ga0070659_100006617 | 3300005366 | Bacteria | 8374 |
| 24 | Ga0070667_100015111 | 3300005367 | Bacteria | 6376 |
| 25 | Ga0070709_10150280 | 3300005434 | Bacteria | 1609 |
| 26 | Ga0070709_10775080 | 3300005434 | Bacteria | 751 |
| 27 | Ga0070711_100058448 | 3300005439 | Unclassified | 2674 |
| 28 | Ga0070705_100426701 | 3300005440 | Unclassified | 989 |
| 29 | Ga0070705_101183046 | 3300005440 | Bacteria | 629 |
| 30 | Ga0070694_100000381 | 3300005444 | Bacteria | 23963 |
| 31 | Ga0070694_100372511 | 3300005444 | Unclassified | 1112 |
| 32 | Ga0070708_100000406 | 3300005445 | Bacteria | 32362 |
| 33 | Ga0070708_100022467 | 3300005445 | Bacteria | 5351 |
| 34 | Ga0070708_100125544 | 3300005445 | Bacteria | 2371 |
| 35 | Ga0070708_100224106 | 3300005445 | Unclassified | 1764 |
| 36 | Ga0070678_100630967 | 3300005456 | Unclassified | 959 |
| 37 | Ga0070662_100178474 | 3300005457 | Unclassified | 1673 |
| 38 | Ga0070681_10004724 | 3300005458 | Bacteria | 13043 |
| 39 | Ga0068867_101721903 | 3300005459 | Unclassified | 588 |
| 40 | Ga0070706_100001194 | 3300005467 | Bacteria | 27840 |
| 41 | Ga0070706_100013663 | 3300005467 | Bacteria | 7506 |
| 42 | Ga0070706_100058559 | 3300005467 | Unclassified | 3555 |
| 43 | Ga0070706_100366623 | 3300005467 | Unclassified | 1342 |
| 44 | Ga0070706_100696944 | 3300005467 | Bacteria | 942 |
| 45 | Ga0070707_100045129 | 3300005468 | Bacteria | 4218 |
| 46 | Ga0070707_100119021 | 3300005468 | Bacteria | 2564 |
| 47 | Ga0070707_100139202 | 3300005468 | Bacteria | 2362 |
| 48 | Ga0070707_100825927 | 3300005468 | Bacteria | 891 |
| 49 | Ga0070707_101271363 | 3300005468 | Bacteria | 702 |
| 50 | Ga0070698_100002160 | 3300005471 | Bacteria | 21832 |
| 51 | Ga0070698_100227432 | 3300005471 | Bacteria | 1799 |
| 52 | Ga0070698_102093056 | 3300005471 | Unclassified | 519 |
| 53 | Ga0070699_100000218 | 3300005518 | Bacteria | 57007 |
| 54 | Ga0070699_100017809 | 3300005518 | Bacteria | 6100 |
| 55 | Ga0070699_100453745 | 3300005518 | Bacteria | 1162 |
| 56 | Ga0070699_100454331 | 3300005518 | Bacteria | 1162 |
| 57 | Ga0070699_100718396 | 3300005518 | Unclassified | 913 |
| 58 | Ga0070699_100834267 | 3300005518 | Unclassified | 844 |
| 59 | Ga0070699_101318129 | 3300005518 | Unclassified | 662 |
| 60 | Ga0070679_100811665 | 3300005530 | Unclassified | 879 |
| 61 | Ga0070684_100557277 | 3300005535 | Unclassified | 1064 |
| 62 | Ga0070684_101373900 | 3300005535 | Unclassified | 665 |
| 63 | Ga0070697_100000042 | 3300005536 | Bacteria | 94533 |
| 64 | Ga0070697_100002583 | 3300005536 | Bacteria | 13925 |
| 65 | Ga0070697_100024206 | 3300005536 | Unclassified | 4833 |
| 66 | Ga0070697_101644906 | 3300005536 | Bacteria | 574 |
| 67 | Ga0070697_101718719 | 3300005536 | Unclassified | 561 |
| 68 | Ga0068853_100182970 | 3300005539 | Bacteria | 1901 |
| 69 | Ga0068853_100334822 | 3300005539 | Bacteria | 1405 |
| 70 | Ga0070686_100040459 | 3300005544 | Bacteria | 2908 |
| 71 | Ga0070695_100091712 | 3300005545 | Bacteria | 2030 |
| 72 | Ga0070695_100129552 | 3300005545 | Unclassified | 1737 |
| 73 | Ga0070695_100140170 | 3300005545 | Unclassified | 1676 |
| 74 | Ga0070695_100183209 | 3300005545 | Bacteria | 1485 |
| 75 | Ga0070695_101354007 | 3300005545 | Unclassified | 589 |
| 76 | Ga0070696_100020075 | 3300005546 | Bacteria | 4531 |
| 77 | Ga0070696_100487788 | 3300005546 | Bacteria | 978 |
| 78 | Ga0070696_101508441 | 3300005546 | Bacteria | 575 |
| 79 | Ga0070693_100718268 | 3300005547 | Unclassified | 733 |
| 80 | Ga0070693_101529470 | 3300005547 | Bacteria | 522 |
| 81 | Ga0070704_100068744 | 3300005549 | Bacteria | 2564 |
| 82 | Ga0070704_100204587 | 3300005549 | Bacteria | 1596 |
| 83 | Ga0068855_100319083 | 3300005563 | Bacteria | 1718 |
| 84 | Ga0070664_100144465 | 3300005564 | Bacteria | 2097 |
| 85 | Ga0070664_100144973 | 3300005564 | Bacteria | 2093 |
| 86 | Ga0068857_100007367 | 3300005577 | Bacteria | 9471 |
| 87 | Ga0068854_101345000 | 3300005578 | Bacteria | 644 |
| 88 | Ga0070702_100185399 | 3300005615 | Unclassified | 1365 |
| 89 | Ga0070702_100197138 | 3300005615 | Bacteria | 1330 |
| 90 | Ga0068859_100013133 | 3300005617 | Bacteria | 8322 |
| 91 | Ga0068859_100685143 | 3300005617 | Unclassified | 1116 |
| 92 | Ga0068859_101302330 | 3300005617 | Unclassified | 801 |
| 93 | Ga0068859_102073182 | 3300005617 | Unclassified | 628 |
| 94 | Ga0068864_100003314 | 3300005618 | Bacteria | 13307 |
| 95 | Ga0068864_100009753 | 3300005618 | Bacteria | 7921 |
| 96 | Ga0068864_100077190 | 3300005618 | Bacteria | 2912 |
| 97 | Ga0068866_10003551 | 3300005718 | Bacteria | 6385 |
| 98 | Ga0068866_10363784 | 3300005718 | Unclassified | 923 |
| 99 | Ga0068861_100032952 | 3300005719 | Bacteria | 3819 |
