F383844

General Info

Members Datasets Scaffolds Average Seq Length
280 168 280 108

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0260725|Ga0453683_0260725_611_1003
Length 130
Sequence MLAKRVFAITATNLSLSNIPEDEMSDLASRECIPCRGGVPPLKGEELTNLLTEVRGWEVVNEHHLKKVHKFANFREAQEFVNRVGDLAEEQGHHPDICFGWGRAEITIWTHKIDGLTESDFILAAKIDRL

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
139 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
149 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
150 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
151 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
155 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
156 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
157 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
158 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
159 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
160 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
161 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
162 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
163 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
164 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.36
Rhizosphere 99.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_11623092 3300005328 Unclassified 500
2 Ga0070690_100278715 3300005330 Bacteria 1192
3 Ga0070690_100514821 3300005330 Bacteria 897
4 Ga0070670_100033772 3300005331 Bacteria 4405
5 Ga0070670_100507217 3300005331 Bacteria 1073
6 Ga0068869_100107390 3300005334 Bacteria 2119
7 Ga0070666_10018695 3300005335 Bacteria 4462
8 Ga0070680_100124989 3300005336 Unclassified 2149
9 Ga0068868_100015354 3300005338 Bacteria 5663
10 Ga0070660_100455835 3300005339 Unclassified 1061
11 Ga0070689_100118679 3300005340 Bacteria 2111
12 Ga0070689_102009056 3300005340 Unclassified 529
13 Ga0070661_100072148 3300005344 Bacteria 2541
14 Ga0070692_10485391 3300005345 Bacteria 798
15 Ga0070692_10572745 3300005345 Unclassified 743
16 Ga0070669_100007623 3300005353 Bacteria 7736
17 Ga0070669_100194836 3300005353 Unclassified 1591
18 Ga0070675_100170707 3300005354 Bacteria 1875
19 Ga0070671_100012257 3300005355 Bacteria 6897
20 Ga0070674_100194176 3300005356 Bacteria 1563
21 Ga0070673_100475117 3300005364 Bacteria 1127
22 Ga0070688_100078158 3300005365 Bacteria 2134
23 Ga0070659_100006617 3300005366 Bacteria 8374
24 Ga0070667_100015111 3300005367 Bacteria 6376
25 Ga0070709_10150280 3300005434 Bacteria 1609
26 Ga0070709_10775080 3300005434 Bacteria 751
27 Ga0070711_100058448 3300005439 Unclassified 2674
28 Ga0070705_100426701 3300005440 Unclassified 989
29 Ga0070705_101183046 3300005440 Bacteria 629
30 Ga0070694_100000381 3300005444 Bacteria 23963
31 Ga0070694_100372511 3300005444 Unclassified 1112
32 Ga0070708_100000406 3300005445 Bacteria 32362
33 Ga0070708_100022467 3300005445 Bacteria 5351
34 Ga0070708_100125544 3300005445 Bacteria 2371
35 Ga0070708_100224106 3300005445 Unclassified 1764
36 Ga0070678_100630967 3300005456 Unclassified 959
37 Ga0070662_100178474 3300005457 Unclassified 1673
38 Ga0070681_10004724 3300005458 Bacteria 13043
39 Ga0068867_101721903 3300005459 Unclassified 588
40 Ga0070706_100001194 3300005467 Bacteria 27840
41 Ga0070706_100013663 3300005467 Bacteria 7506
42 Ga0070706_100058559 3300005467 Unclassified 3555
43 Ga0070706_100366623 3300005467 Unclassified 1342
44 Ga0070706_100696944 3300005467 Bacteria 942
45 Ga0070707_100045129 3300005468 Bacteria 4218
46 Ga0070707_100119021 3300005468 Bacteria 2564
47 Ga0070707_100139202 3300005468 Bacteria 2362
48 Ga0070707_100825927 3300005468 Bacteria 891
49 Ga0070707_101271363 3300005468 Bacteria 702
50 Ga0070698_100002160 3300005471 Bacteria 21832
51 Ga0070698_100227432 3300005471 Bacteria 1799
52 Ga0070698_102093056 3300005471 Unclassified 519
53 Ga0070699_100000218 3300005518 Bacteria 57007
54 Ga0070699_100017809 3300005518 Bacteria 6100
55 Ga0070699_100453745 3300005518 Bacteria 1162
56 Ga0070699_100454331 3300005518 Bacteria 1162
57 Ga0070699_100718396 3300005518 Unclassified 913
58 Ga0070699_100834267 3300005518 Unclassified 844
59 Ga0070699_101318129 3300005518 Unclassified 662
