F383781

General Info

Members Datasets Scaffolds Average Seq Length
280 177 560 251

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10144434|Ga0307411_101444342
Length 291
Sequence MHPSRQRGVSRYAGRVKVATWNVNGIRARQTQVQEFIDREQPDVLCLQEIKASLDQLPVWLCELQGYWCYWHGGKGYSGVGLHVRRATWPERPLFDHPDFDYEHRIVTARVPLGTGDLTVASIYVPNGGKDFPAKMRFLEALDTYAAEQQQAGRNLVLCGDLNVALTDMDVHPKERRPNIVGQRPDERALMQRVLSRGLADVHRIFEPDNADLFTWWAPWRNMKQRNIGWRLDYVFATSGLAERAKSCVVQREVGTSDHGPVVAVFDVELPTATPELPTNSQSPHQDGRLF

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 3.21
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 9.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10144434 3300032005 Bacteria 1759
2 JGI24751J29686_10003689 3300002459 Unclassified 3085
3 JGI25406J46586_10000457 3300003203 Bacteria 19025
4 Ga0065712_10075984 3300005290 Bacteria 3752
5 Ga0065712_10077044 3300005290 Bacteria 3560
6 Ga0065715_10095940 3300005293 Bacteria 3976
7 Ga0065715_10110852 3300005293 Bacteria 2600
8 Ga0065715_10119703 3300005293 Bacteria 2279
9 Ga0065707_10082985 3300005295 Bacteria 11034
10 Ga0070683_100188137 3300005329 Bacteria 1960
11 Ga0070690_100031691 3300005330 Bacteria 3295
12 Ga0070690_100229276 3300005330 Bacteria 1305
13 Ga0070670_100008232 3300005331 Bacteria 8880
14 Ga0070670_100158941 3300005331 Unclassified 1958
15 Ga0070670_100215355 3300005331 Bacteria 1671
16 Ga0070666_10001610 3300005335 Bacteria 13731
17 Ga0070680_100203899 3300005336 Bacteria 1668
18 Ga0070680_100287690 3300005336 Bacteria 1393
19 Ga0068868_100146128 3300005338 Bacteria 1944
20 Ga0070660_100126427 3300005339 Bacteria 2043
21 Ga0070689_100026378 3300005340 Bacteria 4374
22 Ga0070687_100036537 3300005343 Bacteria 2449
23 Ga0070687_100188605 3300005343 Unclassified 1241
24 Ga0070669_100042645 3300005353 Bacteria 3302
25 Ga0070675_100004074 3300005354 Bacteria 11096
26 Ga0070675_100053519 3300005354 Bacteria 3320
27 Ga0070675_100182055 3300005354 Bacteria 1817
28 Ga0070675_100184316 3300005354 Unclassified 1806
29 Ga0070675_100454493 3300005354 Bacteria 1149
30 Ga0070674_100185351 3300005356 Bacteria 1597
31 Ga0070659_100220853 3300005366 Bacteria 1564
32 Ga0070659_100341827 3300005366 Bacteria 1254
33 Ga0070659_100406419 3300005366 Bacteria 1150
34 Ga0070667_100013472 3300005367 Bacteria 6756
35 Ga0070705_100000092 3300005440 Bacteria 50020
36 Ga0070705_100103980 3300005440 Bacteria 1800
37 Ga0070708_100016774 3300005445 Bacteria 6087
38 Ga0070708_100400277 3300005445 Bacteria 1295
39 Ga0070708_100493957 3300005445 Bacteria 1154
40 Ga0070662_100300519 3300005457 Bacteria 1304
41 Ga0070681_10001922 3300005458 Bacteria 18745
42 Ga0070681_10129313 3300005458 Bacteria 2457
43 Ga0068867_100342343 3300005459 Bacteria 1245
44 Ga0070706_100018362 3300005467 Bacteria 6452
45 Ga0070706_100259421 3300005467 Bacteria 1622