| 100 | Ga0068861_100216491 | 3300005719 | Unclassified | 1616 |
| 101 | Ga0068870_10449703 | 3300005840 | Unclassified | 849 |
| 102 | Ga0068863_101273062 | 3300005841 | Unclassified | 742 |
| 103 | Ga0068858_100046429 | 3300005842 | Bacteria | 4026 |
| 104 | Ga0068860_100023828 | 3300005843 | Bacteria | 5918 |
| 105 | Ga0068862_100118792 | 3300005844 | Bacteria | 2328 |
| 106 | Ga0068862_100715266 | 3300005844 | Unclassified | 971 |
| 107 | Ga0068862_101116529 | 3300005844 | Unclassified | 784 |
| 108 | Ga0070716_100000008 | 3300006173 | Bacteria | 182956 |
| 109 | Ga0070716_100072236 | 3300006173 | Unclassified | 2031 |
| 110 | Ga0070716_100266454 | 3300006173 | Unclassified | 1175 |
| 111 | Ga0070716_101328058 | 3300006173 | Bacteria | 582 |
| 112 | Ga0097621_100042465 | 3300006237 | Bacteria | 3663 |
| 113 | Ga0097621_101372500 | 3300006237 | Bacteria | 669 |
| 114 | Ga0068871_100022891 | 3300006358 | Bacteria | 4823 |
| 115 | Ga0075433_10064792 | 3300006852 | Unclassified | 3204 |
| 116 | Ga0075433_10171991 | 3300006852 | Bacteria | 1928 |
| 117 | Ga0075433_10409848 | 3300006852 | Bacteria | 1196 |
| 118 | Ga0075433_11290495 | 3300006852 | Unclassified | 633 |
| 119 | Ga0075434_100009263 | 3300006871 | Bacteria | 9176 |
| 120 | Ga0075434_101318730 | 3300006871 | Bacteria | 732 |
| 121 | Ga0068865_100853175 | 3300006881 | Bacteria | 789 |
| 122 | Ga0097620_100013134 | 3300006931 | Bacteria | 8322 |
| 123 | Ga0097620_100685272 | 3300006931 | Unclassified | 1116 |
| 124 | Ga0097620_101302356 | 3300006931 | Unclassified | 801 |
| 125 | Ga0097620_102073807 | 3300006931 | Unclassified | 628 |
| 126 | Ga0099794_10695368 | 3300007265 | Unclassified | 541 |
| 127 | Ga0105240_11452260 | 3300009093 | Unclassified | 720 |
| 128 | Ga0105245_10141794 | 3300009098 | Bacteria | 2264 |
| 129 | Ga0114129_10011789 | 3300009147 | Bacteria | 12438 |
| 130 | Ga0114129_10052986 | 3300009147 | Bacteria | 5692 |
| 131 | Ga0114129_10077667 | 3300009147 | Bacteria | 4618 |
| 132 | Ga0114129_11422308 | 3300009147 | Unclassified | 855 |
| 133 | Ga0105243_10000037 | 3300009148 | Bacteria | 175237 |
| 134 | Ga0105243_12105661 | 3300009148 | Unclassified | 600 |
| 135 | Ga0105241_10041539 | 3300009174 | Unclassified | 3475 |
| 136 | Ga0105241_10831630 | 3300009174 | Unclassified | 853 |
| 137 | Ga0105242_10000039 | 3300009176 | Bacteria | 88325 |
| 138 | Ga0105242_10049263 | 3300009176 | Bacteria | 3427 |
| 139 | Ga0105242_10130594 | 3300009176 | Bacteria | 2168 |
| 140 | Ga0105242_10232325 | 3300009176 | Bacteria | 1653 |
| 141 | Ga0105249_10339206 | 3300009553 | Unclassified | 1519 |
| 142 | Ga0099796_10475739 | 3300010159 | Unclassified | 558 |
| 143 | Ga0105246_10404349 | 3300011119 | Bacteria | 1135 |
| 144 | Ga0157373_10584586 | 3300013100 | Viruses | 812 |
| 145 | Ga0157374_10009145 | 3300013296 | Bacteria | 8492 |
| 146 | Ga0157378_10036917 | 3300013297 | Unclassified | 4326 |
| 147 | Ga0157378_10167940 | 3300013297 | Bacteria | 2056 |
| 148 | Ga0157378_10269597 | 3300013297 | Unclassified | 1637 |
| 149 | Ga0157378_12210755 | 3300013297 | Unclassified | 601 |
| 150 | Ga0163162_10002710 | 3300013306 | Bacteria | 16806 |
| 151 | Ga0163162_10004905 | 3300013306 | Bacteria | 12891 |
| 152 | Ga0163162_10011664 | 3300013306 | Bacteria | 8568 |
| 153 | Ga0163162_10153413 | 3300013306 | Bacteria | 2422 |
| 154 | Ga0157375_10157919 | 3300013308 | Bacteria | 2408 |
| 155 | Ga0157375_12607593 | 3300013308 | Unclassified | 604 |
| 156 | Ga0157375_13147094 | 3300013308 | Unclassified | 550 |
| 157 | Ga0163163_10002315 | 3300014325 | Bacteria | 16085 |
| 158 | Ga0163163_10007175 | 3300014325 | Bacteria | 9808 |
| 159 | Ga0157380_12386900 | 3300014326 | Bacteria | 594 |
| 160 | Ga0157377_10131472 | 3300014745 | Bacteria | 1529 |
| 161 | Ga0157376_10123952 | 3300014969 | Bacteria | 2294 |
| 162 | Ga0163161_10172376 | 3300017792 | Unclassified | 1655 |
| 163 | Ga0207653_10016414 | 3300025885 | Bacteria | 2325 |
| 164 | Ga0207692_10467176 | 3300025898 | Bacteria | 796 |
| 165 | Ga0207642_10022693 | 3300025899 | Bacteria | 2494 |
| 166 | Ga0207680_10539765 | 3300025903 | Bacteria | 832 |
| 167 | Ga0207647_10389247 | 3300025904 | Unclassified | 786 |
| 168 | Ga0207699_10534343 | 3300025906 | Unclassified | 849 |
| 169 | Ga0207699_11229410 | 3300025906 | Bacteria | 555 |
| 170 | Ga0207643_10445247 | 3300025908 | Unclassified | 824 |
| 171 | Ga0207684_10005647 | 3300025910 | Bacteria | 11491 |
| 172 | Ga0207684_10120788 | 3300025910 | Bacteria | 2246 |
| 173 | Ga0207684_10424779 | 3300025910 | Unclassified | 1142 |
| 174 | Ga0207684_10661659 | 3300025910 | Bacteria | 889 |
| 175 | Ga0207707_10078990 | 3300025912 | Unclassified | 2873 |