60 Ga0070679_100811665 3300005530 Unclassified 879
61 Ga0070684_100557277 3300005535 Unclassified 1064
62 Ga0070684_101373900 3300005535 Unclassified 665
63 Ga0070697_100000042 3300005536 Bacteria 94533
64 Ga0070697_100002583 3300005536 Bacteria 13925
65 Ga0070697_100024206 3300005536 Unclassified 4833
66 Ga0070697_101644906 3300005536 Bacteria 574
67 Ga0070697_101718719 3300005536 Unclassified 561
68 Ga0068853_100182970 3300005539 Bacteria 1901
69 Ga0068853_100334822 3300005539 Bacteria 1405
70 Ga0070686_100040459 3300005544 Bacteria 2908
71 Ga0070695_100091712 3300005545 Bacteria 2030
72 Ga0070695_100129552 3300005545 Unclassified 1737
73 Ga0070695_100140170 3300005545 Unclassified 1676
74 Ga0070695_100183209 3300005545 Bacteria 1485
75 Ga0070695_101354007 3300005545 Unclassified 589
76 Ga0070696_100020075 3300005546 Bacteria 4531
77 Ga0070696_100487788 3300005546 Bacteria 978
78 Ga0070696_101508441 3300005546 Bacteria 575
79 Ga0070693_100718268 3300005547 Unclassified 733
80 Ga0070693_101529470 3300005547 Bacteria 522
81 Ga0070704_100068744 3300005549 Bacteria 2564
82 Ga0070704_100204587 3300005549 Bacteria 1596
83 Ga0068855_100319083 3300005563 Bacteria 1718
84 Ga0070664_100144465 3300005564 Bacteria 2097
85 Ga0070664_100144973 3300005564 Bacteria 2093
86 Ga0068857_100007367 3300005577 Bacteria 9471
87 Ga0068854_101345000 3300005578 Bacteria 644
88 Ga0070702_100185399 3300005615 Unclassified 1365
89 Ga0070702_100197138 3300005615 Bacteria 1330
90 Ga0068859_100013133 3300005617 Bacteria 8322
91 Ga0068859_100685143 3300005617 Unclassified 1116
92 Ga0068859_101302330 3300005617 Unclassified 801
93 Ga0068859_102073182 3300005617 Unclassified 628
94 Ga0068864_100003314 3300005618 Bacteria 13307
95 Ga0068864_100009753 3300005618 Bacteria 7921
96 Ga0068864_100077190 3300005618 Bacteria 2912
97 Ga0068866_10003551 3300005718 Bacteria 6385
98 Ga0068866_10363784 3300005718 Unclassified 923
99 Ga0068861_100032952 3300005719 Bacteria 3819
100 Ga0068861_100216491 3300005719 Unclassified 1616
101 Ga0068870_10449703 3300005840 Unclassified 849
102 Ga0068863_101273062 3300005841 Unclassified 742
103 Ga0068858_100046429 3300005842 Bacteria 4026
104 Ga0068860_100023828 3300005843 Bacteria 5918
105 Ga0068862_100118792 3300005844 Bacteria 2328
106 Ga0068862_100715266 3300005844 Unclassified 971
107 Ga0068862_101116529 3300005844 Unclassified 784
108 Ga0070716_100000008 3300006173 Bacteria 182956
109 Ga0070716_100072236 3300006173 Unclassified 2031
110 Ga0070716_100266454 3300006173 Unclassified 1175
111 Ga0070716_101328058 3300006173 Bacteria 582
112 Ga0097621_100042465 3300006237 Bacteria 3663
113 Ga0097621_101372500 3300006237 Bacteria 669
114 Ga0068871_100022891 3300006358 Bacteria 4823
115 Ga0075433_10064792 3300006852 Unclassified 3204
116 Ga0075433_10171991 3300006852 Bacteria 1928
117 Ga0075433_10409848 3300006852 Bacteria 1196
118 Ga0075433_11290495 3300006852 Unclassified 633
119 Ga0075434_100009263 3300006871 Bacteria 9176
120 Ga0075434_101318730 3300006871 Bacteria 732
121 Ga0068865_100853175 3300006881 Bacteria 789
122 Ga0097620_100013134 3300006931 Bacteria 8322
123 Ga0097620_100685272 3300006931 Unclassified 1116
124 Ga0097620_101302356 3300006931 Unclassified 801
125 Ga0097620_102073807 3300006931 Unclassified 628
126 Ga0099794_10695368 3300007265 Unclassified 541
127 Ga0105240_11452260 3300009093 Unclassified 720
128 Ga0105245_10141794 3300009098 Bacteria 2264
129 Ga0114129_10011789 3300009147 Bacteria 12438
130 Ga0114129_10052986 3300009147 Bacteria 5692
131 Ga0114129_10077667 3300009147 Bacteria 4618
132 Ga0114129_11422308 3300009147 Unclassified 855
133 Ga0105243_10000037 3300009148 Bacteria 175237
134 Ga0105243_12105661 3300009148 Unclassified 600
135 Ga0105241_10041539 3300009174 Unclassified 3475
136 Ga0105241_10831630 3300009174 Unclassified 853
137 Ga0105242_10000039 3300009176 Bacteria 88325
138 Ga0105242_10049263 3300009176 Bacteria 3427
139 Ga0105242_10130594 3300009176 Bacteria 2168
140 Ga0105242_10232325 3300009176 Bacteria 1653
141 Ga0105249_10339206 3300009553 Unclassified 1519
142 Ga0099796_10475739 3300010159 Unclassified 558
143 Ga0105246_10404349 3300011119 Bacteria 1135