46 Ga0070707_100045496 3300005468 Bacteria 4201
47 Ga0070707_100317651 3300005468 Bacteria 1514
48 Ga0070707_100538083 3300005468 Bacteria 1130
49 Ga0070698_100079069 3300005471 Bacteria 3286
50 Ga0070698_100471642 3300005471 Bacteria 1192
51 Ga0070699_100077119 3300005518 Bacteria 2901
52 Ga0070699_100080654 3300005518 Bacteria 2836
53 Ga0070679_100038318 3300005530 Bacteria 4765
54 Ga0070679_100041567 3300005530 Bacteria 4575
55 Ga0070684_100153493 3300005535 Bacteria 2087
56 Ga0070697_100012047 3300005536 Bacteria 6768
57 Ga0068853_100223131 3300005539 Unclassified 1722
58 Ga0070672_100141145 3300005543 Bacteria 1987
59 Ga0070686_100000977 3300005544 Bacteria 16467
60 Ga0070686_100133308 3300005544 Bacteria 1721
61 Ga0070695_100088346 3300005545 Bacteria 2063
62 Ga0068855_100181736 3300005563 Bacteria 2377
63 Ga0068852_100734805 3300005616 Unclassified 998
64 Ga0068859_100025252 3300005617 Bacteria 5962
65 Ga0068859_100126998 3300005617 Unclassified 2620
66 Ga0068859_100159215 3300005617 Bacteria 2336
67 Ga0068864_100343725 3300005618 Bacteria 1406
68 Ga0068870_10028756 3300005840 Bacteria 2794
69 Ga0068860_100159264 3300005843 Bacteria 2176
70 Ga0068860_100781518 3300005843 Bacteria 968
71 Ga0081539_10000012 3300005985 Bacteria 440369
72 Ga0081539_10000211 3300005985 Bacteria 136221
73 Ga0081539_10001641 3300005985 Bacteria 36374
74 Ga0097621_100085236 3300006237 Bacteria 2635
75 Ga0075428_100000042 3300006844 Bacteria 102264
76 Ga0075428_100009671 3300006844 Bacteria 10707
77 Ga0075430_100016491 3300006846 Bacteria 6291
78 Ga0075430_100025581 3300006846 Bacteria 5023
79 Ga0075430_100035965 3300006846 Bacteria 4200
80 Ga0075430_100217814 3300006846 Bacteria 1584
81 Ga0075431_100046007 3300006847 Bacteria 4499
82 Ga0075431_100152518 3300006847 Bacteria 2379
83 Ga0075431_100396567 3300006847 Unclassified 1381
84 Ga0075433_10076058 3300006852 Bacteria 2956
85 Ga0075434_100000239 3300006871 Bacteria 38163
86 Ga0075434_100232095 3300006871 Bacteria 1865
87 Ga0075434_100257278 3300006871 Bacteria 1765
88 Ga0075434_100563797 3300006871 Bacteria 1158
89 Ga0075429_100067838 3300006880 Unclassified 3105
90 Ga0075429_100335829 3300006880 Bacteria 1322
91 Ga0075436_100000333 3300006914 Bacteria 30104
92 Ga0075436_100016489 3300006914 Bacteria 5056
93 Ga0097620_100126997 3300006931 Unclassified 2620
94 Ga0097620_100159207 3300006931 Bacteria 2336
95 Ga0075435_100000013 3300007076 Bacteria 106345
96 Ga0075435_100094253 3300007076 Bacteria 2474
97 Ga0105240_10304845 3300009093 Bacteria 1821
98 Ga0111539_10000002 3300009094 Bacteria 983359
99 Ga0111539_10000149 3300009094 Bacteria 79175
100 Ga0111539_10057357 3300009094 Bacteria 4625
101 Ga0111539_10080998 3300009094 Bacteria 3818
102 Ga0111539_10227308 3300009094 Bacteria 2173
103 Ga0105247_10059464 3300009101 Bacteria 2366
104 Ga0114129_10012297 3300009147 Bacteria 12179