| 176 | Ga0207663_10074588 | 3300025916 | Unclassified | 2199 |
| 177 | Ga0207660_10199454 | 3300025917 | Unclassified | 1562 |
| 178 | Ga0207662_10060733 | 3300025918 | Bacteria | 2268 |
| 179 | Ga0207649_10940184 | 3300025920 | Unclassified | 679 |
| 180 | Ga0207652_11298568 | 3300025921 | Unclassified | 630 |
| 181 | Ga0207646_10076124 | 3300025922 | Bacteria | 2998 |
| 182 | Ga0207646_10086112 | 3300025922 | Bacteria | 2811 |
| 183 | Ga0207646_10093594 | 3300025922 | Bacteria | 2691 |
| 184 | Ga0207646_10898252 | 3300025922 | Unclassified | 786 |
| 185 | Ga0207646_10927232 | 3300025922 | Bacteria | 772 |
| 186 | Ga0207681_10001324 | 3300025923 | Bacteria | 15988 |
| 187 | Ga0207681_10179690 | 3300025923 | Unclassified | 1611 |
| 188 | Ga0207681_10604936 | 3300025923 | Unclassified | 906 |
| 189 | Ga0207681_11225780 | 3300025923 | Unclassified | 630 |
| 190 | Ga0207650_10050396 | 3300025925 | Unclassified | 3078 |
| 191 | Ga0207659_10481532 | 3300025926 | Unclassified | 1048 |
| 192 | Ga0207690_10170886 | 3300025932 | Unclassified | 1628 |
| 193 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 194 | Ga0207686_10000335 | 3300025934 | Bacteria | 33878 |
| 195 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 196 | Ga0207709_10176343 | 3300025935 | Unclassified | 1505 |
| 197 | Ga0207670_10280621 | 3300025936 | Bacteria | 1298 |
| 198 | Ga0207670_10703644 | 3300025936 | Bacteria | 836 |
| 199 | Ga0207704_10570329 | 3300025938 | Bacteria | 922 |
| 200 | Ga0207665_10000003 | 3300025939 | Bacteria | 220666 |
| 201 | Ga0207665_10080583 | 3300025939 | Bacteria | 2240 |
| 202 | Ga0207665_10118008 | 3300025939 | Bacteria | 1871 |
| 203 | Ga0207665_10993769 | 3300025939 | Bacteria | 667 |
| 204 | Ga0207711_10018399 | 3300025941 | Bacteria | 5807 |
| 205 | Ga0207689_10030284 | 3300025942 | Bacteria | 4511 |
| 206 | Ga0207679_10009663 | 3300025945 | Bacteria | 6183 |
| 207 | Ga0207667_11537253 | 3300025949 | Unclassified | 636 |
| 208 | Ga0207651_10522364 | 3300025960 | Bacteria | 1029 |
| 209 | Ga0207712_10287189 | 3300025961 | Unclassified | 1345 |
| 210 | Ga0207658_10774016 | 3300025986 | Bacteria | 870 |
| 211 | Ga0207677_10032732 | 3300026023 | Bacteria | 3345 |
| 212 | Ga0207677_10646033 | 3300026023 | Unclassified | 933 |
| 213 | Ga0207703_10416793 | 3300026035 | Bacteria | 1249 |
| 214 | Ga0207639_10159433 | 3300026041 | Bacteria | 1900 |
| 215 | Ga0207708_11840640 | 3300026075 | Unclassified | 531 |
| 216 | Ga0207648_10145243 | 3300026089 | Bacteria | 2092 |
| 217 | Ga0207648_11685435 | 3300026089 | Unclassified | 595 |
| 218 | Ga0207676_10024186 | 3300026095 | Bacteria | 4493 |
| 219 | Ga0207676_10031720 | 3300026095 | Bacteria | 3975 |
| 220 | Ga0207676_10111752 | 3300026095 | Bacteria | 2287 |
| 221 | Ga0207676_10629126 | 3300026095 | Bacteria | 1034 |
| 222 | Ga0207674_10000192 | 3300026116 | Bacteria | 75255 |
| 223 | Ga0207675_100034497 | 3300026118 | Bacteria | 4718 |
| 224 | Ga0207675_101235140 | 3300026118 | Unclassified | 768 |
| 225 | Ga0207675_101618641 | 3300026118 | Unclassified | 668 |
| 226 | Ga0207683_10173765 | 3300026121 | Bacteria | 1952 |
| 227 | Ga0209588_1029908 | 3300027671 | Bacteria | 1739 |
| 228 | Ga0209974_10164392 | 3300027876 | Unclassified | 806 |
| 229 | Ga0268265_10953167 | 3300028380 | Unclassified | 845 |
| 230 | Ga0268265_10961850 | 3300028380 | Unclassified | 842 |
| 231 | Ga0268264_10084213 | 3300028381 | Bacteria | 2726 |
| 232 | Ga0268264_10681044 | 3300028381 | Unclassified | 1020 |
| 233 | Ga0307408_100204066 | 3300031548 | Unclassified | 1602 |
| 234 | Ga0307405_10058757 | 3300031731 | Bacteria | 2421 |
| 235 | Ga0307413_10825829 | 3300031824 | Unclassified | 781 |
| 236 | Ga0307407_10454496 | 3300031903 | Unclassified | 930 |
| 237 | Ga0307412_10214778 | 3300031911 | Unclassified | 1470 |
| 238 | Ga0307416_100036188 | 3300032002 | Unclassified | 3782 |
| 239 | Ga0307414_10386477 | 3300032004 | Bacteria | 1212 |
| 240 | Ga0307411_11620945 | 3300032005 | Unclassified | 597 |
| 241 | Ga0307415_100068193 | 3300032126 | Bacteria | 2488 |
| 242 | Ga0395900_0657927 | 3300037418 | Bacteria | 984 |
| 243 | Ga0395898_1955849 | 3300037466 | Unclassified | 506 |
| 244 | Ga0450891_016697 | 3300042129 | Bacteria | 702 |
| 245 | Ga0450889_038712 | 3300042144 | Bacteria | 572 |
| 246 | Ga0439434_0202365 | 3300042435 | Bacteria | 670 |
| 247 | Ga0439460_0122605 | 3300042461 | Bacteria | 851 |
| 248 | Ga0453683_0260725 | 3300044673 | Unclassified | 1106 |
| 249 | Ga0451576_0657721 | 3300045051 | Bacteria | 1101 |
| 250 | Ga0495610_0108681 | 3300046512 | Bacteria | 1231 |
| 251 | Ga0495621_0000017 | 3300046539 | Bacteria | 32151 |
| 252 | Ga0495656_0371300 | 3300046615 | Unclassified | 744 |
