F383799

General Info

Members Datasets Scaffolds Average Seq Length
280 161 560 156

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0454235|Ga0316584_0454235_176_745
Length 189
Sequence MWIDEVSSLSKKTSEVVRAGLAQDFRSLGTDEEMLTEGEREEIRAQLGQYDHKRAGCVEALKMVQARHGWVSDGHLREVAELLDMTAEELDAVATFYSLIFRRPVGRHVILICDSITCWIMGYEDLLAHLSGRLGIGLGETSQDGRFTLLPIPCLGCCDHAPAMMIDDTLYGDLSREKIDEILERYGEA

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
79 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
80 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
81 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 2.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 0.36
Rhizosphere 97.5
Stem 0
Stem Tuber 0
Unclassified 9.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0454235 3300036712 Bacteria 906
2 JGI24740J21852_10006384 3300001979 Bacteria 4888
3 rootH2_10018544 3300003320 Bacteria 61980
4 rootH1_10000733 3300003323 Bacteria 30372
5 JGI25160J50197_1009514 3300003354 Bacteria 3597
6 Ga0058861_11434957 3300004800 Unclassified 943
7 Ga0070658_10588390 3300005327 Bacteria 964
8 Ga0070683_100207192 3300005329 Bacteria 1862
9 Ga0070682_100414819 3300005337 Bacteria 1022
10 Ga0070682_101556072 3300005337 Unclassified 570
11 Ga0070660_100086429 3300005339 Bacteria 2467
12 Ga0070691_10112406 3300005341 Bacteria 1364
13 Ga0070691_10361525 3300005341 Bacteria 809
14 Ga0070661_100069831 3300005344 Bacteria 2583
15 Ga0070661_100259944 3300005344 Bacteria 1342
16 Ga0070659_100957488 3300005366 Bacteria 750
17 Ga0070667_100319268 3300005367 Unclassified 1401
18 Ga0070709_10297589 3300005434 Bacteria 1178
19 Ga0070714_100065173 3300005435 Bacteria 3137
20 Ga0070714_100239003 3300005435 Bacteria 1676
21 Ga0070713_100856337 3300005436 Bacteria 873
22 Ga0070711_100512278 3300005439 Bacteria 991
23 Ga0070681_10546050 3300005458 Bacteria 1073
24 Ga0070681_10600863 3300005458 Bacteria 1014
25 Ga0068867_101477005 3300005459 Bacteria 632
26 Ga0070698_100777055 3300005471 Unclassified 901
27 Ga0070699_100631876 3300005518 Bacteria 977
28 Ga0070699_101475322 3300005518 Bacteria 624
29 Ga0070679_100091840 3300005530 Bacteria 3023
30 Ga0070679_100463969 3300005530 Bacteria 1211
31 Ga0070679_100763922 3300005530 Bacteria 909
32 Ga0070684_100380575 3300005535 Bacteria 1300
33 Ga0068853_100058858 3300005539 Bacteria 3318
34 Ga0068853_100302592 3300005539 Bacteria 1478
35 Ga0068855_100016355 3300005563 Bacteria 8920
36 Ga0068855_100150324 3300005563 Bacteria 2648
37 Ga0068854_100056076 3300005578 Bacteria 2839
38 Ga0068856_101354149 3300005614 Unclassified 726
39 Ga0068852_100024503 3300005616 Bacteria 4878
40 Ga0070717_10380920 3300006028 Bacteria 1265
41 Ga0075436_100173980 3300006914 Bacteria 1520
42 Ga0099795_10030231 3300007788 Bacteria 1858
43 Ga0105240_10023982 3300009093 Bacteria 8060
44 Ga0105240_10103375 3300009093 Bacteria 3462
45 Ga0105240_10342805 3300009093 Bacteria 1697
46 Ga0105240_11845688 3300009093 Unclassified 629
47 Ga0105237_10056698 3300009545 Bacteria 3921
48 Ga0105238_10418951 3300009551 Bacteria 1334
49 Ga0105239_11380861 3300010375 Bacteria 813
50 Ga0105239_12473125 3300010375 Bacteria 605