105 Ga0105242_10659081 3300009176 Bacteria 1019
106 Ga0105248_10049146 3300009177 Bacteria 4731
107 Ga0105248_10179350 3300009177 Bacteria 2387
108 Ga0105248_10257387 3300009177 Bacteria 1965
109 Ga0105248_10789579 3300009177 Bacteria 1072
110 Ga0105237_10073223 3300009545 Bacteria 3418
111 Ga0105238_10151920 3300009551 Bacteria 2291
112 Ga0105249_10179582 3300009553 Bacteria 2058
113 Ga0157375_10366605 3300013308 Bacteria 1607
114 Ga0163163_10020326 3300014325 Bacteria 6250
115 Ga0163163_10051227 3300014325 Bacteria 4070
116 Ga0157380_10063169 3300014326 Bacteria 2968
117 Ga0157377_10096890 3300014745 Unclassified 1751
118 Ga0157377_10206088 3300014745 Bacteria 1251
119 Ga0207697_10000309 3300025315 Bacteria 27331
120 Ga0207697_10035575 3300025315 Bacteria 2039
121 Ga0207688_10010948 3300025901 Bacteria 4935
122 Ga0207680_10001521 3300025903 Bacteria 10927
123 Ga0207680_10483417 3300025903 Bacteria 881
124 Ga0207705_10316123 3300025909 Bacteria 1199
125 Ga0207684_10011817 3300025910 Bacteria 7613
126 Ga0207684_10126710 3300025910 Bacteria 2191
127 Ga0207707_10120205 3300025912 Bacteria 2296
128 Ga0207671_10120275 3300025914 Bacteria 2007
129 Ga0207660_10209677 3300025917 Bacteria 1525
130 Ga0207660_10668646 3300025917 Bacteria 847
131 Ga0207662_10074611 3300025918 Unclassified 2059
132 Ga0207662_10109825 3300025918 Bacteria 1718
133 Ga0207657_10001598 3300025919 Bacteria 24352
134 Ga0207652_10091071 3300025921 Bacteria 2681
135 Ga0207646_10045890 3300025922 Bacteria 3921
136 Ga0207646_10748897 3300025922 Bacteria 872
137 Ga0207681_10071928 3300025923 Bacteria 2414
138 Ga0207681_10076991 3300025923 Bacteria 2344
139 Ga0207694_10237385 3300025924 Bacteria 1489
140 Ga0207650_10132024 3300025925 Bacteria 1955
141 Ga0207650_10322622 3300025925 Bacteria 1265
142 Ga0207650_10581959 3300025925 Bacteria 940
143 Ga0207659_10008004 3300025926 Bacteria 6537
144 Ga0207659_10036691 3300025926 Bacteria 3398
145 Ga0207659_10146944 3300025926 Bacteria 1837
146 Ga0207659_10219235 3300025926 Unclassified 1529
147 Ga0207659_10385197 3300025926 Bacteria 1170
148 Ga0207664_10132966 3300025929 Bacteria 2096
149 Ga0207690_10132932 3300025932 Bacteria 1823
150 Ga0207690_10140581 3300025932 Bacteria 1778
151 Ga0207690_10475472 3300025932 Bacteria 1008
152 Ga0207706_10199412 3300025933 Bacteria 1755
153 Ga0207670_10034231 3300025936 Bacteria 3281
154 Ga0207691_10155211 3300025940 Bacteria 2011
155 Ga0207711_10025674 3300025941 Bacteria 4941
156 Ga0207661_10255863 3300025944 Bacteria 1558
157 Ga0207679_10080493 3300025945 Unclassified 2487
158 Ga0207679_10140105 3300025945 Bacteria 1954
159 Ga0207679_10178058 3300025945 Unclassified 1757
160 Ga0207667_10371968 3300025949 Bacteria 1456
161 Ga0207651_10001056 3300025960 Bacteria 12206
162 Ga0207712_10667747 3300025961 Bacteria 905