| 253 | Ga0496112_0746796 | 3300048915 | Unclassified | 905 |
| 254 | Ga0501290_050556 | 3300049513 | Unclassified | 646 |
| 255 | Ga0501296_045932 | 3300049519 | Unclassified | 628 |
| 256 | Ga0501297_001403 | 3300049520 | Bacteria | 2206 |
| 257 | Ga0501298_010233 | 3300049521 | Unclassified | 1610 |
| 258 | Ga0501299_121191 | 3300049522 | Unclassified | 630 |
| 259 | Ga0501202_019820 | 3300049652 | Unclassified | 1332 |
| 260 | Ga0501216_012713 | 3300049660 | Unclassified | 1386 |
| 261 | Ga0501217_009361 | 3300049661 | Bacteria | 2130 |
| 262 | Ga0501223_071580 | 3300049663 | Unclassified | 685 |
| 263 | Ga0501228_061055 | 3300049666 | Unclassified | 533 |
| 264 | Ga0501233_014306 | 3300049668 | Bacteria | 1620 |
| 265 | Ga0501235_117497 | 3300049669 | Unclassified | 663 |
| 266 | Ga0501257_032424 | 3300049686 | Unclassified | 1264 |
| 267 | Ga0501260_017688 | 3300049689 | Unclassified | 756 |
| 268 | Ga0501241_116725 | 3300049758 | Bacteria | 589 |
| 269 | Ga0501279_049386 | 3300049775 | Unclassified | 664 |
| 270 | Ga0501283_006675 | 3300049779 | Unclassified | 1623 |
| 271 | nmdc:mga05p37_29784_c1 | 3300050507 | Bacteria | 6661 |
| 272 | nmdc:mga05p37_592868_c1 | 3300050507 | Bacteria | 1252 |
| 273 | nmdc:mga05p37_76505_c1 | 3300050507 | Unclassified | 4120 |
| 274 | nmdc:mga05p37_95309_c1 | 3300050507 | Unclassified | 3666 |
| 275 | nmdc:mga05p37_98068_c1 | 3300050507 | Bacteria | 3610 |
| 276 | nmdc:mga06r32_1041724_c1 | 3300050510 | Unclassified | 769 |
| 277 | nmdc:mga0n895_1850199_c1 | 3300050512 | Unclassified | 563 |
| 278 | nmdc:mga0a205_198884_c1 | 3300050515 | Bacteria | 1895 |
| 279 | nmdc:mga0a205_403136_c1 | 3300050515 | Bacteria | 1231 |
| 280 | nmdc:mga0a205_81318_c1 | 3300050515 | Bacteria | 3130 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005328 | Ga0070676_11623092 | Ga0070676_116230921 | 107 |
| 2 | 3300005330 | Ga0070690_100278715 | Ga0070690_1002787152 | 107 |
| 3 | 3300005330 | Ga0070690_100514821 | Ga0070690_1005148212 | 107 |
| 4 | 3300005331 | Ga0070670_100033772 | Ga0070670_1000337724 | 107 |
| 5 | 3300005331 | Ga0070670_100507217 | Ga0070670_1005072172 | 107 |
| 6 | 3300005334 | Ga0068869_100107390 | Ga0068869_1001073903 | 107 |
| 7 | 3300005335 | Ga0070666_10018695 | Ga0070666_100186955 | 107 |
| 8 | 3300005336 | Ga0070680_100124989 | Ga0070680_1001249892 | 107 |
| 9 | 3300005338 | Ga0068868_100015354 | Ga0068868_1000153545 | 107 |
| 10 | 3300005339 | Ga0070660_100455835 | Ga0070660_1004558352 | 107 |
| 11 | 3300005340 | Ga0070689_100118679 | Ga0070689_1001186793 | 107 |
| 12 | 3300005340 | Ga0070689_102009056 | Ga0070689_1020090561 | 107 |
| 13 | 3300005344 | Ga0070661_100072148 | Ga0070661_1000721481 | 107 |
| 14 | 3300005345 | Ga0070692_10485391 | Ga0070692_104853912 | 107 |
| 15 | 3300005345 | Ga0070692_10572745 | Ga0070692_105727452 | 107 |
| 16 | 3300005353 | Ga0070669_100007623 | Ga0070669_1000076233 | 107 |
| 17 | 3300005353 | Ga0070669_100194836 | Ga0070669_1001948362 | 107 |
| 18 | 3300005354 | Ga0070675_100170707 | Ga0070675_1001707073 | 107 |
| 19 | 3300005355 | Ga0070671_100012257 | Ga0070671_1000122571 | 107 |
| 20 | 3300005356 | Ga0070674_100194176 | Ga0070674_1001941761 | 107 |
| 21 | 3300005364 | Ga0070673_100475117 | Ga0070673_1004751172 | 107 |
| 22 | 3300005365 | Ga0070688_100078158 | Ga0070688_1000781582 | 107 |
| 23 | 3300005366 | Ga0070659_100006617 | Ga0070659_1000066175 | 107 |
| 24 | 3300005367 | Ga0070667_100015111 | Ga0070667_1000151112 | 107 |
| 25 | 3300005434 | Ga0070709_10150280 | Ga0070709_101502802 | 107 |
| 26 | 3300005434 | Ga0070709_10775080 | Ga0070709_107750801 | 107 |
| 27 | 3300005439 | Ga0070711_100058448 | Ga0070711_1000584482 | 107 |
| 28 | 3300005440 | Ga0070705_100426701 | Ga0070705_1004267012 | 107 |
| 29 | 3300005440 | Ga0070705_101183046 | Ga0070705_1011830461 | 107 |
| 30 | 3300005444 | Ga0070694_100000381 | Ga0070694_1000003817 | 107 |
| 31 | 3300005444 | Ga0070694_100372511 | Ga0070694_1003725112 | 107 |
| 32 | 3300005445 | Ga0070708_100000406 | Ga0070708_1000004064 | 107 |
| 33 | 3300005445 | Ga0070708_100022467 | Ga0070708_1000224674 | 107 |
| 34 | 3300005445 | Ga0070708_100125544 | Ga0070708_1001255442 | 107 |
| 35 | 3300005445 | Ga0070708_100224106 | Ga0070708_1002241062 | 107 |
| 36 | 3300005456 | Ga0070678_100630967 | Ga0070678_1006309671 | 107 |
| 37 | 3300005457 | Ga0070662_100178474 | Ga0070662_1001784743 | 107 |
| 38 | 3300005458 | Ga0070681_10004724 | Ga0070681_100047249 | 107 |
| 39 | 3300005459 | Ga0068867_101721903 | Ga0068867_1017219031 | 107 |
| 40 | 3300005467 | Ga0070706_100001194 | Ga0070706_1000011944 | 107 |
| 41 | 3300005467 | Ga0070706_100013663 | Ga0070706_1000136638 | 107 |