144 Ga0157373_10584586 3300013100 Viruses 812
145 Ga0157374_10009145 3300013296 Bacteria 8492
146 Ga0157378_10036917 3300013297 Unclassified 4326
147 Ga0157378_10167940 3300013297 Bacteria 2056
148 Ga0157378_10269597 3300013297 Unclassified 1637
149 Ga0157378_12210755 3300013297 Unclassified 601
150 Ga0163162_10002710 3300013306 Bacteria 16806
151 Ga0163162_10004905 3300013306 Bacteria 12891
152 Ga0163162_10011664 3300013306 Bacteria 8568
153 Ga0163162_10153413 3300013306 Bacteria 2422
154 Ga0157375_10157919 3300013308 Bacteria 2408
155 Ga0157375_12607593 3300013308 Unclassified 604
156 Ga0157375_13147094 3300013308 Unclassified 550
157 Ga0163163_10002315 3300014325 Bacteria 16085
158 Ga0163163_10007175 3300014325 Bacteria 9808
159 Ga0157380_12386900 3300014326 Bacteria 594
160 Ga0157377_10131472 3300014745 Bacteria 1529
161 Ga0157376_10123952 3300014969 Bacteria 2294
162 Ga0163161_10172376 3300017792 Unclassified 1655
163 Ga0207653_10016414 3300025885 Bacteria 2325
164 Ga0207692_10467176 3300025898 Bacteria 796
165 Ga0207642_10022693 3300025899 Bacteria 2494
166 Ga0207680_10539765 3300025903 Bacteria 832
167 Ga0207647_10389247 3300025904 Unclassified 786
168 Ga0207699_10534343 3300025906 Unclassified 849
169 Ga0207699_11229410 3300025906 Bacteria 555
170 Ga0207643_10445247 3300025908 Unclassified 824
171 Ga0207684_10005647 3300025910 Bacteria 11491
172 Ga0207684_10120788 3300025910 Bacteria 2246
173 Ga0207684_10424779 3300025910 Unclassified 1142
174 Ga0207684_10661659 3300025910 Bacteria 889
175 Ga0207707_10078990 3300025912 Unclassified 2873
176 Ga0207663_10074588 3300025916 Unclassified 2199
177 Ga0207660_10199454 3300025917 Unclassified 1562
178 Ga0207662_10060733 3300025918 Bacteria 2268
179 Ga0207649_10940184 3300025920 Unclassified 679
180 Ga0207652_11298568 3300025921 Unclassified 630
181 Ga0207646_10076124 3300025922 Bacteria 2998
182 Ga0207646_10086112 3300025922 Bacteria 2811
183 Ga0207646_10093594 3300025922 Bacteria 2691
184 Ga0207646_10898252 3300025922 Unclassified 786
185 Ga0207646_10927232 3300025922 Bacteria 772
186 Ga0207681_10001324 3300025923 Bacteria 15988
187 Ga0207681_10179690 3300025923 Unclassified 1611
188 Ga0207681_10604936 3300025923 Unclassified 906
189 Ga0207681_11225780 3300025923 Unclassified 630
190 Ga0207650_10050396 3300025925 Unclassified 3078
191 Ga0207659_10481532 3300025926 Unclassified 1048
192 Ga0207690_10170886 3300025932 Unclassified 1628
193 Ga0207686_10000003 3300025934 Bacteria 376934
194 Ga0207686_10000335 3300025934 Bacteria 33878
195 Ga0207709_10000017 3300025935 Bacteria 470753
196 Ga0207709_10176343 3300025935 Unclassified 1505
197 Ga0207670_10280621 3300025936 Bacteria 1298
198 Ga0207670_10703644 3300025936 Bacteria 836
199 Ga0207704_10570329 3300025938 Bacteria 922
200 Ga0207665_10000003 3300025939 Bacteria 220666
201 Ga0207665_10080583 3300025939 Bacteria 2240
202 Ga0207665_10118008 3300025939 Bacteria 1871
203 Ga0207665_10993769 3300025939 Bacteria 667
204 Ga0207711_10018399 3300025941 Bacteria 5807
205 Ga0207689_10030284 3300025942 Bacteria 4511
206 Ga0207679_10009663 3300025945 Bacteria 6183
207 Ga0207667_11537253 3300025949 Unclassified 636
208 Ga0207651_10522364 3300025960 Bacteria 1029
209 Ga0207712_10287189 3300025961 Unclassified 1345
210 Ga0207658_10774016 3300025986 Bacteria 870
211 Ga0207677_10032732 3300026023 Bacteria 3345
212 Ga0207677_10646033 3300026023 Unclassified 933
213 Ga0207703_10416793 3300026035 Bacteria 1249
214 Ga0207639_10159433 3300026041 Bacteria 1900
215 Ga0207708_11840640 3300026075 Unclassified 531
216 Ga0207648_10145243 3300026089 Bacteria 2092
217 Ga0207648_11685435 3300026089 Unclassified 595
218 Ga0207676_10024186 3300026095 Bacteria 4493
219 Ga0207676_10031720 3300026095 Bacteria 3975
220 Ga0207676_10111752 3300026095 Bacteria 2287
221 Ga0207676_10629126 3300026095 Bacteria 1034
222 Ga0207674_10000192 3300026116 Bacteria 75255
223 Ga0207675_100034497 3300026118 Bacteria 4718
224 Ga0207675_101235140 3300026118 Unclassified 768
225 Ga0207675_101618641 3300026118 Unclassified 668
226 Ga0207683_10173765 3300026121 Bacteria 1952
227 Ga0209588_1029908 3300027671 Bacteria 1739
228 Ga0209974_10164392 3300027876 Unclassified 806
229 Ga0268265_10953167 3300028380 Unclassified 845
230 Ga0268265_10961850 3300028380 Unclassified 842
231 Ga0268264_10084213 3300028381 Bacteria 2726
232 Ga0268264_10681044 3300028381 Unclassified 1020
233 Ga0307408_100204066 3300031548 Unclassified 1602
234 Ga0307405_10058757 3300031731 Bacteria 2421
235 Ga0307413_10825829 3300031824 Unclassified 781
236 Ga0307407_10454496 3300031903 Unclassified 930
237 Ga0307412_10214778 3300031911 Unclassified 1470
238 Ga0307416_100036188 3300032002 Unclassified 3782
239 Ga0307414_10386477 3300032004 Bacteria 1212
240 Ga0307411_11620945 3300032005 Unclassified 597
241 Ga0307415_100068193 3300032126 Bacteria 2488
242 Ga0395900_0657927 3300037418 Bacteria 984
243 Ga0395898_1955849 3300037466 Unclassified 506
244 Ga0450891_016697 3300042129 Bacteria 702
245 Ga0450889_038712 3300042144 Bacteria 572
246 Ga0439434_0202365 3300042435 Bacteria 670
247 Ga0439460_0122605 3300042461 Bacteria 851
248 Ga0453683_0260725 3300044673 Unclassified 1106
249 Ga0451576_0657721 3300045051 Bacteria 1101
250 Ga0495610_0108681 3300046512 Bacteria 1231
251 Ga0495621_0000017 3300046539 Bacteria 32151
252 Ga0495656_0371300 3300046615 Unclassified 744
253 Ga0496112_0746796 3300048915 Unclassified 905
254 Ga0501290_050556 3300049513 Unclassified 646
255 Ga0501296_045932 3300049519 Unclassified 628
256 Ga0501297_001403 3300049520 Bacteria 2206
257 Ga0501298_010233 3300049521 Unclassified 1610
258 Ga0501299_121191 3300049522 Unclassified 630
259 Ga0501202_019820 3300049652 Unclassified 1332
260 Ga0501216_012713 3300049660 Unclassified 1386
261 Ga0501217_009361 3300049661 Bacteria 2130
262 Ga0501223_071580 3300049663 Unclassified 685
263 Ga0501228_061055 3300049666 Unclassified 533
264 Ga0501233_014306 3300049668 Bacteria 1620
265 Ga0501235_117497 3300049669 Unclassified 663
266 Ga0501257_032424 3300049686 Unclassified 1264
267 Ga0501260_017688 3300049689 Unclassified 756
268 Ga0501241_116725 3300049758 Bacteria 589
269 Ga0501279_049386 3300049775 Unclassified 664
270 Ga0501283_006675 3300049779 Unclassified 1623
271 nmdc:mga05p37_29784_c1 3300050507 Bacteria 6661
272 nmdc:mga05p37_592868_c1 3300050507 Bacteria 1252
273 nmdc:mga05p37_76505_c1 3300050507 Unclassified 4120
274 nmdc:mga05p37_95309_c1 3300050507 Unclassified 3666
275 nmdc:mga05p37_98068_c1 3300050507 Bacteria 3610
276 nmdc:mga06r32_1041724_c1 3300050510 Unclassified 769
277 nmdc:mga0n895_1850199_c1 3300050512 Unclassified 563
278 nmdc:mga0a205_198884_c1 3300050515 Bacteria 1895
279 nmdc:mga0a205_403136_c1 3300050515 Bacteria 1231
280 nmdc:mga0a205_81318_c1 3300050515 Bacteria 3130

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_11623092 Ga0070676_116230921 107
2 3300005330 Ga0070690_100278715 Ga0070690_1002787152 107
3 3300005330 Ga0070690_100514821 Ga0070690_1005148212 107
4 3300005331 Ga0070670_100033772 Ga0070670_1000337724 107
5 3300005331 Ga0070670_100507217 Ga0070670_1005072172 107
6 3300005334 Ga0068869_100107390 Ga0068869_1001073903 107
7 3300005335 Ga0070666_10018695 Ga0070666_100186955 107
8 3300005336 Ga0070680_100124989 Ga0070680_1001249892 107
9 3300005338 Ga0068868_100015354 Ga0068868_1000153545 107
10 3300005339 Ga0070660_100455835 Ga0070660_1004558352 107
11 3300005340 Ga0070689_100118679 Ga0070689_1001186793 107
12 3300005340 Ga0070689_102009056 Ga0070689_1020090561 107
13 3300005344 Ga0070661_100072148 Ga0070661_1000721481 107
14 3300005345 Ga0070692_10485391 Ga0070692_104853912 107
15 3300005345 Ga0070692_10572745 Ga0070692_105727452 107
16 3300005353 Ga0070669_100007623 Ga0070669_1000076233 107
17 3300005353 Ga0070669_100194836 Ga0070669_1001948362 107
18 3300005354 Ga0070675_100170707 Ga0070675_1001707073 107
19 3300005355 Ga0070671_100012257 Ga0070671_1000122571 107
20 3300005356 Ga0070674_100194176 Ga0070674_1001941761 107
21 3300005364 Ga0070673_100475117 Ga0070673_1004751172 107
22 3300005365 Ga0070688_100078158 Ga0070688_1000781582 107
23 3300005366 Ga0070659_100006617 Ga0070659_1000066175 107
24 3300005367 Ga0070667_100015111 Ga0070667_1000151112 107
25 3300005434 Ga0070709_10150280 Ga0070709_101502802 107
26 3300005434 Ga0070709_10775080 Ga0070709_107750801 107
27 3300005439 Ga0070711_100058448 Ga0070711_1000584482 107
28 3300005440 Ga0070705_100426701 Ga0070705_1004267012 107
29 3300005440 Ga0070705_101183046 Ga0070705_1011830461 107
30 3300005444 Ga0070694_100000381 Ga0070694_1000003817 107
31 3300005444 Ga0070694_100372511 Ga0070694_1003725112 107
32 3300005445 Ga0070708_100000406 Ga0070708_1000004064 107
33 3300005445 Ga0070708_100022467 Ga0070708_1000224674 107
34 3300005445 Ga0070708_100125544 Ga0070708_1001255442 107
35 3300005445 Ga0070708_100224106 Ga0070708_1002241062 107
36 3300005456 Ga0070678_100630967 Ga0070678_1006309671 107
37 3300005457 Ga0070662_100178474 Ga0070662_1001784743 107
38 3300005458 Ga0070681_10004724 Ga0070681_100047249 107
39 3300005459 Ga0068867_101721903 Ga0068867_1017219031 107
40 3300005467 Ga0070706_100001194 Ga0070706_1000011944 107
41 3300005467 Ga0070706_100013663 Ga0070706_1000136638 107
42 3300005467 Ga0070706_100058559 Ga0070706_1000585593 107
43 3300005467 Ga0070706_100366623 Ga0070706_1003666231 107
44 3300005467 Ga0070706_100696944 Ga0070706_1006969442 107
45 3300005468 Ga0070707_100045129 Ga0070707_1000451294 107
46 3300005468 Ga0070707_100119021 Ga0070707_1001190212 107
47 3300005468 Ga0070707_100139202 Ga0070707_1001392023 107
48 3300005468 Ga0070707_100825927 Ga0070707_1008259272 107
49 3300005468 Ga0070707_101271363 Ga0070707_1012713631 107
50 3300005471 Ga0070698_100002160 Ga0070698_1000021604 107
51 3300005471 Ga0070698_100227432 Ga0070698_1002274321 107
52 3300005471 Ga0070698_102093056 Ga0070698_1020930561 107
53 3300005518 Ga0070699_100000218 Ga0070699_10000021834 107
54 3300005518 Ga0070699_100017809 Ga0070699_1000178096 107
55 3300005518 Ga0070699_100453745 Ga0070699_1004537451 107
56 3300005518 Ga0070699_100454331 Ga0070699_1004543312 107
57 3300005518 Ga0070699_100718396 Ga0070699_1007183961 107
58 3300005518 Ga0070699_100834267 Ga0070699_1008342672 107
59 3300005518 Ga0070699_101318129 Ga0070699_1013181291 107
60 3300005530 Ga0070679_100811665 Ga0070679_1008116651 107
61 3300005535 Ga0070684_100557277 Ga0070684_1005572771 107
62 3300005535 Ga0070684_101373900 Ga0070684_1013739001 107
63 3300005536 Ga0070697_100000042 Ga0070697_10000004212 107
64 3300005536 Ga0070697_100002583 Ga0070697_1000025836 107
65 3300005536 Ga0070697_100024206 Ga0070697_1000242065 107
66 3300005536 Ga0070697_101644906 Ga0070697_1016449062 107
67 3300005536 Ga0070697_101718719 Ga0070697_1017187192 107
68 3300005539 Ga0068853_100182970 Ga0068853_1001829701 107
69 3300005539 Ga0068853_100334822 Ga0068853_1003348222 107
70 3300005544 Ga0070686_100040459 Ga0070686_1000404595 107
71 3300005545 Ga0070695_100091712 Ga0070695_1000917123 107
72 3300005545 Ga0070695_100129552 Ga0070695_1001295522 107
73 3300005545 Ga0070695_100140170 Ga0070695_1001401701 107
74 3300005545 Ga0070695_100183209 Ga0070695_1001832092 107
75 3300005545 Ga0070695_101354007 Ga0070695_1013540071 107
76 3300005546 Ga0070696_100020075 Ga0070696_1000200752 107
77 3300005546 Ga0070696_100487788 Ga0070696_1004877882 107
78 3300005546 Ga0070696_101508441 Ga0070696_1015084411 107
79 3300005547 Ga0070693_100718268 Ga0070693_1007182681 107
80 3300005547 Ga0070693_101529470 Ga0070693_1015294701 107
81 3300005549 Ga0070704_100068744 Ga0070704_1000687444 107
82 3300005549 Ga0070704_100204587 Ga0070704_1002045872 107
83 3300005563 Ga0068855_100319083 Ga0068855_1003190832 107
84 3300005564 Ga0070664_100144465 Ga0070664_1001444652 107
85 3300005564 Ga0070664_100144973 Ga0070664_1001449734 107
86 3300005577 Ga0068857_100007367 Ga0068857_1000073677 107
87 3300005578 Ga0068854_101345000 Ga0068854_1013450002 107
88 3300005615 Ga0070702_100185399 Ga0070702_1001853992 107
89 3300005615 Ga0070702_100197138 Ga0070702_1001971382 107
90 3300005617 Ga0068859_100013133 Ga0068859_1000131335 107
91 3300005617 Ga0068859_100685143 Ga0068859_1006851432 107
92 3300005617 Ga0068859_101302330 Ga0068859_1013023302 107
93 3300005617 Ga0068859_102073182 Ga0068859_1020731822 107
94 3300005618 Ga0068864_100003314 Ga0068864_10000331411 107
95 3300005618 Ga0068864_100009753 Ga0068864_1000097535 107
96 3300005618 Ga0068864_100077190 Ga0068864_1000771903 107
97 3300005718 Ga0068866_10003551 Ga0068866_100035512 107
98 3300005718 Ga0068866_10363784 Ga0068866_103637841 107
99 3300005719 Ga0068861_100032952 Ga0068861_1000329524 107
100 3300005719 Ga0068861_100216491 Ga0068861_1002164911 107
101 3300005840 Ga0068870_10449703 Ga0068870_104497031 107
102 3300005841 Ga0068863_101273062 Ga0068863_1012730622 107
103 3300005842 Ga0068858_100046429 Ga0068858_1000464292 107
104 3300005843 Ga0068860_100023828 Ga0068860_1000238286 107
105 3300005844 Ga0068862_100118792 Ga0068862_1001187923 107
106 3300005844 Ga0068862_100715266 Ga0068862_1007152663 107
107 3300005844 Ga0068862_101116529 Ga0068862_1011165291 107
108 3300006173 Ga0070716_100000008 Ga0070716_1000000082 107
109 3300006173 Ga0070716_100072236 Ga0070716_1000722362 107
110 3300006173 Ga0070716_100266454 Ga0070716_1002664541 107
111 3300006173 Ga0070716_101328058 Ga0070716_1013280581 107
112 3300006237 Ga0097621_100042465 Ga0097621_1000424653 107
113 3300006237 Ga0097621_101372500 Ga0097621_1013725002 107
114 3300006358 Ga0068871_100022891 Ga0068871_1000228914 107
115 3300006852 Ga0075433_10064792 Ga0075433_100647923 107
116 3300006852 Ga0075433_10171991 Ga0075433_101719912 107
117 3300006852 Ga0075433_10409848 Ga0075433_104098482 107
118 3300006852 Ga0075433_11290495 Ga0075433_112904952 107
119 3300006871 Ga0075434_100009263 Ga0075434_1000092634 107
120 3300006871 Ga0075434_101318730 Ga0075434_1013187302 107
121 3300006881 Ga0068865_100853175 Ga0068865_1008531752 107
122 3300006931 Ga0097620_100013134 Ga0097620_1000131345 107
123 3300006931 Ga0097620_100685272 Ga0097620_1006852722 107
124 3300006931 Ga0097620_101302356 Ga0097620_1013023562 107
125 3300006931 Ga0097620_102073807 Ga0097620_1020738072 107
126 3300007265 Ga0099794_10695368 Ga0099794_106953681 107
127 3300009093 Ga0105240_11452260 Ga0105240_114522601 107
128 3300009098 Ga0105245_10141794 Ga0105245_101417942 107
129 3300009147 Ga0114129_10011789 Ga0114129_100117897 107
130 3300009147 Ga0114129_10052986 Ga0114129_100529861 107
131 3300009147 Ga0114129_10077667 Ga0114129_100776677 107
132 3300009147 Ga0114129_11422308 Ga0114129_114223082 107
133 3300009148 Ga0105243_10000037 Ga0105243_10000037120 107
134 3300009148 Ga0105243_12105661 Ga0105243_121056612 107
135 3300009174 Ga0105241_10041539 Ga0105241_100415393 107
136 3300009174 Ga0105241_10831630 Ga0105241_108316302 107
137 3300009176 Ga0105242_10000039 Ga0105242_1000003932 107
138 3300009176 Ga0105242_10049263 Ga0105242_100492635 107
139 3300009176 Ga0105242_10130594 Ga0105242_101305941 107
140 3300009176 Ga0105242_10232325 Ga0105242_102323251 107
141 3300009553 Ga0105249_10339206 Ga0105249_103392062 107
142 3300010159 Ga0099796_10475739 Ga0099796_104757391 107
143 3300011119 Ga0105246_10404349 Ga0105246_104043491 107
144 3300013100 Ga0157373_10584586 Ga0157373_105845861 107
145 3300013296 Ga0157374_10009145 Ga0157374_100091455 107
146 3300013297 Ga0157378_10036917 Ga0157378_100369175 107
147 3300013297 Ga0157378_10167940 Ga0157378_101679403 107
148 3300013297 Ga0157378_10269597 Ga0157378_102695972 107
149 3300013297 Ga0157378_12210755 Ga0157378_122107551 107
150 3300013306 Ga0163162_10002710 Ga0163162_100027109 107
151 3300013306 Ga0163162_10004905 Ga0163162_1000490512 107
152 3300013306 Ga0163162_10011664 Ga0163162_100116645 107
153 3300013306 Ga0163162_10153413 Ga0163162_101534133 107
154 3300013308 Ga0157375_10157919 Ga0157375_101579192 107
155 3300013308 Ga0157375_12607593 Ga0157375_126075931 107
156 3300013308 Ga0157375_13147094 Ga0157375_131470942 107
157 3300014325 Ga0163163_10002315 Ga0163163_100023156 107
158 3300014325 Ga0163163_10007175 Ga0163163_100071754 107
159 3300014326 Ga0157380_12386900 Ga0157380_123869001 107
160 3300014745 Ga0157377_10131472 Ga0157377_101314721 107
161 3300014969 Ga0157376_10123952 Ga0157376_101239522 107
162 3300017792 Ga0163161_10172376 Ga0163161_101723761 107
163 3300025885 Ga0207653_10016414 Ga0207653_100164142 107
164 3300025898 Ga0207692_10467176 Ga0207692_104671762 107
165 3300025899 Ga0207642_10022693 Ga0207642_100226933 107
166 3300025903 Ga0207680_10539765 Ga0207680_105397652 107
167 3300025904 Ga0207647_10389247 Ga0207647_103892472 107
168 3300025906 Ga0207699_10534343 Ga0207699_105343431 107
169 3300025906 Ga0207699_11229410 Ga0207699_112294101 107
170 3300025908 Ga0207643_10445247 Ga0207643_104452471 107
171 3300025910 Ga0207684_10005647 Ga0207684_100056478 107
172 3300025910 Ga0207684_10120788 Ga0207684_101207882 107
173 3300025910 Ga0207684_10424779 Ga0207684_104247792 107
174 3300025910 Ga0207684_10661659 Ga0207684_106616592 107
175 3300025912 Ga0207707_10078990 Ga0207707_100789903 107
176 3300025916 Ga0207663_10074588 Ga0207663_100745882 107
177 3300025917 Ga0207660_10199454 Ga0207660_101994542 107
178 3300025918 Ga0207662_10060733 Ga0207662_100607332 107
179 3300025920 Ga0207649_10940184 Ga0207649_109401842 107
180 3300025921 Ga0207652_11298568 Ga0207652_112985681 107
181 3300025922 Ga0207646_10076124 Ga0207646_100761242 107
182 3300025922 Ga0207646_10086112 Ga0207646_100861124 107
183 3300025922 Ga0207646_10093594 Ga0207646_100935942 107
184 3300025922 Ga0207646_10898252 Ga0207646_108982521 107
185 3300025922 Ga0207646_10927232 Ga0207646_109272321 107
186 3300025923 Ga0207681_10001324 Ga0207681_100013242 107
187 3300025923 Ga0207681_10179690 Ga0207681_101796902 107
188 3300025923 Ga0207681_10604936 Ga0207681_106049362 107
189 3300025923 Ga0207681_11225780 Ga0207681_112257801 107
190 3300025925 Ga0207650_10050396 Ga0207650_100503963 107
191 3300025926 Ga0207659_10481532 Ga0207659_104815322 107
192 3300025932 Ga0207690_10170886 Ga0207690_101708862 107
193 3300025934 Ga0207686_10000003 Ga0207686_10000003306 107
194 3300025934 Ga0207686_10000335 Ga0207686_1000033520 107
195 3300025935 Ga0207709_10000017 Ga0207709_10000017365 107
196 3300025935 Ga0207709_10176343 Ga0207709_101763432 107
197 3300025936 Ga0207670_10280621 Ga0207670_102806213 107
198 3300025936 Ga0207670_10703644 Ga0207670_107036442 107
199 3300025938 Ga0207704_10570329 Ga0207704_105703291 107
200 3300025939 Ga0207665_10000003 Ga0207665_10000003116 107
201 3300025939 Ga0207665_10080583 Ga0207665_100805832 107
202 3300025939 Ga0207665_10118008 Ga0207665_101180081 107
203 3300025939 Ga0207665_10993769 Ga0207665_109937692 107
204 3300025941 Ga0207711_10018399 Ga0207711_100183992 107
205 3300025942 Ga0207689_10030284 Ga0207689_100302843 107
206 3300025945 Ga0207679_10009663 Ga0207679_100096632 107
207 3300025949 Ga0207667_11537253 Ga0207667_115372531 107
208 3300025960 Ga0207651_10522364 Ga0207651_105223642 107
209 3300025961 Ga0207712_10287189 Ga0207712_102871892 107
210 3300025986 Ga0207658_10774016 Ga0207658_107740162 107
211 3300026023 Ga0207677_10032732 Ga0207677_100327323 107
212 3300026023 Ga0207677_10646033 Ga0207677_106460332 107
213 3300026035 Ga0207703_10416793 Ga0207703_104167932 107
214 3300026041 Ga0207639_10159433 Ga0207639_101594331 107
215 3300026075 Ga0207708_11840640 Ga0207708_118406402 107
216 3300026089 Ga0207648_10145243 Ga0207648_101452432 107
217 3300026089 Ga0207648_11685435 Ga0207648_116854351 107
218 3300026095 Ga0207676_10024186 Ga0207676_100241862 107
219 3300026095 Ga0207676_10031720 Ga0207676_100317203 107
220 3300026095 Ga0207676_10111752 Ga0207676_101117522 107
221 3300026095 Ga0207676_10629126 Ga0207676_106291262 107
222 3300026116 Ga0207674_10000192 Ga0207674_100001926 107
223 3300026118 Ga0207675_100034497 Ga0207675_1000344975 107
224 3300026118 Ga0207675_101235140 Ga0207675_1012351401 107
225 3300026118 Ga0207675_101618641 Ga0207675_1016186412 107
226 3300026121 Ga0207683_10173765 Ga0207683_101737653 107
227 3300027671 Ga0209588_1029908 Ga0209588_10299082 107
228 3300027876 Ga0209974_10164392 Ga0209974_101643922 107
229 3300028380 Ga0268265_10953167 Ga0268265_109531672 107
230 3300028380 Ga0268265_10961850 Ga0268265_109618502 107
231 3300028381 Ga0268264_10084213 Ga0268264_100842133 107
232 3300028381 Ga0268264_10681044 Ga0268264_106810441 107
233 3300031548 Ga0307408_100204066 Ga0307408_1002040661 107
234 3300031731 Ga0307405_10058757 Ga0307405_100587571 107
235 3300031824 Ga0307413_10825829 Ga0307413_108258291 107
236 3300031903 Ga0307407_10454496 Ga0307407_104544962 107
237 3300031911 Ga0307412_10214778 Ga0307412_102147783 107
238 3300032002 Ga0307416_100036188 Ga0307416_1000361885 107
239 3300032004 Ga0307414_10386477 Ga0307414_103864772 107
240 3300032005 Ga0307411_11620945 Ga0307411_116209451 107
241 3300032126 Ga0307415_100068193 Ga0307415_1000681934 107
242 3300037418 Ga0395900_0657927 Ga0395900_0657927_538_864 107
243 3300037466 Ga0395898_1955849 Ga0395898_1955849_95_421 107
244 3300042129 Ga0450891_016697 Ga0450891_016697_192_524 107
245 3300042144 Ga0450889_038712 Ga0450889_038712_95_427 107
246 3300042435 Ga0439434_0202365 Ga0439434_0202365_169_501 107
247 3300042461 Ga0439460_0122605 Ga0439460_0122605_193_525 107
248 3300044673 Ga0453683_0260725 Ga0453683_0260725_611_1003 107
249 3300045051 Ga0451576_0657721 Ga0451576_0657721_223_546 107
250 3300046512 Ga0495610_0108681 Ga0495610_0108681_226_549 107
251 3300046539 Ga0495621_0000017 Ga0495621_0000017_1693_2025 107
252 3300046615 Ga0495656_0371300 Ga0495656_0371300_374_697 107
253 3300048915 Ga0496112_0746796 Ga0496112_0746796_301_624 107
254 3300049513 Ga0501290_050556 Ga0501290_050556_261_587 107
255 3300049519 Ga0501296_045932 Ga0501296_045932_280_606 107
256 3300049520 Ga0501297_001403 Ga0501297_001403_1804_2130 107
257 3300049521 Ga0501298_010233 Ga0501298_010233_238_564 107
258 3300049522 Ga0501299_121191 Ga0501299_121191_263_589 107
259 3300049652 Ga0501202_019820 Ga0501202_019820_110_436 107
260 3300049660 Ga0501216_012713 Ga0501216_012713_917_1243 107
261 3300049661 Ga0501217_009361 Ga0501217_009361_226_552 107
262 3300049663 Ga0501223_071580 Ga0501223_071580_313_639 107
263 3300049666 Ga0501228_061055 Ga0501228_061055_14_340 107
264 3300049668 Ga0501233_014306 Ga0501233_014306_1271_1597 107
265 3300049669 Ga0501235_117497 Ga0501235_117497_192_518 107
266 3300049686 Ga0501257_032424 Ga0501257_032424_103_429 107
267 3300049689 Ga0501260_017688 Ga0501260_017688_98_424 107
268 3300049758 Ga0501241_116725 Ga0501241_116725_146_472 107
269 3300049775 Ga0501279_049386 Ga0501279_049386_88_414 107
270 3300049779 Ga0501283_006675 Ga0501283_006675_922_1248 107
271 3300050507 nmdc:mga05p37_29784_c1 nmdc:mga05p37_29784_c1_4152_4475 107
272 3300050507 nmdc:mga05p37_592868_c1 nmdc:mga05p37_592868_c1_387_713 107
273 3300050507 nmdc:mga05p37_76505_c1 nmdc:mga05p37_76505_c1_3704_4027 107
274 3300050507 nmdc:mga05p37_95309_c1 nmdc:mga05p37_95309_c1_236_565 107
275 3300050507 nmdc:mga05p37_98068_c1 nmdc:mga05p37_98068_c1_211_543 107
276 3300050510 nmdc:mga06r32_1041724_c1 nmdc:mga06r32_1041724_c1_106_594 107
277 3300050512 nmdc:mga0n895_1850199_c1 nmdc:mga0n895_1850199_c1_139_471 107
278 3300050515 nmdc:mga0a205_198884_c1 nmdc:mga0a205_198884_c1_938_1261 107
279 3300050515 nmdc:mga0a205_403136_c1 nmdc:mga0a205_403136_c1_840_1163 107
280 3300050515 nmdc:mga0a205_81318_c1 nmdc:mga0a205_81318_c1_560_883 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

40

130

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9622 32 106
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9549 34 106
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9414 17 106
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9214 17 106
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.9061 17 106
ID Description Score Start End Superfamily
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9515 16 106 3.30.1360.20
1usoB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9447 32 106 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9414 17 106 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9386 19 106 3.30.1360.20
af_O42658_1_95_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9338 34 106 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A832VBI8-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9841 34 107 GO:0006729
GO:0008124
AF-A0A7C2TT88-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.984 26 107 GO:0006729
GO:0008124
AF-A0A6V8DDE3-F1-model_v4 deleted 0.9832 22 107
AF-A0A554JES3-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9826 20 106 GO:0006729
GO:0008124
AF-A0A3A5VAR2-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9804 34 106 GO:0006729
GO:0008124

Feature Viewer

pLDDT pTM Quality
90.79 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map