51 Ga0157370_10002058 3300013104 Bacteria 24658
52 Ga0157370_10008871 3300013104 Bacteria 10807
53 Ga0157370_10025215 3300013104 Bacteria 5886
54 Ga0157370_10529251 3300013104 Bacteria 1081
55 Ga0157369_10092351 3300013105 Bacteria 3230
56 Ga0157369_10117324 3300013105 Bacteria 2825
57 Ga0157369_10223625 3300013105 Bacteria 1970
58 Ga0157369_10969067 3300013105 Bacteria 871
59 Ga0157374_10236983 3300013296 Bacteria 1794
60 Ga0163162_10754593 3300013306 Bacteria 1092
61 Ga0157372_10001257 3300013307 Bacteria 27443
62 Ga0157372_10040134 3300013307 Bacteria 5168
63 Ga0157372_10155267 3300013307 Bacteria 2643
64 Ga0163163_10857869 3300014325 Unclassified 971
65 Ga0163163_10883428 3300014325 Bacteria 957
66 Ga0163163_12232621 3300014325 Unclassified 606
67 Ga0206353_10673899 3300020082 Bacteria 723
68 Ga0213872_10001684 3300021361 Bacteria 13911
69 Ga0207647_10006615 3300025904 Bacteria 8420
70 Ga0207707_10043618 3300025912 Bacteria 3911
71 Ga0207695_10020033 3300025913 Bacteria 7677
72 Ga0207695_10095277 3300025913 Bacteria 2981
73 Ga0207695_10126370 3300025913 Bacteria 2518
74 Ga0207695_10229607 3300025913 Bacteria 1761
75 Ga0207671_10216368 3300025914 Bacteria 1500
76 Ga0207660_10159630 3300025917 Bacteria 1738
77 Ga0207660_11186504 3300025917 Bacteria 621
78 Ga0207660_11309051 3300025917 Bacteria 588
79 Ga0207657_10119119 3300025919 Bacteria 2173
80 Ga0207657_10196116 3300025919 Bacteria 1626
81 Ga0207649_10058844 3300025920 Bacteria 2408
82 Ga0207649_10387033 3300025920 Bacteria 1043
83 Ga0207652_10158633 3300025921 Bacteria 2027
84 Ga0207652_10838547 3300025921 Bacteria 815
85 Ga0207700_10097036 3300025928 Bacteria 2342
86 Ga0207664_10307116 3300025929 Bacteria 1397
87 Ga0207664_10680593 3300025929 Bacteria 925
88 Ga0207686_10918623 3300025934 Bacteria 707
89 Ga0207665_10197018 3300025939 Bacteria 1466
90 Ga0207665_11138321 3300025939 Unclassified 622
91 Ga0207661_11274873 3300025944 Bacteria 675
92 Ga0207667_10013848 3300025949 Bacteria 9213
93 Ga0207667_10051190 3300025949 Bacteria 4355
94 Ga0207667_12093657 3300025949 Bacteria 524
95 Ga0207640_10108733 3300025981 Bacteria 1960
96 Ga0207658_10426946 3300025986 Bacteria 1170
97 Ga0207639_10113526 3300026041 Bacteria 2213
98 Ga0207639_10360484 3300026041 Bacteria 1301
99 Ga0207641_10010424 3300026088 Bacteria 7637
100 Ga0207648_10461713 3300026089 Bacteria 1157
101 Ga0207698_10014961 3300026142 Bacteria 5179
102 Ga0268266_10000260 3300028379 Bacteria 88643
103 Ga0268265_10444774 3300028380 Bacteria 1209
104 Ga0265338_10096205 3300028800 Bacteria 2430
105 Ga0265339_10010931 3300031249 Bacteria 5611
106 Ga0307408_100200691 3300031548 Bacteria 1614
107 Ga0316575_10006550 3300031665 Bacteria 4194
108 Ga0316575_10033097 3300031665 Bacteria 2026
109 Ga0316575_10046326 3300031665 Bacteria 1727
110 Ga0316575_10100212 3300031665 Bacteria 1177
111 Ga0316575_10197861 3300031665 Bacteria 836
112 Ga0316579_10017243 3300031691 Bacteria 3165
113 Ga0316579_10030019 3300031691 Bacteria 2482
114 Ga0316579_10033445 3300031691 Bacteria 2361
115 Ga0316579_10040099 3300031691 Bacteria 2171
116 Ga0316579_10085496 3300031691 Bacteria 1505