| 42 | 3300005467 | Ga0070706_100058559 | Ga0070706_1000585593 | 107 |
| 43 | 3300005467 | Ga0070706_100366623 | Ga0070706_1003666231 | 107 |
| 44 | 3300005467 | Ga0070706_100696944 | Ga0070706_1006969442 | 107 |
| 45 | 3300005468 | Ga0070707_100045129 | Ga0070707_1000451294 | 107 |
| 46 | 3300005468 | Ga0070707_100119021 | Ga0070707_1001190212 | 107 |
| 47 | 3300005468 | Ga0070707_100139202 | Ga0070707_1001392023 | 107 |
| 48 | 3300005468 | Ga0070707_100825927 | Ga0070707_1008259272 | 107 |
| 49 | 3300005468 | Ga0070707_101271363 | Ga0070707_1012713631 | 107 |
| 50 | 3300005471 | Ga0070698_100002160 | Ga0070698_1000021604 | 107 |
| 51 | 3300005471 | Ga0070698_100227432 | Ga0070698_1002274321 | 107 |
| 52 | 3300005471 | Ga0070698_102093056 | Ga0070698_1020930561 | 107 |
| 53 | 3300005518 | Ga0070699_100000218 | Ga0070699_10000021834 | 107 |
| 54 | 3300005518 | Ga0070699_100017809 | Ga0070699_1000178096 | 107 |
| 55 | 3300005518 | Ga0070699_100453745 | Ga0070699_1004537451 | 107 |
| 56 | 3300005518 | Ga0070699_100454331 | Ga0070699_1004543312 | 107 |
| 57 | 3300005518 | Ga0070699_100718396 | Ga0070699_1007183961 | 107 |
| 58 | 3300005518 | Ga0070699_100834267 | Ga0070699_1008342672 | 107 |
| 59 | 3300005518 | Ga0070699_101318129 | Ga0070699_1013181291 | 107 |
| 60 | 3300005530 | Ga0070679_100811665 | Ga0070679_1008116651 | 107 |
| 61 | 3300005535 | Ga0070684_100557277 | Ga0070684_1005572771 | 107 |
| 62 | 3300005535 | Ga0070684_101373900 | Ga0070684_1013739001 | 107 |
| 63 | 3300005536 | Ga0070697_100000042 | Ga0070697_10000004212 | 107 |
| 64 | 3300005536 | Ga0070697_100002583 | Ga0070697_1000025836 | 107 |
| 65 | 3300005536 | Ga0070697_100024206 | Ga0070697_1000242065 | 107 |
| 66 | 3300005536 | Ga0070697_101644906 | Ga0070697_1016449062 | 107 |
| 67 | 3300005536 | Ga0070697_101718719 | Ga0070697_1017187192 | 107 |
| 68 | 3300005539 | Ga0068853_100182970 | Ga0068853_1001829701 | 107 |
| 69 | 3300005539 | Ga0068853_100334822 | Ga0068853_1003348222 | 107 |
| 70 | 3300005544 | Ga0070686_100040459 | Ga0070686_1000404595 | 107 |
| 71 | 3300005545 | Ga0070695_100091712 | Ga0070695_1000917123 | 107 |
| 72 | 3300005545 | Ga0070695_100129552 | Ga0070695_1001295522 | 107 |
| 73 | 3300005545 | Ga0070695_100140170 | Ga0070695_1001401701 | 107 |
| 74 | 3300005545 | Ga0070695_100183209 | Ga0070695_1001832092 | 107 |
| 75 | 3300005545 | Ga0070695_101354007 | Ga0070695_1013540071 | 107 |
| 76 | 3300005546 | Ga0070696_100020075 | Ga0070696_1000200752 | 107 |
| 77 | 3300005546 | Ga0070696_100487788 | Ga0070696_1004877882 | 107 |
| 78 | 3300005546 | Ga0070696_101508441 | Ga0070696_1015084411 | 107 |
| 79 | 3300005547 | Ga0070693_100718268 | Ga0070693_1007182681 | 107 |
| 80 | 3300005547 | Ga0070693_101529470 | Ga0070693_1015294701 | 107 |
| 81 | 3300005549 | Ga0070704_100068744 | Ga0070704_1000687444 | 107 |
| 82 | 3300005549 | Ga0070704_100204587 | Ga0070704_1002045872 | 107 |
| 83 | 3300005563 | Ga0068855_100319083 | Ga0068855_1003190832 | 107 |
| 84 | 3300005564 | Ga0070664_100144465 | Ga0070664_1001444652 | 107 |
| 85 | 3300005564 | Ga0070664_100144973 | Ga0070664_1001449734 | 107 |
| 86 | 3300005577 | Ga0068857_100007367 | Ga0068857_1000073677 | 107 |
| 87 | 3300005578 | Ga0068854_101345000 | Ga0068854_1013450002 | 107 |
| 88 | 3300005615 | Ga0070702_100185399 | Ga0070702_1001853992 | 107 |
| 89 | 3300005615 | Ga0070702_100197138 | Ga0070702_1001971382 | 107 |
| 90 | 3300005617 | Ga0068859_100013133 | Ga0068859_1000131335 | 107 |
| 91 | 3300005617 | Ga0068859_100685143 | Ga0068859_1006851432 | 107 |
| 92 | 3300005617 | Ga0068859_101302330 | Ga0068859_1013023302 | 107 |
| 93 | 3300005617 | Ga0068859_102073182 | Ga0068859_1020731822 | 107 |
| 94 | 3300005618 | Ga0068864_100003314 | Ga0068864_10000331411 | 107 |
| 95 | 3300005618 | Ga0068864_100009753 | Ga0068864_1000097535 | 107 |
| 96 | 3300005618 | Ga0068864_100077190 | Ga0068864_1000771903 | 107 |
| 97 | 3300005718 | Ga0068866_10003551 | Ga0068866_100035512 | 107 |
| 98 | 3300005718 | Ga0068866_10363784 | Ga0068866_103637841 | 107 |
| 99 | 3300005719 | Ga0068861_100032952 | Ga0068861_1000329524 | 107 |
| 100 | 3300005719 | Ga0068861_100216491 | Ga0068861_1002164911 | 107 |
| 101 | 3300005840 | Ga0068870_10449703 | Ga0068870_104497031 | 107 |
| 102 | 3300005841 | Ga0068863_101273062 | Ga0068863_1012730622 | 107 |
| 103 | 3300005842 | Ga0068858_100046429 | Ga0068858_1000464292 | 107 |
| 104 | 3300005843 | Ga0068860_100023828 | Ga0068860_1000238286 | 107 |
| 105 | 3300005844 | Ga0068862_100118792 | Ga0068862_1001187923 | 107 |
| 106 | 3300005844 | Ga0068862_100715266 | Ga0068862_1007152663 | 107 |
| 107 | 3300005844 | Ga0068862_101116529 | Ga0068862_1011165291 | 107 |