163 Ga0207640_10010571 3300025981 Bacteria 5205
164 Ga0207677_10096664 3300026023 Bacteria 2162
165 Ga0207677_10103476 3300026023 Bacteria 2102
166 Ga0207703_10280260 3300026035 Bacteria 1514
167 Ga0207703_10726960 3300026035 Bacteria 945
168 Ga0207639_10312458 3300026041 Bacteria 1392
169 Ga0207648_10350950 3300026089 Bacteria 1330
170 Ga0207648_10617001 3300026089 Bacteria 1001
171 Ga0207676_10024132 3300026095 Bacteria 4498
172 Ga0207676_10296756 3300026095 Bacteria 1474
173 Ga0207683_10093823 3300026121 Bacteria 2674
174 Ga0207683_10415339 3300026121 Bacteria 1239
175 Ga0209970_1008386 3300027614 Bacteria 1696
176 Ga0210002_1005187 3300027617 Bacteria 1954
177 Ga0209983_1000870 3300027665 Bacteria 6657
178 Ga0209971_1001170 3300027682 Bacteria 6605
179 Ga0209966_1008249 3300027695 Bacteria 1846
180 Ga0209974_10000493 3300027876 Bacteria 13154
181 Ga0207428_10000004 3300027907 Bacteria 727800
182 Ga0207428_10055264 3300027907 Bacteria 3157
183 Ga0207428_10455204 3300027907 Bacteria 933
184 Ga0268265_10111033 3300028380 Bacteria 2238
185 Ga0268264_10684090 3300028381 Bacteria 1018
186 Ga0307408_100017160 3300031548 Bacteria 4844
187 Ga0307508_10054717 3300031616 Bacteria 3537
188 Ga0307407_10105495 3300031903 Unclassified 1758
189 Ga0307409_100811340 3300031995 Unclassified 944
190 Ga0307411_10389291 3300032005 Unclassified 1149
191 Ga0307411_10637032 3300032005 Unclassified 921
192 Ga0373930_0002934 3300034816 Bacteria 2682
193 Ga0373950_0036210 3300034818 Bacteria 930
194 Ga0373958_0001932 3300034819 Bacteria 2847
195 Ga0373928_0000193 3300035084 Bacteria 11706
196 Ga0373929_0004928 3300035085 Bacteria 2393
197 Ga0373940_0020354 3300035088 Bacteria 1685
198 Ga0373949_0002694 3300035090 Bacteria 4455
199 Ga0373952_0000168 3300035092 Bacteria 10016
200 Ga0373932_0000676 3300035112 Bacteria 10316
201 Ga0373939_0000207 3300035114 Bacteria 16310
202 Ga0373941_0001460 3300035115 Bacteria 4997
203 Ga0373960_0000066 3300035121 Bacteria 14802
204 Ga0373942_0002579 3300035207 Bacteria 4370
205 Ga0373961_0000579 3300035241 Bacteria 13736
206 Ga0373962_0001726 3300035242 Bacteria 5197
207 Ga0373962_0085506 3300035242 Bacteria 964
208 Ga0373931_0000370 3300035691 Bacteria 18463
209 Ga0373933_0112702 3300035724 Bacteria 1698
210 Ga0373947_0461239 3300035725 Bacteria 861
211 Ga0373937_0384231 3300036401 Unclassified 1331
212 Ga0439435_0001661 3300042436 Bacteria 4187
213 Ga0439435_0001965 3300042436 Bacteria 3959
214 Ga0451577_0132232 3300042876 Bacteria 2239
215 Ga0451577_0335624 3300042876 Bacteria 1371
216 Ga0453683_0321884 3300044673 Bacteria 991
217 Ga0451576_0043659 3300045051 Bacteria 4729
218 Ga0451576_0049645 3300045051 Bacteria 4403
219 Ga0451576_0071616 3300045051 Bacteria 3608
220 Ga0495629_0001607 3300046459 Bacteria 17758
221 Ga0495638_0038102 3300046460 Bacteria 3057
222 Ga0495594_0104622 3300046499 Bacteria 1593
223 Ga0495643_0004267 3300046522 Bacteria 10083
224 Ga0495621_0009622 3300046539 Unclassified 2941
225 Ga0495667_0281381 3300046559 Bacteria 1056
226 Ga0495659_0025472 3300046664 Unclassified 2025
227 Ga0495647_0061616 3300046681 Bacteria 1482
228 Ga0495647_0076518 3300046681 Bacteria 1349
229 Ga0495658_0127243 3300046683 Bacteria 1547
230 Ga0495670_0193493 3300046691 Bacteria 1076
231 Ga0495677_0046700 3300047445 Bacteria 1589
232 Ga0496102_0479955 3300048905 Bacteria 1164
233 Ga0496102_0773006 3300048905 Bacteria 883
234 Ga0496109_0077043 3300048912 Bacteria 3068
235 Ga0496109_0295885 3300048912 Bacteria 1526
236 Ga0496109_0984611 3300048912 Unclassified 781
237 Ga0496110_0051252 3300048913 Bacteria 3627
238 Ga0496111_0261516 3300048914 Bacteria 1284
239 Ga0496112_0074513 3300048915 Bacteria 3356
240 Ga0496113_0485161 3300048916 Bacteria 993
241 Ga0501034_0038435 3300049571 Bacteria 4846
242 Ga0501034_0166173 3300049571 Bacteria 2175
243 Ga0501043_0136118 3300049579 Bacteria 1924
244 Ga0501046_0328219 3300049580 Bacteria 1114
245 Ga0501047_0107346 3300049581 Bacteria 2673
246 Ga0501070_0350641 3300049586 Unclassified 1198
247 Ga0501072_0040651 3300049588 Bacteria 3652
248 Ga0501075_0196920 3300049591 Bacteria 1537
249 Ga0501080_0228635 3300049742 Bacteria 1701
250 Ga0501081_0371233 3300049743 Bacteria 1056
251 Ga0501044_0008783 3300049823 Bacteria 11056
252 Ga0501045_0307108 3300049824 Bacteria 1181
253 nmdc:mga00v17_50174_c1 3300050491 Bacteria 2534
254 nmdc:mga05p37_221370_c1 3300050507 Bacteria 2284
255 nmdc:mga09592_448579_c1 3300050508 Bacteria 1113
256 nmdc:mga0qj67_10374_c1 3300050509 Bacteria 6959
257 nmdc:mga0qj67_240115_c1 3300050509 Bacteria 1470
258 nmdc:mga0qj67_259740_c1 3300050509 Unclassified 1409
259 nmdc:mga0qj67_28671_c1 3300050509 Bacteria 4323
260 nmdc:mga0qj67_44123_c1 3300050509 Bacteria 3512
261 nmdc:mga06r32_5993_c1 3300050510 Bacteria 10934
262 nmdc:mga06r32_99598_c1 3300050510 Bacteria 2851
263 nmdc:mga08y16_17742_c1 3300050511 Bacteria 7495
264 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
265 nmdc:mga08y16_33871_c1 3300050511 Bacteria 5366
266 nmdc:mga08y16_354722_c1 3300050511 Bacteria 1506
267 nmdc:mga08y16_68309_c1 3300050511 Bacteria 3705
268 nmdc:mga0n895_370895_c1 3300050512 Unclassified 1449
269 nmdc:mga0n895_371881_c1 3300050512 Bacteria 1447
270 nmdc:mga0n895_663193_c1 3300050512 Bacteria 1041
271 nmdc:mga0n895_72_c1 3300050512 Bacteria 58012
272 nmdc:mga0rr50_75023_c1 3300050513 Bacteria 2591
273 nmdc:mga0rr50_79867_c1 3300050513 Bacteria 2520
274 nmdc:mga0rr50_9_c1 3300050513 Bacteria 224716
275 nmdc:mga08x19_38271_c1 3300050514 Bacteria 3047
276 nmdc:mga08x19_3861_c1 3300050514 Bacteria 8917
277 Ga0495619_0160280 3300053085 Bacteria 1554
278 Ga0500641_0001626 3300053096 Bacteria 8004
279 Ga0500628_047635 3300053129 Unclassified 1005
280 Ga0501084_0271112 3300054114 Bacteria 1433
281 Ga0307411_10144434
282 JGI24751J29686_10003689
283 JGI25406J46586_10000457
284 Ga0065712_10075984
285 Ga0065712_10077044
286 Ga0065715_10095940
287 Ga0065715_10110852
288 Ga0065715_10119703
289 Ga0065707_10082985
290 Ga0070683_100188137
291 Ga0070690_100031691
292 Ga0070690_100229276
293 Ga0070670_100008232
294 Ga0070670_100158941
295 Ga0070670_100215355
296 Ga0070666_10001610
297 Ga0070680_100203899
298 Ga0070680_100287690
299 Ga0068868_100146128
300 Ga0070660_100126427
301 Ga0070689_100026378
302 Ga0070687_100036537
303 Ga0070687_100188605
304 Ga0070669_100042645
305 Ga0070675_100004074
306 Ga0070675_100053519
307 Ga0070675_100182055
308 Ga0070675_100184316
309 Ga0070675_100454493
310 Ga0070674_100185351
311 Ga0070659_100220853
312 Ga0070659_100341827
313 Ga0070659_100406419
314 Ga0070667_100013472
315 Ga0070705_100000092
316 Ga0070705_100103980
317 Ga0070708_100016774
318 Ga0070708_100400277
319 Ga0070708_100493957
320 Ga0070662_100300519
321 Ga0070681_10001922
322 Ga0070681_10129313
323 Ga0068867_100342343
324 Ga0070706_100018362
325 Ga0070706_100259421
326 Ga0070707_100045496
327 Ga0070707_100317651
328 Ga0070707_100538083
329 Ga0070698_100079069
330 Ga0070698_100471642
331 Ga0070699_100077119
332 Ga0070699_100080654
333 Ga0070679_100038318
334 Ga0070679_100041567
335 Ga0070684_100153493
336 Ga0070697_100012047
337 Ga0068853_100223131
338 Ga0070672_100141145
339 Ga0070686_100000977
340 Ga0070686_100133308
341 Ga0070695_100088346
342 Ga0068855_100181736
343 Ga0068852_100734805
344 Ga0068859_100025252
345 Ga0068859_100126998
346 Ga0068859_100159215
347 Ga0068864_100343725
348 Ga0068870_10028756
349 Ga0068860_100159264
350 Ga0068860_100781518
351 Ga0081539_10000012
352 Ga0081539_10000211
353 Ga0081539_10001641
354 Ga0097621_100085236
355 Ga0075428_100000042
356 Ga0075428_100009671
357 Ga0075430_100016491
358 Ga0075430_100025581
359 Ga0075430_100035965
360 Ga0075430_100217814
361 Ga0075431_100046007
362 Ga0075431_100152518
363 Ga0075431_100396567
364 Ga0075433_10076058
365 Ga0075434_100000239
366 Ga0075434_100232095
367 Ga0075434_100257278
368 Ga0075434_100563797
369 Ga0075429_100067838
370 Ga0075429_100335829
371 Ga0075436_100000333
372 Ga0075436_100016489
373 Ga0097620_100126997
374 Ga0097620_100159207
375 Ga0075435_100000013
376 Ga0075435_100094253
377 Ga0105240_10304845
378 Ga0111539_10000002
379 Ga0111539_10000149
380 Ga0111539_10057357
381 Ga0111539_10080998
382 Ga0111539_10227308
383 Ga0105247_10059464
384 Ga0114129_10012297
385 Ga0105242_10659081
386 Ga0105248_10049146
387 Ga0105248_10179350
388 Ga0105248_10257387
389 Ga0105248_10789579
390 Ga0105237_10073223
391 Ga0105238_10151920
392 Ga0105249_10179582
393 Ga0157375_10366605
394 Ga0163163_10020326
395 Ga0163163_10051227
396 Ga0157380_10063169
397 Ga0157377_10096890
398 Ga0157377_10206088
399 Ga0207697_10000309
400 Ga0207697_10035575
401 Ga0207688_10010948
402 Ga0207680_10001521
403 Ga0207680_10483417
404 Ga0207705_10316123
405 Ga0207684_10011817
406 Ga0207684_10126710
407 Ga0207707_10120205
408 Ga0207671_10120275
409 Ga0207660_10209677
410 Ga0207660_10668646
411 Ga0207662_10074611
412 Ga0207662_10109825
413 Ga0207657_10001598
414 Ga0207652_10091071
415 Ga0207646_10045890
416 Ga0207646_10748897
417 Ga0207681_10071928
418 Ga0207681_10076991
419 Ga0207694_10237385
420 Ga0207650_10132024
421 Ga0207650_10322622
422 Ga0207650_10581959
423 Ga0207659_10008004
424 Ga0207659_10036691
425 Ga0207659_10146944
426 Ga0207659_10219235
427 Ga0207659_10385197
428 Ga0207664_10132966
429 Ga0207690_10132932
430 Ga0207690_10140581
431 Ga0207690_10475472
432 Ga0207706_10199412
433 Ga0207670_10034231
434 Ga0207691_10155211
435 Ga0207711_10025674
436 Ga0207661_10255863
437 Ga0207679_10080493
438 Ga0207679_10140105
439 Ga0207679_10178058
440 Ga0207667_10371968
441 Ga0207651_10001056
442 Ga0207712_10667747
443 Ga0207640_10010571
444 Ga0207677_10096664
445 Ga0207677_10103476
446 Ga0207703_10280260
447 Ga0207703_10726960
448 Ga0207639_10312458
449 Ga0207648_10350950
450 Ga0207648_10617001
451 Ga0207676_10024132
452 Ga0207676_10296756
453 Ga0207683_10093823
454 Ga0207683_10415339
455 Ga0209970_1008386
456 Ga0210002_1005187
457 Ga0209983_1000870
458 Ga0209971_1001170
459 Ga0209966_1008249
460 Ga0209974_10000493
461 Ga0207428_10000004
462 Ga0207428_10055264
463 Ga0207428_10455204
464 Ga0268265_10111033
465 Ga0268264_10684090
466 Ga0307408_100017160
467 Ga0307508_10054717
468 Ga0307407_10105495
469 Ga0307409_100811340
470 Ga0307411_10389291
471 Ga0307411_10637032
472 Ga0373930_0002934
473 Ga0373950_0036210
474 Ga0373958_0001932
475 Ga0373928_0000193
476 Ga0373929_0004928
477 Ga0373940_0020354
478 Ga0373949_0002694
479 Ga0373952_0000168
480 Ga0373932_0000676
481 Ga0373939_0000207
482 Ga0373941_0001460
483 Ga0373960_0000066
484 Ga0373942_0002579
485 Ga0373961_0000579
486 Ga0373962_0001726
487 Ga0373962_0085506
488 Ga0373931_0000370
489 Ga0373933_0112702
490 Ga0373947_0461239
491 Ga0373937_0384231
492 Ga0439435_0001661
493 Ga0439435_0001965
494 Ga0451577_0132232
495 Ga0451577_0335624
496 Ga0453683_0321884
497 Ga0451576_0043659
498 Ga0451576_0049645
499 Ga0451576_0071616
500 Ga0495629_0001607
501 Ga0495638_0038102
502 Ga0495594_0104622
503 Ga0495643_0004267
504 Ga0495621_0009622
505 Ga0495667_0281381
506 Ga0495659_0025472
507 Ga0495647_0061616
508 Ga0495647_0076518
509 Ga0495658_0127243
510 Ga0495670_0193493
511 Ga0495677_0046700
512 Ga0496102_0479955
513 Ga0496102_0773006
514 Ga0496109_0077043
515 Ga0496109_0295885
516 Ga0496109_0984611
517 Ga0496110_0051252
518 Ga0496111_0261516
519 Ga0496112_0074513
520 Ga0496113_0485161
521 Ga0501034_0038435
522 Ga0501034_0166173
523 Ga0501043_0136118
524 Ga0501046_0328219
525 Ga0501047_0107346
526 Ga0501070_0350641
527 Ga0501072_0040651
528 Ga0501075_0196920
529 Ga0501080_0228635
530 Ga0501081_0371233
531 Ga0501044_0008783
532 Ga0501045_0307108
533 nmdc:mga00v17_50174_c1
534 nmdc:mga05p37_221370_c1
535 nmdc:mga09592_448579_c1
536 nmdc:mga0qj67_10374_c1
537 nmdc:mga0qj67_240115_c1
538 nmdc:mga0qj67_259740_c1
539 nmdc:mga0qj67_28671_c1
540 nmdc:mga0qj67_44123_c1
541 nmdc:mga06r32_5993_c1
542 nmdc:mga06r32_99598_c1
543 nmdc:mga08y16_17742_c1
544 nmdc:mga08y16_2_c1
545 nmdc:mga08y16_33871_c1
546 nmdc:mga08y16_354722_c1
547 nmdc:mga08y16_68309_c1
548 nmdc:mga0n895_370895_c1
549 nmdc:mga0n895_371881_c1
550 nmdc:mga0n895_663193_c1
551 nmdc:mga0n895_72_c1
552 nmdc:mga0rr50_75023_c1
553 nmdc:mga0rr50_79867_c1
554 nmdc:mga0rr50_9_c1
555 nmdc:mga08x19_38271_c1
556 nmdc:mga08x19_3861_c1
557 Ga0495619_0160280
558 Ga0500641_0001626
559 Ga0500628_047635
560 Ga0501084_0271112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

19

259

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b5m-assembly2.cif.gz_B neisseria ap endonuclease bound to the substrate with a cytosine orphan base 0.871 4 232
3g91-assembly1.cif.gz_A 1.2 angstrom structure of the exonuclease iii homologue mth0212 0.8603 5 232
3u8u-assembly2.cif.gz_B crystal structure of human apurinic/apyridinimic endonuclease, ape1 in a new crystal form 0.8582 4 227
4b5m-assembly2.cif.gz_B neisseria ap endonuclease bound to the substrate with a cytosine orphan base 0.8569 4 232
1e9n-assembly1.cif.gz_A a second divalent metal ion in the active site of a new crystal form of human apurinic/apyrimidinic endonuclease, ape1, and its implications for the catalytic mechanism 0.8563 4 227
ID Description Score Start End Superfamily
af_P27864_388_678_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8573 4 232 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8536 4 232 3.60.10.10
4qh9A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.85 4 227 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.85 5 228 3.60.10.10
af_P27864_388_678_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8436 4 232 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A7V8XUG1-F1-model_v4 Endonuclease/exonuclease/phosphatase family protein 0.9725 5 196 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A355F311-F1-model_v4 Exodeoxyribonuclease III 0.9507 5 162 GO:0006281
GO:0008311
GO:0046872
AF-A0A7V8XUG1-F1-model_v4 Endonuclease/exonuclease/phosphatase family protein 0.9479 5 196 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A355F311-F1-model_v4 Exodeoxyribonuclease III 0.9336 5 162 GO:0006281
GO:0008311
GO:0046872
AF-A0A2V7WBN2-F1-model_v4 Exodeoxyribonuclease III 0.9292 5 232 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872

Map