117 Ga0316579_10126324 3300031691 Bacteria 1230
118 Ga0265314_10000200 3300031711 Bacteria 88202
119 Ga0265314_10103934 3300031711 Bacteria 1820
120 Ga0316576_10001358 3300031727 Bacteria 13056
121 Ga0316576_10030996 3300031727 Bacteria 3791
122 Ga0316576_10037763 3300031727 Bacteria 3459
123 Ga0316576_10066149 3300031727 Bacteria 2657
124 Ga0316576_10117280 3300031727 Bacteria 1998
125 Ga0316576_10296646 3300031727 Bacteria 1208
126 Ga0316576_10501753 3300031727 Bacteria 892
127 Ga0316576_10790195 3300031727 Unclassified 684
128 Ga0316576_10977922 3300031727 Bacteria 604
129 Ga0316578_10016758 3300031728 Bacteria 3973
130 Ga0316578_10018119 3300031728 Bacteria 3850
131 Ga0316578_10044655 3300031728 Bacteria 2578
132 Ga0316578_10066494 3300031728 Bacteria 2129
133 Ga0316578_10079809 3300031728 Bacteria 1946
134 Ga0316578_10100649 3300031728 Bacteria 1732
135 Ga0316578_10133750 3300031728 Bacteria 1493
136 Ga0316578_10156796 3300031728 Unclassified 1372
137 Ga0316578_10330717 3300031728 Bacteria 909
138 Ga0316577_10014255 3300031733 Bacteria 4363
139 Ga0316577_10025149 3300031733 Bacteria 3312
140 Ga0316577_10097140 3300031733 Bacteria 1650
141 Ga0316577_10102745 3300031733 Bacteria 1602
142 Ga0316577_10196001 3300031733 Bacteria 1141
143 Ga0316577_10286680 3300031733 Bacteria 932
144 Ga0316577_10452678 3300031733 Bacteria 729
145 Ga0307409_100455608 3300031995 Unclassified 1236
146 Ga0307416_100879578 3300032002 Bacteria 995
147 Ga0316583_10002705 3300032133 Bacteria 6195
148 Ga0316583_10015581 3300032133 Bacteria 2735
149 Ga0316583_10043692 3300032133 Bacteria 1583
150 Ga0316583_10075781 3300032133 Unclassified 1176
151 Ga0316585_10001133 3300032137 Bacteria 6935
152 Ga0316585_10007648 3300032137 Bacteria 3122
153 Ga0316585_10052128 3300032137 Bacteria 1314
154 Ga0316580_10004098 3300032139 Bacteria 4200
155 Ga0316592_1036049 3300033524 Bacteria 1086
156 Ga0316588_1008933 3300033528 Bacteria 2077
157 Ga0316574_0006243 3300035398 Bacteria 6419
158 Ga0316574_0038902 3300035398 Bacteria 2921
159 Ga0316574_0070703 3300035398 Bacteria 2204
160 Ga0316574_0087050 3300035398 Bacteria 1989
161 Ga0316574_0150187 3300035398 Unclassified 1501
162 Ga0316574_0312922 3300035398 Bacteria 997
163 Ga0316574_0524255 3300035398 Bacteria 737
164 Ga0373933_0989476 3300035724 Bacteria 554
165 Ga0373937_0205619 3300036401 Bacteria 1852
166 Ga0316582_0002360 3300036647 Bacteria 8847
167 Ga0316582_0005606 3300036647 Bacteria 6490
168 Ga0316582_0010856 3300036647 Bacteria 5008
169 Ga0316582_0030993 3300036647 Bacteria 3264
170 Ga0316582_0066258 3300036647 Bacteria 2327
171 Ga0316582_0079145 3300036647 Bacteria 2143
172 Ga0316582_0100645 3300036647 Bacteria 1913
173 Ga0316582_0122463 3300036647 Bacteria 1741
174 Ga0316582_0129903 3300036647 Bacteria 1691
175 Ga0316582_0150588 3300036647 Bacteria 1573
176 Ga0316582_0402075 3300036647 Bacteria 943
177 Ga0316584_0001149 3300036712 Bacteria 15585
178 Ga0316584_0003440 3300036712 Bacteria 10276
179 Ga0316584_0017851 3300036712 Bacteria 5110
180 Ga0316584_0026181 3300036712 Bacteria 4285
181 Ga0316584_0054368 3300036712 Bacteria 2996
182 Ga0316584_0098379 3300036712 Bacteria 2190
183 Ga0316584_0181114 3300036712 Bacteria 1560
184 Ga0316584_0226519 3300036712 Bacteria 1371
185 Ga0316584_0315269 3300036712 Bacteria 1129
186 Ga0316584_0344655 3300036712 Bacteria 1070
187 Ga0316584_0512264 3300036712 Unclassified 842
188 Ga0316584_0528863 3300036712 Bacteria 825
189 Ga0316584_0589982 3300036712 Unclassified 772
190 Ga0395900_0452677 3300037418 Bacteria 1240
191 Ga0395905_0899903 3300037471 Unclassified 788
192 Ga0316581_0002627 3300037588 Bacteria 4340
193 Ga0316581_0019755 3300037588 Bacteria 1967
194 Ga0316581_0020213 3300037588 Bacteria 1948
195 Ga0316581_0028830 3300037588 Bacteria 1665
196 Ga0316581_0030243 3300037588 Bacteria 1629
197 Ga0316581_0110638 3300037588 Bacteria 846
198 Ga0436361_0245497 3300039447 Bacteria 13991
199 Ga0451577_0000129 3300042876 Bacteria 167794
200 Ga0453683_0370851 3300044673 Bacteria 921
201 Ga0453684_0001165 3300044712 Bacteria 81646
202 Ga0495592_0027302 3300046454 Bacteria 4329
203 Ga0495603_0012298 3300046455 Bacteria 5180
204 Ga0495629_0440040 3300046459 Bacteria 883
205 Ga0495651_0030607 3300046462 Bacteria 4197
206 Ga0495653_0020469 3300046463 Bacteria 5363
207 Ga0495580_0189817 3300046472 Bacteria 1417
208 Ga0495582_0001734 3300046473 Bacteria 12309
209 Ga0495639_0000745 3300046475 Bacteria 14896
210 Ga0495662_0007892 3300046476 Bacteria 5240
211 Ga0495664_0010856 3300046477 Bacteria 5120
212 Ga0495594_0021666 3300046499 Bacteria 3431
213 Ga0495608_0537538 3300046511 Unclassified 705
214 Ga0495628_0021864 3300046516 Bacteria 5257
215 Ga0495630_0023940 3300046517 Bacteria 4515
216 Ga0495666_0003666 3300046526 Bacteria 7757
217 Ga0495652_0005301 3300046529 Bacteria 12154
218 Ga0495665_0014859 3300046531 Bacteria 4193
219 Ga0495640_0007292 3300046533 Bacteria 8712
220 Ga0495586_0007148 3300046535 Bacteria 5950
221 Ga0495587_0100795 3300046536 Bacteria 1664
222 Ga0495645_0007130 3300046543 Bacteria 7783
223 Ga0495634_0003158 3300046642 Bacteria 13334
224 Ga0495635_0020000 3300046663 Bacteria 4665
225 Ga0495588_0342342 3300046674 Unclassified 786
226 Ga0495599_0009756 3300046678 Bacteria 5877
227 Ga0495599_0450770 3300046678 Bacteria 762
228 Ga0495646_0006639 3300046680 Bacteria 7336
229 Ga0495658_0237421 3300046683 Bacteria 1144
230 Ga0495613_0035950 3300046689 Bacteria 3673
231 Ga0495624_0003705 3300046690 Bacteria 11297
232 Ga0495600_0000817 3300046809 Bacteria 16536
233 Ga0495581_0013856 3300047315 Bacteria 4673
234 Ga0495604_0005986 3300047317 Bacteria 9655
235 Ga0495674_0014787 3300047319 Bacteria 7300
236 Ga0495676_0006988 3300047321 Bacteria 10358
237 Ga0495680_0087240 3300047322 Bacteria 2347
238 Ga0495675_0013041 3300047444 Bacteria 5241
239 Ga0495684_0009188 3300047471 Bacteria 7633
240 Ga0495593_0085083 3300047673 Bacteria 1632
241 Ga0495614_0001515 3300048089 Bacteria 10066
242 Ga0496105_0696992 3300048908 Bacteria 780
243 Ga0496126_0629390 3300048929 Bacteria 842
244 Ga0501031_0000168 3300049568 Bacteria 37163
245 Ga0501031_0014236 3300049568 Bacteria 5174
246 Ga0501032_0044604 3300049569 Bacteria 3001
247 Ga0501034_0042713 3300049571 Bacteria 4589
248 Ga0501034_0297959 3300049571 Unclassified 1550
249 Ga0501036_0083955 3300049572 Bacteria 2693
250 Ga0501037_0024539 3300049573 Bacteria 4459
251 Ga0501037_0304160 3300049573 Bacteria 1107
252 Ga0501037_0390587 3300049573 Bacteria 955
253 Ga0501038_0163226 3300049574 Bacteria 1809
254 Ga0501039_0000371 3300049575 Bacteria 32180
255 Ga0501039_0075922 3300049575 Bacteria 2612
256 Ga0501040_0074537 3300049576 Bacteria 2345
257 Ga0501040_0301353 3300049576 Bacteria 1146
258 Ga0501041_0043985 3300049577 Bacteria 2714
259 Ga0501041_0100558 3300049577 Unclassified 1789
260 Ga0501042_0001748 3300049578 Bacteria 12992
261 Ga0501042_0016347 3300049578 Bacteria 5092
262 Ga0501043_0117315 3300049579 Bacteria 2088
263 Ga0501043_0636794 3300049579 Bacteria 784
264 Ga0501046_0005948 3300049580 Bacteria 10863
265 Ga0501046_0129160 3300049580 Unclassified 1917
266 Ga0501047_0069760 3300049581 Bacteria 3384
267 Ga0501048_0036765 3300049582 Bacteria 3519
268 Ga0501071_0148090 3300049587 Bacteria 1750
269 Ga0501075_0983052 3300049591 Bacteria 641
270 Ga0501076_0832837 3300049592 Bacteria 761
271 Ga0501035_0105447 3300049822 Bacteria 2471
272 Ga0501044_0083460 3300049823 Bacteria 3231
273 nmdc:mga08x19_94822_c1 3300050514 Bacteria 1973
274 Ga0500652_003189 3300053131 Bacteria 4958
275 Ga0500568_0245404 3300053139 Unclassified 652
276 Ga0587083_0133074 3300059505 Unclassified 655
277 Ga0587091_114881 3300059511 Unclassified 647
278 Ga0587067_091263 3300059640 Unclassified 690
279 Ga0587079_041353 3300059647 Bacteria 932
280 Ga0501082_0226646 3300060353 Bacteria 1626
281 Ga0316584_0454235
282 JGI24740J21852_10006384
283 rootH2_10018544
284 rootH1_10000733
285 JGI25160J50197_1009514
286 Ga0058861_11434957
287 Ga0070658_10588390
288 Ga0070683_100207192
289 Ga0070682_100414819
290 Ga0070682_101556072
291 Ga0070660_100086429
292 Ga0070691_10112406
293 Ga0070691_10361525
294 Ga0070661_100069831
295 Ga0070661_100259944
296 Ga0070659_100957488
297 Ga0070667_100319268
298 Ga0070709_10297589
299 Ga0070714_100065173
300 Ga0070714_100239003
301 Ga0070713_100856337
302 Ga0070711_100512278
303 Ga0070681_10546050
304 Ga0070681_10600863
305 Ga0068867_101477005
306 Ga0070698_100777055
307 Ga0070699_100631876
308 Ga0070699_101475322
309 Ga0070679_100091840
310 Ga0070679_100463969
311 Ga0070679_100763922
312 Ga0070684_100380575
313 Ga0068853_100058858
314 Ga0068853_100302592
315 Ga0068855_100016355
316 Ga0068855_100150324
317 Ga0068854_100056076
318 Ga0068856_101354149
319 Ga0068852_100024503
320 Ga0070717_10380920
321 Ga0075436_100173980
322 Ga0099795_10030231
323 Ga0105240_10023982
324 Ga0105240_10103375
325 Ga0105240_10342805
326 Ga0105240_11845688
327 Ga0105237_10056698
328 Ga0105238_10418951
329 Ga0105239_11380861
330 Ga0105239_12473125
331 Ga0157370_10002058
332 Ga0157370_10008871
333 Ga0157370_10025215
334 Ga0157370_10529251
335 Ga0157369_10092351
336 Ga0157369_10117324
337 Ga0157369_10223625
338 Ga0157369_10969067
339 Ga0157374_10236983
340 Ga0163162_10754593
341 Ga0157372_10001257
342 Ga0157372_10040134
343 Ga0157372_10155267
344 Ga0163163_10857869
345 Ga0163163_10883428
346 Ga0163163_12232621
347 Ga0206353_10673899
348 Ga0213872_10001684
349 Ga0207647_10006615
350 Ga0207707_10043618
351 Ga0207695_10020033
352 Ga0207695_10095277
353 Ga0207695_10126370
354 Ga0207695_10229607
355 Ga0207671_10216368
356 Ga0207660_10159630
357 Ga0207660_11186504
358 Ga0207660_11309051
359 Ga0207657_10119119
360 Ga0207657_10196116
361 Ga0207649_10058844
362 Ga0207649_10387033
363 Ga0207652_10158633
364 Ga0207652_10838547
365 Ga0207700_10097036
366 Ga0207664_10307116
367 Ga0207664_10680593
368 Ga0207686_10918623
369 Ga0207665_10197018
370 Ga0207665_11138321
371 Ga0207661_11274873
372 Ga0207667_10013848
373 Ga0207667_10051190
374 Ga0207667_12093657
375 Ga0207640_10108733
376 Ga0207658_10426946
377 Ga0207639_10113526
378 Ga0207639_10360484
379 Ga0207641_10010424
380 Ga0207648_10461713
381 Ga0207698_10014961
382 Ga0268266_10000260
383 Ga0268265_10444774
384 Ga0265338_10096205
385 Ga0265339_10010931
386 Ga0307408_100200691
387 Ga0316575_10006550
388 Ga0316575_10033097
389 Ga0316575_10046326
390 Ga0316575_10100212
391 Ga0316575_10197861
392 Ga0316579_10017243
393 Ga0316579_10030019
394 Ga0316579_10033445
395 Ga0316579_10040099
396 Ga0316579_10085496
397 Ga0316579_10126324
398 Ga0265314_10000200
399 Ga0265314_10103934
400 Ga0316576_10001358
401 Ga0316576_10030996
402 Ga0316576_10037763
403 Ga0316576_10066149
404 Ga0316576_10117280
405 Ga0316576_10296646
406 Ga0316576_10501753
407 Ga0316576_10790195
408 Ga0316576_10977922
409 Ga0316578_10016758
410 Ga0316578_10018119
411 Ga0316578_10044655
412 Ga0316578_10066494
413 Ga0316578_10079809
414 Ga0316578_10100649
415 Ga0316578_10133750
416 Ga0316578_10156796
417 Ga0316578_10330717
418 Ga0316577_10014255
419 Ga0316577_10025149
420 Ga0316577_10097140
421 Ga0316577_10102745
422 Ga0316577_10196001
423 Ga0316577_10286680
424 Ga0316577_10452678
425 Ga0307409_100455608
426 Ga0307416_100879578
427 Ga0316583_10002705
428 Ga0316583_10015581
429 Ga0316583_10043692
430 Ga0316583_10075781
431 Ga0316585_10001133
432 Ga0316585_10007648
433 Ga0316585_10052128
434 Ga0316580_10004098
435 Ga0316592_1036049
436 Ga0316588_1008933
437 Ga0316574_0006243
438 Ga0316574_0038902
439 Ga0316574_0070703
440 Ga0316574_0087050
441 Ga0316574_0150187
442 Ga0316574_0312922
443 Ga0316574_0524255
444 Ga0373933_0989476
445 Ga0373937_0205619
446 Ga0316582_0002360
447 Ga0316582_0005606
448 Ga0316582_0010856
449 Ga0316582_0030993
450 Ga0316582_0066258
451 Ga0316582_0079145
452 Ga0316582_0100645
453 Ga0316582_0122463
454 Ga0316582_0129903
455 Ga0316582_0150588
456 Ga0316582_0402075
457 Ga0316584_0001149
458 Ga0316584_0003440
459 Ga0316584_0017851
460 Ga0316584_0026181
461 Ga0316584_0054368
462 Ga0316584_0098379
463 Ga0316584_0181114
464 Ga0316584_0226519
465 Ga0316584_0315269
466 Ga0316584_0344655
467 Ga0316584_0512264
468 Ga0316584_0528863
469 Ga0316584_0589982
470 Ga0395900_0452677
471 Ga0395905_0899903
472 Ga0316581_0002627
473 Ga0316581_0019755
474 Ga0316581_0020213
475 Ga0316581_0028830
476 Ga0316581_0030243
477 Ga0316581_0110638
478 Ga0436361_0245497
479 Ga0451577_0000129
480 Ga0453683_0370851
481 Ga0453684_0001165
482 Ga0495592_0027302
483 Ga0495603_0012298
484 Ga0495629_0440040
485 Ga0495651_0030607
486 Ga0495653_0020469
487 Ga0495580_0189817
488 Ga0495582_0001734
489 Ga0495639_0000745
490 Ga0495662_0007892
491 Ga0495664_0010856
492 Ga0495594_0021666
493 Ga0495608_0537538
494 Ga0495628_0021864
495 Ga0495630_0023940
496 Ga0495666_0003666
497 Ga0495652_0005301
498 Ga0495665_0014859
499 Ga0495640_0007292
500 Ga0495586_0007148
501 Ga0495587_0100795
502 Ga0495645_0007130
503 Ga0495634_0003158
504 Ga0495635_0020000
505 Ga0495588_0342342
506 Ga0495599_0009756
507 Ga0495599_0450770
508 Ga0495646_0006639
509 Ga0495658_0237421
510 Ga0495613_0035950
511 Ga0495624_0003705
512 Ga0495600_0000817
513 Ga0495581_0013856
514 Ga0495604_0005986
515 Ga0495674_0014787
516 Ga0495676_0006988
517 Ga0495680_0087240
518 Ga0495675_0013041
519 Ga0495684_0009188
520 Ga0495593_0085083
521 Ga0495614_0001515
522 Ga0496105_0696992
523 Ga0496126_0629390
524 Ga0501031_0000168
525 Ga0501031_0014236
526 Ga0501032_0044604
527 Ga0501034_0042713
528 Ga0501034_0297959
529 Ga0501036_0083955
530 Ga0501037_0024539
531 Ga0501037_0304160
532 Ga0501037_0390587
533 Ga0501038_0163226
534 Ga0501039_0000371
535 Ga0501039_0075922
536 Ga0501040_0074537
537 Ga0501040_0301353
538 Ga0501041_0043985
539 Ga0501041_0100558
540 Ga0501042_0001748
541 Ga0501042_0016347
542 Ga0501043_0117315
543 Ga0501043_0636794
544 Ga0501046_0005948
545 Ga0501046_0129160
546 Ga0501047_0069760
547 Ga0501048_0036765
548 Ga0501071_0148090
549 Ga0501075_0983052
550 Ga0501076_0832837
551 Ga0501035_0105447
552 Ga0501044_0083460
553 nmdc:mga08x19_94822_c1
554 Ga0500652_003189
555 Ga0500568_0245404
556 Ga0587083_0133074
557 Ga0587091_114881
558 Ga0587067_091263
559 Ga0587079_041353
560 Ga0501082_0226646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

43

187

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.9392 1 154
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.9335 1 154
7a24-assembly1.cif.gz_B assembly intermediate of the plant mitochondrial complex i 0.9167 2 152
6zjy-assembly1.cif.gz_2 respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.9146 11 151
4uq8-assembly1.cif.gz_E electron cryo-microscopy of bovine complex i 0.9146 44 152
ID Description Score Start End Superfamily
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9953 71 153 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9835 71 153 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9807 72 152 3.40.30.10
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9702 72 151 3.40.30.10
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9618 72 152 3.40.30.10
ID Description Score Start End GO Terms
AF-J3TXN0-F1-model_v4 NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) 0.9717 2 154 GO:0003954
GO:0046872
GO:0051537
AF-X0QSL1-F1-model_v4 NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) 0.9694 1 154 GO:0003954
GO:0046872
GO:0051537
AF-A0A1V5BT53-F1-model_v4 NADH-quinone oxidoreductase subunit E (EC 1.6.5.11) 0.9683 1 154 GO:0003954
GO:0046872
GO:0051537
AF-Q2YAA2-F1-model_v4 NADH dehydrogenase subunit E (EC 1.6.5.3) 0.968 1 152 GO:0003954
GO:0046872
GO:0051537
AF-A0A345PBN0-F1-model_v4 NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) 0.9673 2 154 GO:0003954
GO:0046872
GO:0051537

Map