| 108 | 3300006173 | Ga0070716_100000008 | Ga0070716_1000000082 | 107 |
| 109 | 3300006173 | Ga0070716_100072236 | Ga0070716_1000722362 | 107 |
| 110 | 3300006173 | Ga0070716_100266454 | Ga0070716_1002664541 | 107 |
| 111 | 3300006173 | Ga0070716_101328058 | Ga0070716_1013280581 | 107 |
| 112 | 3300006237 | Ga0097621_100042465 | Ga0097621_1000424653 | 107 |
| 113 | 3300006237 | Ga0097621_101372500 | Ga0097621_1013725002 | 107 |
| 114 | 3300006358 | Ga0068871_100022891 | Ga0068871_1000228914 | 107 |
| 115 | 3300006852 | Ga0075433_10064792 | Ga0075433_100647923 | 107 |
| 116 | 3300006852 | Ga0075433_10171991 | Ga0075433_101719912 | 107 |
| 117 | 3300006852 | Ga0075433_10409848 | Ga0075433_104098482 | 107 |
| 118 | 3300006852 | Ga0075433_11290495 | Ga0075433_112904952 | 107 |
| 119 | 3300006871 | Ga0075434_100009263 | Ga0075434_1000092634 | 107 |
| 120 | 3300006871 | Ga0075434_101318730 | Ga0075434_1013187302 | 107 |
| 121 | 3300006881 | Ga0068865_100853175 | Ga0068865_1008531752 | 107 |
| 122 | 3300006931 | Ga0097620_100013134 | Ga0097620_1000131345 | 107 |
| 123 | 3300006931 | Ga0097620_100685272 | Ga0097620_1006852722 | 107 |
| 124 | 3300006931 | Ga0097620_101302356 | Ga0097620_1013023562 | 107 |
| 125 | 3300006931 | Ga0097620_102073807 | Ga0097620_1020738072 | 107 |
| 126 | 3300007265 | Ga0099794_10695368 | Ga0099794_106953681 | 107 |
| 127 | 3300009093 | Ga0105240_11452260 | Ga0105240_114522601 | 107 |
| 128 | 3300009098 | Ga0105245_10141794 | Ga0105245_101417942 | 107 |
| 129 | 3300009147 | Ga0114129_10011789 | Ga0114129_100117897 | 107 |
| 130 | 3300009147 | Ga0114129_10052986 | Ga0114129_100529861 | 107 |
| 131 | 3300009147 | Ga0114129_10077667 | Ga0114129_100776677 | 107 |
| 132 | 3300009147 | Ga0114129_11422308 | Ga0114129_114223082 | 107 |
| 133 | 3300009148 | Ga0105243_10000037 | Ga0105243_10000037120 | 107 |
| 134 | 3300009148 | Ga0105243_12105661 | Ga0105243_121056612 | 107 |
| 135 | 3300009174 | Ga0105241_10041539 | Ga0105241_100415393 | 107 |
| 136 | 3300009174 | Ga0105241_10831630 | Ga0105241_108316302 | 107 |
| 137 | 3300009176 | Ga0105242_10000039 | Ga0105242_1000003932 | 107 |
| 138 | 3300009176 | Ga0105242_10049263 | Ga0105242_100492635 | 107 |
| 139 | 3300009176 | Ga0105242_10130594 | Ga0105242_101305941 | 107 |
| 140 | 3300009176 | Ga0105242_10232325 | Ga0105242_102323251 | 107 |
| 141 | 3300009553 | Ga0105249_10339206 | Ga0105249_103392062 | 107 |
| 142 | 3300010159 | Ga0099796_10475739 | Ga0099796_104757391 | 107 |
| 143 | 3300011119 | Ga0105246_10404349 | Ga0105246_104043491 | 107 |
| 144 | 3300013100 | Ga0157373_10584586 | Ga0157373_105845861 | 107 |
| 145 | 3300013296 | Ga0157374_10009145 | Ga0157374_100091455 | 107 |
| 146 | 3300013297 | Ga0157378_10036917 | Ga0157378_100369175 | 107 |
| 147 | 3300013297 | Ga0157378_10167940 | Ga0157378_101679403 | 107 |
| 148 | 3300013297 | Ga0157378_10269597 | Ga0157378_102695972 | 107 |
| 149 | 3300013297 | Ga0157378_12210755 | Ga0157378_122107551 | 107 |
| 150 | 3300013306 | Ga0163162_10002710 | Ga0163162_100027109 | 107 |
| 151 | 3300013306 | Ga0163162_10004905 | Ga0163162_1000490512 | 107 |
| 152 | 3300013306 | Ga0163162_10011664 | Ga0163162_100116645 | 107 |
| 153 | 3300013306 | Ga0163162_10153413 | Ga0163162_101534133 | 107 |
| 154 | 3300013308 | Ga0157375_10157919 | Ga0157375_101579192 | 107 |
| 155 | 3300013308 | Ga0157375_12607593 | Ga0157375_126075931 | 107 |
| 156 | 3300013308 | Ga0157375_13147094 | Ga0157375_131470942 | 107 |
| 157 | 3300014325 | Ga0163163_10002315 | Ga0163163_100023156 | 107 |
| 158 | 3300014325 | Ga0163163_10007175 | Ga0163163_100071754 | 107 |
| 159 | 3300014326 | Ga0157380_12386900 | Ga0157380_123869001 | 107 |
| 160 | 3300014745 | Ga0157377_10131472 | Ga0157377_101314721 | 107 |
| 161 | 3300014969 | Ga0157376_10123952 | Ga0157376_101239522 | 107 |
| 162 | 3300017792 | Ga0163161_10172376 | Ga0163161_101723761 | 107 |
| 163 | 3300025885 | Ga0207653_10016414 | Ga0207653_100164142 | 107 |
| 164 | 3300025898 | Ga0207692_10467176 | Ga0207692_104671762 | 107 |
| 165 | 3300025899 | Ga0207642_10022693 | Ga0207642_100226933 | 107 |
| 166 | 3300025903 | Ga0207680_10539765 | Ga0207680_105397652 | 107 |
| 167 | 3300025904 | Ga0207647_10389247 | Ga0207647_103892472 | 107 |
| 168 | 3300025906 | Ga0207699_10534343 | Ga0207699_105343431 | 107 |
| 169 | 3300025906 | Ga0207699_11229410 | Ga0207699_112294101 | 107 |
| 170 | 3300025908 | Ga0207643_10445247 | Ga0207643_104452471 | 107 |
| 171 | 3300025910 | Ga0207684_10005647 | Ga0207684_100056478 | 107 |
| 172 | 3300025910 | Ga0207684_10120788 | Ga0207684_101207882 | 107 |
| 173 | 3300025910 | Ga0207684_10424779 | Ga0207684_104247792 | 107 |
| 174 | 3300025910 | Ga0207684_10661659 | Ga0207684_106616592 | 107 |
| 175 | 3300025912 | Ga0207707_10078990 | Ga0207707_100789903 | 107 |
| 176 | 3300025916 | Ga0207663_10074588 | Ga0207663_100745882 | 107 |
| 177 | 3300025917 | Ga0207660_10199454 | Ga0207660_101994542 | 107 |
| 178 | 3300025918 | Ga0207662_10060733 | Ga0207662_100607332 | 107 |
| 179 | 3300025920 | Ga0207649_10940184 | Ga0207649_109401842 | 107 |
| 180 | 3300025921 | Ga0207652_11298568 | Ga0207652_112985681 | 107 |
| 181 | 3300025922 | Ga0207646_10076124 | Ga0207646_100761242 | 107 |
| 182 | 3300025922 | Ga0207646_10086112 | Ga0207646_100861124 | 107 |
| 183 | 3300025922 | Ga0207646_10093594 | Ga0207646_100935942 | 107 |
| 184 | 3300025922 | Ga0207646_10898252 | Ga0207646_108982521 | 107 |
| 185 | 3300025922 | Ga0207646_10927232 | Ga0207646_109272321 | 107 |
| 186 | 3300025923 | Ga0207681_10001324 | Ga0207681_100013242 | 107 |
| 187 | 3300025923 | Ga0207681_10179690 | Ga0207681_101796902 | 107 |
| 188 | 3300025923 | Ga0207681_10604936 | Ga0207681_106049362 | 107 |
| 189 | 3300025923 | Ga0207681_11225780 | Ga0207681_112257801 | 107 |
| 190 | 3300025925 | Ga0207650_10050396 | Ga0207650_100503963 | 107 |
| 191 | 3300025926 | Ga0207659_10481532 | Ga0207659_104815322 | 107 |
| 192 | 3300025932 | Ga0207690_10170886 | Ga0207690_101708862 | 107 |
| 193 | 3300025934 | Ga0207686_10000003 | Ga0207686_10000003306 | 107 |
| 194 | 3300025934 | Ga0207686_10000335 | Ga0207686_1000033520 | 107 |
| 195 | 3300025935 | Ga0207709_10000017 | Ga0207709_10000017365 | 107 |
| 196 | 3300025935 | Ga0207709_10176343 | Ga0207709_101763432 | 107 |
| 197 | 3300025936 | Ga0207670_10280621 | Ga0207670_102806213 | 107 |
| 198 | 3300025936 | Ga0207670_10703644 | Ga0207670_107036442 | 107 |
| 199 | 3300025938 | Ga0207704_10570329 | Ga0207704_105703291 | 107 |
| 200 | 3300025939 | Ga0207665_10000003 | Ga0207665_10000003116 | 107 |
| 201 | 3300025939 | Ga0207665_10080583 | Ga0207665_100805832 | 107 |
| 202 | 3300025939 | Ga0207665_10118008 | Ga0207665_101180081 | 107 |
| 203 | 3300025939 | Ga0207665_10993769 | Ga0207665_109937692 | 107 |
| 204 | 3300025941 | Ga0207711_10018399 | Ga0207711_100183992 | 107 |
| 205 | 3300025942 | Ga0207689_10030284 | Ga0207689_100302843 | 107 |
| 206 | 3300025945 | Ga0207679_10009663 | Ga0207679_100096632 | 107 |
| 207 | 3300025949 | Ga0207667_11537253 | Ga0207667_115372531 | 107 |
| 208 | 3300025960 | Ga0207651_10522364 | Ga0207651_105223642 | 107 |
| 209 | 3300025961 | Ga0207712_10287189 | Ga0207712_102871892 | 107 |
| 210 | 3300025986 | Ga0207658_10774016 | Ga0207658_107740162 | 107 |
| 211 | 3300026023 | Ga0207677_10032732 | Ga0207677_100327323 | 107 |
| 212 | 3300026023 | Ga0207677_10646033 | Ga0207677_106460332 | 107 |
| 213 | 3300026035 | Ga0207703_10416793 | Ga0207703_104167932 | 107 |
| 214 | 3300026041 | Ga0207639_10159433 | Ga0207639_101594331 | 107 |
| 215 | 3300026075 | Ga0207708_11840640 | Ga0207708_118406402 | 107 |
| 216 | 3300026089 | Ga0207648_10145243 | Ga0207648_101452432 | 107 |
| 217 | 3300026089 | Ga0207648_11685435 | Ga0207648_116854351 | 107 |
| 218 | 3300026095 | Ga0207676_10024186 | Ga0207676_100241862 | 107 |
| 219 | 3300026095 | Ga0207676_10031720 | Ga0207676_100317203 | 107 |
| 220 | 3300026095 | Ga0207676_10111752 | Ga0207676_101117522 | 107 |
| 221 | 3300026095 | Ga0207676_10629126 | Ga0207676_106291262 | 107 |
| 222 | 3300026116 | Ga0207674_10000192 | Ga0207674_100001926 | 107 |
| 223 | 3300026118 | Ga0207675_100034497 | Ga0207675_1000344975 | 107 |
| 224 | 3300026118 | Ga0207675_101235140 | Ga0207675_1012351401 | 107 |
| 225 | 3300026118 | Ga0207675_101618641 | Ga0207675_1016186412 | 107 |
| 226 | 3300026121 | Ga0207683_10173765 | Ga0207683_101737653 | 107 |
| 227 | 3300027671 | Ga0209588_1029908 | Ga0209588_10299082 | 107 |
| 228 | 3300027876 | Ga0209974_10164392 | Ga0209974_101643922 | 107 |
| 229 | 3300028380 | Ga0268265_10953167 | Ga0268265_109531672 | 107 |
| 230 | 3300028380 | Ga0268265_10961850 | Ga0268265_109618502 | 107 |
| 231 | 3300028381 | Ga0268264_10084213 | Ga0268264_100842133 | 107 |
| 232 | 3300028381 | Ga0268264_10681044 | Ga0268264_106810441 | 107 |
| 233 | 3300031548 | Ga0307408_100204066 | Ga0307408_1002040661 | 107 |
| 234 | 3300031731 | Ga0307405_10058757 | Ga0307405_100587571 | 107 |
| 235 | 3300031824 | Ga0307413_10825829 | Ga0307413_108258291 | 107 |
| 236 | 3300031903 | Ga0307407_10454496 | Ga0307407_104544962 | 107 |
| 237 | 3300031911 | Ga0307412_10214778 | Ga0307412_102147783 | 107 |
| 238 | 3300032002 | Ga0307416_100036188 | Ga0307416_1000361885 | 107 |
| 239 | 3300032004 | Ga0307414_10386477 | Ga0307414_103864772 | 107 |
| 240 | 3300032005 | Ga0307411_11620945 | Ga0307411_116209451 | 107 |
| 241 | 3300032126 | Ga0307415_100068193 | Ga0307415_1000681934 | 107 |
| 242 | 3300037418 | Ga0395900_0657927 | Ga0395900_0657927_538_864 | 107 |
| 243 | 3300037466 | Ga0395898_1955849 | Ga0395898_1955849_95_421 | 107 |
| 244 | 3300042129 | Ga0450891_016697 | Ga0450891_016697_192_524 | 107 |
| 245 | 3300042144 | Ga0450889_038712 | Ga0450889_038712_95_427 | 107 |
| 246 | 3300042435 | Ga0439434_0202365 | Ga0439434_0202365_169_501 | 107 |
| 247 | 3300042461 | Ga0439460_0122605 | Ga0439460_0122605_193_525 | 107 |
| 248 | 3300044673 | Ga0453683_0260725 | Ga0453683_0260725_611_1003 | 107 |
| 249 | 3300045051 | Ga0451576_0657721 | Ga0451576_0657721_223_546 | 107 |
| 250 | 3300046512 | Ga0495610_0108681 | Ga0495610_0108681_226_549 | 107 |
| 251 | 3300046539 | Ga0495621_0000017 | Ga0495621_0000017_1693_2025 | 107 |
| 252 | 3300046615 | Ga0495656_0371300 | Ga0495656_0371300_374_697 | 107 |
| 253 | 3300048915 | Ga0496112_0746796 | Ga0496112_0746796_301_624 | 107 |
| 254 | 3300049513 | Ga0501290_050556 | Ga0501290_050556_261_587 | 107 |
| 255 | 3300049519 | Ga0501296_045932 | Ga0501296_045932_280_606 | 107 |
| 256 | 3300049520 | Ga0501297_001403 | Ga0501297_001403_1804_2130 | 107 |
| 257 | 3300049521 | Ga0501298_010233 | Ga0501298_010233_238_564 | 107 |
| 258 | 3300049522 | Ga0501299_121191 | Ga0501299_121191_263_589 | 107 |
| 259 | 3300049652 | Ga0501202_019820 | Ga0501202_019820_110_436 | 107 |
| 260 | 3300049660 | Ga0501216_012713 | Ga0501216_012713_917_1243 | 107 |
| 261 | 3300049661 | Ga0501217_009361 | Ga0501217_009361_226_552 | 107 |
| 262 | 3300049663 | Ga0501223_071580 | Ga0501223_071580_313_639 | 107 |
| 263 | 3300049666 | Ga0501228_061055 | Ga0501228_061055_14_340 | 107 |
| 264 | 3300049668 | Ga0501233_014306 | Ga0501233_014306_1271_1597 | 107 |
| 265 | 3300049669 | Ga0501235_117497 | Ga0501235_117497_192_518 | 107 |
| 266 | 3300049686 | Ga0501257_032424 | Ga0501257_032424_103_429 | 107 |
| 267 | 3300049689 | Ga0501260_017688 | Ga0501260_017688_98_424 | 107 |
| 268 | 3300049758 | Ga0501241_116725 | Ga0501241_116725_146_472 | 107 |
| 269 | 3300049775 | Ga0501279_049386 | Ga0501279_049386_88_414 | 107 |
| 270 | 3300049779 | Ga0501283_006675 | Ga0501283_006675_922_1248 | 107 |
| 271 | 3300050507 | nmdc:mga05p37_29784_c1 | nmdc:mga05p37_29784_c1_4152_4475 | 107 |
| 272 | 3300050507 | nmdc:mga05p37_592868_c1 | nmdc:mga05p37_592868_c1_387_713 | 107 |
| 273 | 3300050507 | nmdc:mga05p37_76505_c1 | nmdc:mga05p37_76505_c1_3704_4027 | 107 |
| 274 | 3300050507 | nmdc:mga05p37_95309_c1 | nmdc:mga05p37_95309_c1_236_565 | 107 |
| 275 | 3300050507 | nmdc:mga05p37_98068_c1 | nmdc:mga05p37_98068_c1_211_543 | 107 |
| 276 | 3300050510 | nmdc:mga06r32_1041724_c1 | nmdc:mga06r32_1041724_c1_106_594 | 107 |
| 277 | 3300050512 | nmdc:mga0n895_1850199_c1 | nmdc:mga0n895_1850199_c1_139_471 | 107 |
| 278 | 3300050515 | nmdc:mga0a205_198884_c1 | nmdc:mga0a205_198884_c1_938_1261 | 107 |
| 279 | 3300050515 | nmdc:mga0a205_403136_c1 | nmdc:mga0a205_403136_c1_840_1163 | 107 |
| 280 | 3300050515 | nmdc:mga0a205_81318_c1 | nmdc:mga0a205_81318_c1_560_883 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1usm-assembly1.cif.gz_A-2 | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9622 | 32 | 106 |
| 1uso-assembly1.cif.gz_A | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9549 | 34 | 106 |
| 2ebb-assembly1.cif.gz_A-2 | crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 | 0.9414 | 17 | 106 |
| 3jst-assembly2.cif.gz_B | crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis | 0.9214 | 17 | 106 |
| 3hxa-assembly1.cif.gz_D | crystal structure of dcoh1thr51ser | 0.9061 | 17 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WI93_1_93_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9515 | 16 | 106 | 3.30.1360.20 |
| 1usoB00 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9447 | 32 | 106 | 3.30.1360.20 |
| 2ebbA00 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9414 | 17 | 106 | 3.30.1360.20 |
| af_Q6MX13_31_126_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9386 | 19 | 106 | 3.30.1360.20 |
| af_O42658_1_95_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9338 | 34 | 106 | 3.30.1360.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832VBI8-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9841 | 34 | 107 |
GO:0006729
GO:0008124 |
| AF-A0A7C2TT88-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.984 | 26 | 107 |
GO:0006729
GO:0008124 |
| AF-A0A6V8DDE3-F1-model_v4 | deleted | 0.9832 | 22 | 107 |
|
| AF-A0A554JES3-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9826 | 20 | 106 |
GO:0006729
GO:0008124 |
| AF-A0A3A5VAR2-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9804 | 34 | 106 |
GO:0006729
GO:0008124 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar