F383774

General Info

Members Datasets Scaffolds Average Seq Length
280 71 280 167

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100186419|Ga0307409_1001864193
Length 171
Sequence VTHRVDQLACHIRRLGNHELNELLLQLPAPCFAALVEIALARPVLPAGLVLRYEPALGVDGWTVVACAPRRQLGTLTRDRDRDPSGRVVYRAWTRAGQPVQFTGSSTWRRRGDAAAALAWVIPASGARCLALAAYVRALPDSALQQLLGGLPRERFDRLLDAAYQPAGSAA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
5 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
6 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
7 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
8 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
9 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
10 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
12 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
13 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
14 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
15 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
16 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
17 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
18 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
19 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
20 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
21 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
22 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
23 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
24 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
25 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
28 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
29 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
30 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
31 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
32 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
33 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
34 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
35 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
36 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
37 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
38 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
39 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
40 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
41 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
42 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
43 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
44 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
45 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
46 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
47 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
51 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
52 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
53 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
54 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
55 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
56 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
57 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
58 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
59 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
60 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
61 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
64 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
65 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
66 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
67 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
68 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
69 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
70 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
71 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10003869 3300003373 Bacteria 3625
2 Ga0081538_10008820 3300005981 Bacteria 8494
3 Ga0081538_10028263 3300005981 Bacteria 3863
4 Ga0081538_10031446 3300005981 Bacteria 3580
5 Ga0081538_10035135 3300005981 Bacteria 3298
6 Ga0081538_10044907 3300005981 Bacteria 2748
7 Ga0081538_10048790 3300005981 Bacteria 2577
8 Ga0081538_10067758 3300005981 Bacteria 1990
9 Ga0081538_10120561 3300005981 Bacteria 1261
10 Ga0081539_10001512 3300005985 Bacteria 39176
11 Ga0075432_10321223 3300006058 Bacteria 648
12 Ga0075428_100011693 3300006844 Bacteria 9769
13 Ga0075428_100022229 3300006844 Bacteria 7022
14 Ga0075428_100050572 3300006844 Bacteria 4557
15 Ga0075428_100052719 3300006844 Bacteria 4457
16 Ga0075428_100268450 3300006844 Bacteria 1836
17 Ga0075428_100979325 3300006844 Unclassified 896
18 Ga0075428_101130477 3300006844 Bacteria 827
19 Ga0075431_100144833 3300006847 Bacteria 2448
20 Ga0075431_100550098 3300006847 Bacteria 1142
21 Ga0075431_100738319 3300006847 Bacteria 960
22 Ga0075434_100146468 3300006871 Bacteria 2382
23 Ga0075429_100010819 3300006880 Bacteria 7889
24 Ga0075429_100017242 3300006880 Bacteria 6247
25 Ga0075429_100029027 3300006880 Bacteria 4803
26 Ga0075429_100255377 3300006880 Bacteria 1535
27 Ga0075429_100450353 3300006880 Unclassified 1128
28 Ga0075429_101110429 3300006880 Bacteria 691
29 Ga0111539_10630914 3300009094 Bacteria 1248
30 Ga0114129_10016362 3300009147 Bacteria 10559
31 Ga0114129_10017333 3300009147 Bacteria 10253
32 Ga0114129_10199652 3300009147 Bacteria 2710
33 Ga0114129_10225665 3300009147 Bacteria 2525
34 Ga0114129_10526540 3300009147 Bacteria 1540
35 Ga0114129_11695922 3300009147 Unclassified 771
36 Ga0114129_11934171 3300009147 Unclassified 714
37 Ga0114129_12600222 3300009147 Bacteria 604
38 Ga0207428_10547949 3300027907 Bacteria 837
39 Ga0307408_100036022 3300031548 Unclassified 3475
40 Ga0307408_100036332 3300031548 Bacteria 3463
41 Ga0307408_100165055 3300031548 Unclassified 1763
42 Ga0307408_100237227 3300031548 Bacteria 1497
43 Ga0307408_100265118 3300031548 Bacteria 1424
44 Ga0307405_10022310 3300031731 Bacteria 3577
45 Ga0307405_10069705 3300031731 Bacteria 2255
46 Ga0307405_10075026 3300031731 Unclassified 2189
47 Ga0307405_10084167 3300031731 Bacteria 2087
48 Ga0307405_10126506 3300031731 Bacteria 1758
49 Ga0307405_10164033 3300031731 Bacteria 1577
50 Ga0307405_10172090 3300031731 Bacteria 1546
51 Ga0307405_10268972 3300031731 Bacteria 1277
52 Ga0307405_10298557 3300031731 Bacteria 1221
53 Ga0307405_10347649 3300031731 Bacteria 1143
54 Ga0307405_10578218 3300031731 Unclassified 913
55 Ga0307405_10619935 3300031731 Bacteria 885
56 Ga0307405_10914668 3300031731 Unclassified 743
57 Ga0307405_11215767 3300031731 Unclassified 652
58 Ga0307413_10113176 3300031824 Bacteria 1821
59 Ga0307413_10134436 3300031824 Bacteria 1698
60 Ga0307413_10171480 3300031824 Bacteria 1536
61 Ga0307413_10263718 3300031824 Bacteria 1286
62 Ga0307413_10310676 3300031824 Bacteria 1200
63 Ga0307413_10521793 3300031824 Unclassified 958
64 Ga0307413_10639121 3300031824 Unclassified 876
65 Ga0307413_11195077 3300031824 Bacteria 661
66 Ga0307410_10014643 3300031852 Bacteria 4623
67 Ga0307410_10029266 3300031852 Bacteria 3506
68 Ga0307410_10037526 3300031852 Unclassified 3166
69 Ga0307410_10049562 3300031852 Bacteria 2820
70 Ga0307410_10054478 3300031852 Bacteria 2712
71 Ga0307410_10090539 3300031852 Bacteria 2170
72 Ga0307410_10104228 3300031852 Bacteria 2039
73 Ga0307410_10105486 3300031852 Bacteria 2029
74 Ga0307410_10146434 3300031852 Bacteria 1753
75 Ga0307410_10150126 3300031852 Unclassified 1734
76 Ga0307410_10209022 3300031852 Bacteria 1494
77 Ga0307410_10215688 3300031852 Bacteria 1473
78 Ga0307410_10234053 3300031852 Bacteria 1420
79 Ga0307410_10259934 3300031852 Bacteria 1354
80 Ga0307410_10457640 3300031852 Unclassified 1042
81 Ga0307410_10621583 3300031852 Unclassified 903
82 Ga0307410_10706895 3300031852 Unclassified 850
83 Ga0307410_10751742 3300031852 Unclassified 826
84 Ga0307406_10003416 3300031901 Bacteria 8652
85 Ga0307406_10140239 3300031901 Bacteria 1710
86 Ga0307406_10155093 3300031901 Unclassified 1639
87 Ga0307406_10212427 3300031901 Unclassified 1432
88 Ga0307406_10370125 3300031901 Bacteria 1126
89 Ga0307406_10481534 3300031901 Bacteria 1002
90 Ga0307406_10513825 3300031901 Unclassified 973
91 Ga0307406_10530720 3300031901 Bacteria 959
92 Ga0307406_10612786 3300031901 Bacteria 899
93 Ga0307406_10616838 3300031901 Bacteria 896
94 Ga0307406_10683562 3300031901 Bacteria 855
95 Ga0307406_11296303 3300031901 Bacteria 635
96 Ga0307407_10005148 3300031903 Bacteria 5640
97 Ga0307407_10005909 3300031903 Bacteria 5374
98 Ga0307407_10115354 3300031903 Bacteria 1693
99 Ga0307407_10313426 3300031903 Unclassified 1098
100 Ga0307407_10315303 3300031903 Archaea 1095
101 Ga0307407_10449477 3300031903 Unclassified 935
102 Ga0307407_10640824 3300031903 Bacteria 795
103 Ga0307407_10664790 3300031903 Bacteria 782
104 Ga0307412_10086076 3300031911 Bacteria 2186
105 Ga0307412_10087056 3300031911 Unclassified 2176
106 Ga0307412_10158844 3300031911 Bacteria 1677
107 Ga0307412_10182166 3300031911 Unclassified 1581
108 Ga0307412_10254675 3300031911 Bacteria 1365
109 Ga0307412_10463102 3300031911 Bacteria 1047
110 Ga0307412_10573718 3300031911 Bacteria 951
111 Ga0307412_10591517 3300031911 Bacteria 938
112 Ga0307409_100002985 3300031995 Bacteria 9018
113 Ga0307409_100007667 3300031995 Bacteria 6478
114 Ga0307409_100011692 3300031995 Bacteria 5550
115 Ga0307409_100040528 3300031995 Unclassified 3469
116 Ga0307409_100047298 3300031995 Unclassified 3264
117 Ga0307409_100067649 3300031995 Bacteria 2822
118 Ga0307409_100076864 3300031995 Bacteria 2679
119 Ga0307409_100084669 3300031995 Viruses 2575
120 Ga0307409_100091715 3300031995 Unclassified 2491
121 Ga0307409_100120193 3300031995 Unclassified 2223
122 Ga0307409_100126517 3300031995 Bacteria 2174
123 Ga0307409_100159056 3300031995 Bacteria 1973
124 Ga0307409_100186419 3300031995 Bacteria 1842
125 Ga0307409_100218597 3300031995 Unclassified 1718
126 Ga0307409_100273017 3300031995 Bacteria 1558
127 Ga0307409_100607764 3300031995 Unclassified 1081
128 Ga0307409_100665790 3300031995 Bacteria 1036
129 Ga0307409_100750813 3300031995 Bacteria 979
130 Ga0307409_100899240 3300031995 Unclassified 899
131 Ga0307409_101088022 3300031995 Unclassified 820
132 Ga0307416_100000939 3300032002 Bacteria 15432
133 Ga0307416_100001056 3300032002 Bacteria 14677
134 Ga0307416_100003172 3300032002 Bacteria 9635
135 Ga0307416_100003549 3300032002 Bacteria 9195
136 Ga0307416_100004332 3300032002 Bacteria 8533
137 Ga0307416_100005593 3300032002 Bacteria 7746
138 Ga0307416_100008927 3300032002 Bacteria 6515
139 Ga0307416_100016832 3300032002 Bacteria 5095
140 Ga0307416_100030539 3300032002 Bacteria 4044
141 Ga0307416_100031390 3300032002 Bacteria 3999
142 Ga0307416_100039620 3300032002 Viruses 3651
143 Ga0307416_100042310 3300032002 Bacteria 3555
144 Ga0307416_100043875 3300032002 Bacteria 3506
145 Ga0307416_100054603 3300032002 Unclassified 3212
146 Ga0307416_100086748 3300032002 Bacteria 2669
147 Ga0307416_100089193 3300032002 Bacteria 2639
148 Ga0307416_100142994 3300032002 Bacteria 2178
149 Ga0307416_100268372 3300032002 Bacteria 1673
150 Ga0307416_100331607 3300032002 Unclassified 1529
151 Ga0307416_100430643 3300032002 Bacteria 1366
152 Ga0307416_100520629 3300032002 Bacteria 1257
153 Ga0307416_100672235 3300032002 Bacteria 1122
154 Ga0307416_100690052 3300032002 Unclassified 1109
155 Ga0307416_100795781 3300032002 Unclassified 1041
156 Ga0307416_100804896 3300032002 Bacteria 1036
157 Ga0307416_101036150 3300032002 Bacteria 924
158 Ga0307416_101180532 3300032002 Bacteria 871
159 Ga0307416_101812240 3300032002 Bacteria 714
160 Ga0307416_102042107 3300032002 Bacteria 676
161 Ga0307414_10426211 3300032004 Unclassified 1158
162 Ga0307414_10592526 3300032004 Bacteria 993
163 Ga0307414_10678903 3300032004 Unclassified 931
164 Ga0307414_11123448 3300032004 Bacteria 726
165 Ga0307414_11260401 3300032004 Unclassified 685
166 Ga0307414_11281372 3300032004 Unclassified 680
167 Ga0307414_11512964 3300032004 Bacteria 625
168 Ga0307414_11572543 3300032004 Bacteria 612
169 Ga0307411_10161474 3300032005 Unclassified 1679
170 Ga0307411_10577545 3300032005 Unclassified 963
171 Ga0307411_10627744 3300032005 Bacteria 927
172 Ga0307411_10839073 3300032005 Unclassified 812
173 Ga0307415_100000191 3300032126 Bacteria 27229
174 Ga0307415_100000624 3300032126 Bacteria 15497
175 Ga0307415_100000998 3300032126 Bacteria 13066
176 Ga0307415_100001162 3300032126 Bacteria 12296
177 Ga0307415_100002789 3300032126 Bacteria 8749
178 Ga0307415_100004529 3300032126 Bacteria 7232
179 Ga0307415_100008229 3300032126 Bacteria 5772
180 Ga0307415_100009013 3300032126 Bacteria 5565
181 Ga0307415_100013810 3300032126 Bacteria 4726
182 Ga0307415_100016086 3300032126 Bacteria 4447
183 Ga0307415_100018848 3300032126 Bacteria 4177
184 Ga0307415_100038194 3300032126 Bacteria 3162
185 Ga0307415_100074108 3300032126 Bacteria 2404
186 Ga0307415_100121677 3300032126 Bacteria 1958
187 Ga0307415_100124997 3300032126 Bacteria 1937
188 Ga0307415_100137027 3300032126 Bacteria 1863
189 Ga0307415_100164935 3300032126 Bacteria 1721
190 Ga0307415_100217045 3300032126 Bacteria 1530
191 Ga0307415_100301303 3300032126 Unclassified 1328
192 Ga0307415_100372809 3300032126 Bacteria 1209
193 Ga0307415_100670084 3300032126 Bacteria 932
194 Ga0307415_100754528 3300032126 Unclassified 884
195 Ga0395899_0861959 3300037312 Unclassified 555
196 Ga0395900_0273680 3300037418 Bacteria 1683
197 Ga0395900_0551523 3300037418 Bacteria 1097
198 Ga0395900_0895461 3300037418 Bacteria 811
199 Ga0395900_1019230 3300037418 Bacteria 747
200 Ga0395898_0327912 3300037466 Bacteria 1460
201 Ga0395898_1291450 3300037466 Unclassified 659
202 Ga0395905_0472181 3300037471 Bacteria 1153
203 Ga0395901_0048845 3300038443 Bacteria 4395
204 Ga0395901_0052370 3300038443 Unclassified 4242
205 Ga0395901_0127394 3300038443 Bacteria 2676
206 Ga0395901_0304771 3300038443 Bacteria 1651
207 Ga0395901_0368028 3300038443 Unclassified 1481
208 Ga0395901_0553269 3300038443 Unclassified 1166
209 Ga0395901_0567383 3300038443 Unclassified 1148
210 Ga0395901_0641693 3300038443 Bacteria 1066
211 Ga0395901_1111847 3300038443 Bacteria 760
212 Ga0439448_0001615 3300042005 Bacteria 5909
213 Ga0439448_0189539 3300042005 Bacteria 720
214 Ga0439448_0252861 3300042005 Bacteria 622
215 Ga0439450_009262 3300042008 Bacteria 1865
216 Ga0439463_001806 3300042016 Bacteria 5570
217 Ga0439463_127364 3300042016 Bacteria 659
218 Ga0450915_013000 3300042119 Unclassified 606
219 Ga0450902_037674 3300042137 Bacteria 820
220 Ga0439458_0051572 3300042157 Unclassified 1016
221 Ga0439444_0017838 3300042437 Unclassified 1223
222 Ga0439440_0033756 3300042993 Unclassified 1221
223 Ga0439440_0038684 3300042993 Archaea 1155
224 Ga0501031_0018616 3300049568 Bacteria 4523
225 Ga0501032_0152806 3300049569 Bacteria 1517
226 Ga0501033_0051190 3300049570 Bacteria 3061
227 Ga0501036_0000266 3300049572 Bacteria 35661
228 Ga0501037_0058285 3300049573 Bacteria 2818
229 Ga0501037_0535679 3300049573 Bacteria 791
230 Ga0501038_0010074 3300049574 Bacteria 8655
231 Ga0501039_0031940 3300049575 Bacteria 4059
232 Ga0501040_0003141 3300049576 Bacteria 10721
233 Ga0501040_0130173 3300049576 Unclassified 1769
234 Ga0501040_0593825 3300049576 Bacteria 800
235 Ga0501041_0000741 3300049577 Bacteria 17464
236 Ga0501041_0419106 3300049577 Bacteria 849
237 Ga0501042_0001219 3300049578 Bacteria 14948
238 Ga0501043_0020407 3300049579 Bacteria 5197
239 Ga0501046_0039070 3300049580 Bacteria 3803
240 Ga0501048_0000100 3300049582 Bacteria 47000
241 Ga0501048_0362427 3300049582 Bacteria 1034
242 Ga0501068_0033176 3300049584 Bacteria 3074
243 Ga0501070_0196862 3300049586 Bacteria 1655
244 Ga0501071_0030323 3300049587 Bacteria 3824
245 Ga0501072_0000478 3300049588 Bacteria 28733
246 Ga0501072_1330883 3300049588 Bacteria 556
247 Ga0501074_0012233 3300049590 Bacteria 6239
248 Ga0501074_0129305 3300049590 Unclassified 1807
249 Ga0501074_1129489 3300049590 Bacteria 550
250 Ga0501075_0002455 3300049591 Bacteria 12359
251 Ga0501075_0413665 3300049591 Bacteria 1028
252 Ga0501076_0000011 3300049592 Bacteria 115142
253 Ga0501076_0055900 3300049592 Bacteria 3131
254 Ga0501077_0000033 3300049593 Bacteria 69645
255 Ga0501079_0008047 3300049741 Bacteria 7988
256 Ga0501080_0011760 3300049742 Bacteria 8022
257 Ga0501081_0000643 3300049743 Bacteria 19939
258 Ga0501035_0046815 3300049822 Bacteria 3888
259 Ga0501044_0292371 3300049823 Bacteria 1560
260 Ga0501045_0000023 3300049824 Bacteria 63531
261 Ga0501045_0071308 3300049824 Unclassified 2557
262 nmdc:mga05p37_12846_c1 3300050507 Bacteria 10015
263 nmdc:mga05p37_134953_c1 3300050507 Bacteria 3028
264 nmdc:mga05p37_13614_c1 3300050507 Bacteria 9748
265 nmdc:mga05p37_152446_c1 3300050507 Bacteria 2826
266 nmdc:mga05p37_1614415_c1 3300050507 Unclassified 638
267 nmdc:mga05p37_25757_c1 3300050507 Bacteria 7154
268 nmdc:mga09592_167047_c1 3300050508 Bacteria 1902
269 nmdc:mga09592_24475_c1 3300050508 Bacteria 4994
270 nmdc:mga09592_681087_c1 3300050508 Bacteria 876
271 nmdc:mga0qj67_140287_c1 3300050509 Unclassified 1959
272 nmdc:mga06r32_301359_c1 3300050510 Bacteria 1589
273 nmdc:mga06r32_619292_c1 3300050510 Bacteria 1052
274 nmdc:mga0n895_89418_c1 3300050512 Bacteria 3080
275 Ga0501084_0000432 3300054114 Bacteria 32240
276 Ga0501084_1141016 3300054114 Bacteria 654
277 Ga0501084_1179697 3300054114 Bacteria 642
278 Ga0501082_0110143 3300060353 Bacteria 2383
279 Ga0501082_0948907 3300060353 Bacteria 752
280 Ga0530510_0000100 3300061734 Bacteria 47053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100754528 Ga0307415_1007545282 136
2 3300042157 Ga0439458_0051572 Ga0439458_0051572_406_915 136
3 3300006844 Ga0075428_100052719 Ga0075428_10005271910 139
4 3300006880 Ga0075429_100010819 Ga0075429_1000108192 139
5 3300032002 Ga0307416_100690052 Ga0307416_1006900523 139
6 3300037418 Ga0395900_0551523 Ga0395900_0551523_444_965 139
7 3300050508 nmdc:mga09592_167047_c1 nmdc:mga09592_167047_c1_1368_1874 139
8 3300050509 nmdc:mga0qj67_140287_c1 nmdc:mga0qj67_140287_c1_1398_1904 139
9 3300031995 Ga0307409_100899240 Ga0307409_1008992402 140
10 3300032002 Ga0307416_100804896 Ga0307416_1008048962 141
11 3300031731 Ga0307405_10022310 Ga0307405_100223103 144
12 3300031852 Ga0307410_10146434 Ga0307410_101464343 144
13 3300031901 Ga0307406_11296303 Ga0307406_112963031 144
14 3300031903 Ga0307407_10115354 Ga0307407_101153542 144
15 3300031995 Ga0307409_100076864 Ga0307409_1000768645 144
16 3300032002 Ga0307416_100031390 Ga0307416_1000313907 144
17 3300032004 Ga0307414_11572543 Ga0307414_115725431 144
18 3300032126 Ga0307415_100018848 Ga0307415_1000188487 144
19 3300042005 Ga0439448_0189539 Ga0439448_0189539_166_672 144
20 3300009147 Ga0114129_10526540 Ga0114129_105265403 146
21 3300031548 Ga0307408_100036332 Ga0307408_1000363324 146
22 3300031548 Ga0307408_100165055 Ga0307408_1001650554 146
23 3300031731 Ga0307405_10069705 Ga0307405_100697052 146
24 3300031731 Ga0307405_11215767 Ga0307405_112157671 146
25 3300031824 Ga0307413_10113176 Ga0307413_101131763 146
26 3300031852 Ga0307410_10105486 Ga0307410_101054863 146
27 3300031852 Ga0307410_10259934 Ga0307410_102599342 146
28 3300031901 Ga0307406_10003416 Ga0307406_100034165 146
29 3300031903 Ga0307407_10005148 Ga0307407_1000514811 146
30 3300031903 Ga0307407_10449477 Ga0307407_104494772 146
31 3300031911 Ga0307412_10087056 Ga0307412_100870561 146
32 3300031911 Ga0307412_10573718 Ga0307412_105737182 146
33 3300031995 Ga0307409_100091715 Ga0307409_1000917153 146
34 3300031995 Ga0307409_100665790 Ga0307409_1006657902 146
35 3300032002 Ga0307416_100000939 Ga0307416_10000093924 146
36 3300032002 Ga0307416_100042310 Ga0307416_1000423105 146
37 3300032002 Ga0307416_100331607 Ga0307416_1003316073 146
38 3300032004 Ga0307414_10678903 Ga0307414_106789032 146
39 3300032126 Ga0307415_100013810 Ga0307415_1000138104 146
40 3300032126 Ga0307415_100016086 Ga0307415_1000160868 146
41 3300032126 Ga0307415_100038194 Ga0307415_1000381944 146
42 3300038443 Ga0395901_0553269 Ga0395901_0553269_168_671 146
43 3300054114 Ga0501084_1141016 Ga0501084_1141016_98_601 146
44 3300005981 Ga0081538_10048790 Ga0081538_100487904 147
45 3300005981 Ga0081538_10067758 Ga0081538_100677583 147
46 3300006844 Ga0075428_100022229 Ga0075428_10002222911 147
47 3300006847 Ga0075431_100144833 Ga0075431_1001448335 147
48 3300006847 Ga0075431_100738319 Ga0075431_1007383192 147
49 3300006880 Ga0075429_100029027 Ga0075429_1000290271 147
50 3300006880 Ga0075429_101110429 Ga0075429_1011104292 147
51 3300009147 Ga0114129_10199652 Ga0114129_101996522 147
52 3300009147 Ga0114129_11934171 Ga0114129_119341712 147
53 3300031731 Ga0307405_10126506 Ga0307405_101265063 147
54 3300031731 Ga0307405_10578218 Ga0307405_105782183 147
55 3300031824 Ga0307413_10134436 Ga0307413_101344363 147
56 3300031824 Ga0307413_10521793 Ga0307413_105217931 147
57 3300031824 Ga0307413_11195077 Ga0307413_111950772 147
58 3300031852 Ga0307410_10029266 Ga0307410_100292664 147
59 3300031852 Ga0307410_10049562 Ga0307410_100495624 147
60 3300031852 Ga0307410_10090539 Ga0307410_100905395 147
61 3300031852 Ga0307410_10209022 Ga0307410_102090224 147
62 3300031852 Ga0307410_10621583 Ga0307410_106215832 147
63 3300031852 Ga0307410_10751742 Ga0307410_107517422 147
64 3300031901 Ga0307406_10155093 Ga0307406_101550932 147
65 3300031901 Ga0307406_10212427 Ga0307406_102124273 147
66 3300031901 Ga0307406_10530720 Ga0307406_105307202 147
67 3300031901 Ga0307406_10612786 Ga0307406_106127862 147
68 3300031911 Ga0307412_10158844 Ga0307412_101588442 147
69 3300031995 Ga0307409_100007667 Ga0307409_1000076676 147
70 3300031995 Ga0307409_100120193 Ga0307409_1001201932 147
71 3300031995 Ga0307409_100159056 Ga0307409_1001590563 147
72 3300032002 Ga0307416_100086748 Ga0307416_1000867483 147
73 3300032002 Ga0307416_100142994 Ga0307416_1001429944 147
74 3300032002 Ga0307416_100520629 Ga0307416_1005206292 147
75 3300032002 Ga0307416_101036150 Ga0307416_1010361502 147
76 3300032002 Ga0307416_101180532 Ga0307416_1011805322 147
77 3300032002 Ga0307416_101812240 Ga0307416_1018122402 147
78 3300032004 Ga0307414_10426211 Ga0307414_104262113 147
79 3300032004 Ga0307414_11512964 Ga0307414_115129641 147
80 3300032005 Ga0307411_10161474 Ga0307411_101614744 147
81 3300032005 Ga0307411_10839073 Ga0307411_108390731 147
82 3300032126 Ga0307415_100008229 Ga0307415_1000082295 147
83 3300032126 Ga0307415_100009013 Ga0307415_10000901312 147
84 3300032126 Ga0307415_100124997 Ga0307415_1001249973 147
85 3300032126 Ga0307415_100137027 Ga0307415_1001370273 147
86 3300038443 Ga0395901_0641693 Ga0395901_0641693_305_811 147
87 3300038443 Ga0395901_1111847 Ga0395901_1111847_227_733 147
88 3300042016 Ga0439463_127364 Ga0439463_127364_77_583 147
89 3300049573 Ga0501037_0535679 Ga0501037_0535679_157_663 147
90 3300049576 Ga0501040_0130173 Ga0501040_0130173_725_1231 147
91 3300049576 Ga0501040_0593825 Ga0501040_0593825_57_563 147
92 3300049577 Ga0501041_0419106 Ga0501041_0419106_176_682 147
93 3300049582 Ga0501048_0362427 Ga0501048_0362427_207_713 147
94 3300049588 Ga0501072_1330883 Ga0501072_1330883_26_532 147
95 3300049590 Ga0501074_0129305 Ga0501074_0129305_468_974 147
96 3300049590 Ga0501074_1129489 Ga0501074_1129489_11_517 147
97 3300049592 Ga0501076_0055900 Ga0501076_0055900_2010_2516 147
98 3300049824 Ga0501045_0071308 Ga0501045_0071308_693_1199 147
99 3300050507 nmdc:mga05p37_134953_c1 nmdc:mga05p37_134953_c1_2429_2938 147
100 3300050507 nmdc:mga05p37_1614415_c1 nmdc:mga05p37_1614415_c1_80_589 147
101 3300050510 nmdc:mga06r32_301359_c1 nmdc:mga06r32_301359_c1_54_563 147
102 3300054114 Ga0501084_1179697 Ga0501084_1179697_11_517 147
103 3300003373 JGI25407J50210_10003869 JGI25407J50210_100038691 148
104 3300005981 Ga0081538_10008820 Ga0081538_100088207 148
105 3300005981 Ga0081538_10028263 Ga0081538_100282633 148
106 3300005981 Ga0081538_10031446 Ga0081538_100314463 148
107 3300005981 Ga0081538_10035135 Ga0081538_100351352 148
108 3300005981 Ga0081538_10044907 Ga0081538_100449076 148
109 3300005981 Ga0081538_10120561 Ga0081538_101205613 148
110 3300005985 Ga0081539_10001512 Ga0081539_1000151219 148
111 3300006058 Ga0075432_10321223 Ga0075432_103212231 148
112 3300006844 Ga0075428_100011693 Ga0075428_10001169312 148
113 3300006844 Ga0075428_100050572 Ga0075428_1000505722 148
114 3300006844 Ga0075428_100268450 Ga0075428_1002684503 148
115 3300006844 Ga0075428_100979325 Ga0075428_1009793252 148
116 3300006844 Ga0075428_101130477 Ga0075428_1011304772 148
117 3300006847 Ga0075431_100550098 Ga0075431_1005500982 148
118 3300006871 Ga0075434_100146468 Ga0075434_1001464685 148
119 3300006880 Ga0075429_100017242 Ga0075429_1000172423 148
120 3300006880 Ga0075429_100255377 Ga0075429_1002553774 148
121 3300006880 Ga0075429_100450353 Ga0075429_1004503532 148
122 3300009094 Ga0111539_10630914 Ga0111539_106309143 148
123 3300009147 Ga0114129_10016362 Ga0114129_100163625 148
124 3300009147 Ga0114129_10017333 Ga0114129_1001733312 148
125 3300009147 Ga0114129_10225665 Ga0114129_102256654 148
126 3300009147 Ga0114129_11695922 Ga0114129_116959222 148
127 3300009147 Ga0114129_12600222 Ga0114129_126002221 148
128 3300027907 Ga0207428_10547949 Ga0207428_105479492 148
129 3300031548 Ga0307408_100036022 Ga0307408_1000360222 148
130 3300031548 Ga0307408_100237227 Ga0307408_1002372272 148
131 3300031548 Ga0307408_100265118 Ga0307408_1002651183 148
132 3300031731 Ga0307405_10075026 Ga0307405_100750265 148
133 3300031731 Ga0307405_10084167 Ga0307405_100841672 148
134 3300031731 Ga0307405_10164033 Ga0307405_101640332 148
135 3300031731 Ga0307405_10172090 Ga0307405_101720903 148
136 3300031731 Ga0307405_10268972 Ga0307405_102689723 148
137 3300031731 Ga0307405_10298557 Ga0307405_102985572 148
138 3300031731 Ga0307405_10347649 Ga0307405_103476493 148
139 3300031731 Ga0307405_10619935 Ga0307405_106199352 148
140 3300031731 Ga0307405_10914668 Ga0307405_109146681 148
141 3300031824 Ga0307413_10171480 Ga0307413_101714803 148
142 3300031824 Ga0307413_10263718 Ga0307413_102637183 148
143 3300031824 Ga0307413_10310676 Ga0307413_103106762 148
144 3300031824 Ga0307413_10639121 Ga0307413_106391212 148
145 3300031852 Ga0307410_10014643 Ga0307410_100146438 148
146 3300031852 Ga0307410_10037526 Ga0307410_100375266 148
147 3300031852 Ga0307410_10054478 Ga0307410_100544786 148
148 3300031852 Ga0307410_10104228 Ga0307410_101042283 148
149 3300031852 Ga0307410_10150126 Ga0307410_101501263 148
150 3300031852 Ga0307410_10215688 Ga0307410_102156884 148
151 3300031852 Ga0307410_10234053 Ga0307410_102340533 148
152 3300031852 Ga0307410_10457640 Ga0307410_104576402 148
153 3300031852 Ga0307410_10706895 Ga0307410_107068952 148
154 3300031901 Ga0307406_10140239 Ga0307406_101402394 148
155 3300031901 Ga0307406_10370125 Ga0307406_103701252 148
156 3300031901 Ga0307406_10481534 Ga0307406_104815341 148
157 3300031901 Ga0307406_10513825 Ga0307406_105138253 148
158 3300031901 Ga0307406_10616838 Ga0307406_106168382 148
159 3300031901 Ga0307406_10683562 Ga0307406_106835622 148
160 3300031903 Ga0307407_10005909 Ga0307407_100059093 148
161 3300031903 Ga0307407_10313426 Ga0307407_103134262 148
162 3300031903 Ga0307407_10315303 Ga0307407_103153032 148
163 3300031903 Ga0307407_10640824 Ga0307407_106408241 148
164 3300031903 Ga0307407_10664790 Ga0307407_106647902 148
165 3300031911 Ga0307412_10086076 Ga0307412_100860765 148
166 3300031911 Ga0307412_10182166 Ga0307412_101821663 148
167 3300031911 Ga0307412_10254675 Ga0307412_102546753 148
168 3300031911 Ga0307412_10463102 Ga0307412_104631022 148
169 3300031911 Ga0307412_10591517 Ga0307412_105915173 148
170 3300031995 Ga0307409_100002985 Ga0307409_1000029858 148
171 3300031995 Ga0307409_100011692 Ga0307409_10001169210 148
172 3300031995 Ga0307409_100040528 Ga0307409_1000405284 148
173 3300031995 Ga0307409_100047298 Ga0307409_1000472985 148
174 3300031995 Ga0307409_100067649 Ga0307409_1000676495 148
175 3300031995 Ga0307409_100084669 Ga0307409_1000846692 148
176 3300031995 Ga0307409_100126517 Ga0307409_1001265174 148
177 3300031995 Ga0307409_100186419 Ga0307409_1001864193 148
178 3300031995 Ga0307409_100218597 Ga0307409_1002185974 148
179 3300031995 Ga0307409_100273017 Ga0307409_1002730173 148
180 3300031995 Ga0307409_100607764 Ga0307409_1006077642 148
181 3300031995 Ga0307409_100750813 Ga0307409_1007508132 148
182 3300031995 Ga0307409_101088022 Ga0307409_1010880222 148
183 3300032002 Ga0307416_100001056 Ga0307416_10000105612 148
184 3300032002 Ga0307416_100003172 Ga0307416_10000317210 148
185 3300032002 Ga0307416_100003549 Ga0307416_1000035496 148
186 3300032002 Ga0307416_100004332 Ga0307416_1000043324 148
187 3300032002 Ga0307416_100005593 Ga0307416_1000055934 148
188 3300032002 Ga0307416_100008927 Ga0307416_1000089279 148
189 3300032002 Ga0307416_100016832 Ga0307416_1000168326 148
190 3300032002 Ga0307416_100030539 Ga0307416_1000305393 148
191 3300032002 Ga0307416_100039620 Ga0307416_1000396203 148
192 3300032002 Ga0307416_100043875 Ga0307416_1000438754 148
193 3300032002 Ga0307416_100054603 Ga0307416_1000546034 148
194 3300032002 Ga0307416_100089193 Ga0307416_1000891936 148
195 3300032002 Ga0307416_100268372 Ga0307416_1002683724 148
196 3300032002 Ga0307416_100430643 Ga0307416_1004306431 148
197 3300032002 Ga0307416_100672235 Ga0307416_1006722353 148
198 3300032002 Ga0307416_100795781 Ga0307416_1007957812 148
199 3300032002 Ga0307416_102042107 Ga0307416_1020421072 148
200 3300032004 Ga0307414_10592526 Ga0307414_105925262 148
201 3300032004 Ga0307414_11123448 Ga0307414_111234482 148
202 3300032004 Ga0307414_11260401 Ga0307414_112604011 148
203 3300032004 Ga0307414_11281372 Ga0307414_112813722 148
204 3300032005 Ga0307411_10577545 Ga0307411_105775452 148
205 3300032005 Ga0307411_10627744 Ga0307411_106277442 148
206 3300032126 Ga0307415_100000191 Ga0307415_1000001914 148
207 3300032126 Ga0307415_100000624 Ga0307415_1000006249 148
208 3300032126 Ga0307415_100000998 Ga0307415_10000099812 148
209 3300032126 Ga0307415_100001162 Ga0307415_10000116210 148
210 3300032126 Ga0307415_100002789 Ga0307415_1000027892 148
211 3300032126 Ga0307415_100004529 Ga0307415_1000045296 148
212 3300032126 Ga0307415_100074108 Ga0307415_1000741083 148
213 3300032126 Ga0307415_100121677 Ga0307415_1001216774 148
214 3300032126 Ga0307415_100164935 Ga0307415_1001649352 148
215 3300032126 Ga0307415_100217045 Ga0307415_1002170452 148
216 3300032126 Ga0307415_100301303 Ga0307415_1003013033 148
217 3300032126 Ga0307415_100372809 Ga0307415_1003728091 148
218 3300032126 Ga0307415_100670084 Ga0307415_1006700842 148
219 3300037312 Ga0395899_0861959 Ga0395899_0861959_29_538 148
220 3300037418 Ga0395900_0273680 Ga0395900_0273680_577_1086 148
221 3300037418 Ga0395900_0895461 Ga0395900_0895461_249_758 148
222 3300037418 Ga0395900_1019230 Ga0395900_1019230_194_703 148
223 3300037466 Ga0395898_0327912 Ga0395898_0327912_612_1121 148
224 3300037466 Ga0395898_1291450 Ga0395898_1291450_59_568 148
225 3300037471 Ga0395905_0472181 Ga0395905_0472181_582_1091 148
226 3300038443 Ga0395901_0048845 Ga0395901_0048845_1512_2021 148
227 3300038443 Ga0395901_0052370 Ga0395901_0052370_3224_3733 148
228 3300038443 Ga0395901_0127394 Ga0395901_0127394_507_1016 148
229 3300038443 Ga0395901_0304771 Ga0395901_0304771_644_1153 148
230 3300038443 Ga0395901_0368028 Ga0395901_0368028_576_1085 148
231 3300038443 Ga0395901_0567383 Ga0395901_0567383_60_569 148
232 3300042005 Ga0439448_0001615 Ga0439448_0001615_441_947 148
233 3300042005 Ga0439448_0252861 Ga0439448_0252861_63_572 148
234 3300042008 Ga0439450_009262 Ga0439450_009262_1143_1649 148
235 3300042016 Ga0439463_001806 Ga0439463_001806_4498_5004 148
236 3300042119 Ga0450915_013000 Ga0450915_013000_81_587 148
237 3300042137 Ga0450902_037674 Ga0450902_037674_153_659 148
238 3300042437 Ga0439444_0017838 Ga0439444_0017838_149_655 148
239 3300042993 Ga0439440_0033756 Ga0439440_0033756_176_685 148
240 3300042993 Ga0439440_0038684 Ga0439440_0038684_135_641 148
241 3300049568 Ga0501031_0018616 Ga0501031_0018616_3044_3553 148
242 3300049569 Ga0501032_0152806 Ga0501032_0152806_848_1357 148
243 3300049570 Ga0501033_0051190 Ga0501033_0051190_753_1262 148
244 3300049572 Ga0501036_0000266 Ga0501036_0000266_22398_22907 148
245 3300049573 Ga0501037_0058285 Ga0501037_0058285_1685_2194 148
246 3300049574 Ga0501038_0010074 Ga0501038_0010074_6512_7021 148
247 3300049575 Ga0501039_0031940 Ga0501039_0031940_2631_3140 148
248 3300049576 Ga0501040_0003141 Ga0501040_0003141_2944_3453 148
249 3300049577 Ga0501041_0000741 Ga0501041_0000741_15811_16320 148
250 3300049578 Ga0501042_0001219 Ga0501042_0001219_1813_2322 148
251 3300049579 Ga0501043_0020407 Ga0501043_0020407_4003_4512 148
252 3300049580 Ga0501046_0039070 Ga0501046_0039070_1928_2437 148
253 3300049582 Ga0501048_0000100 Ga0501048_0000100_16254_16763 148
254 3300049584 Ga0501068_0033176 Ga0501068_0033176_1302_1811 148
255 3300049586 Ga0501070_0196862 Ga0501070_0196862_26_535 148
256 3300049587 Ga0501071_0030323 Ga0501071_0030323_2479_2988 148
257 3300049588 Ga0501072_0000478 Ga0501072_0000478_12729_13238 148
258 3300049590 Ga0501074_0012233 Ga0501074_0012233_1404_1913 148
259 3300049591 Ga0501075_0002455 Ga0501075_0002455_1694_2203 148
260 3300049591 Ga0501075_0413665 Ga0501075_0413665_149_655 148
261 3300049592 Ga0501076_0000011 Ga0501076_0000011_51321_51830 148
262 3300049593 Ga0501077_0000033 Ga0501077_0000033_32181_32690 148
263 3300049741 Ga0501079_0008047 Ga0501079_0008047_6853_7362 148
264 3300049742 Ga0501080_0011760 Ga0501080_0011760_588_1097 148
265 3300049743 Ga0501081_0000643 Ga0501081_0000643_8386_8895 148
266 3300049822 Ga0501035_0046815 Ga0501035_0046815_1093_1602 148
267 3300049823 Ga0501044_0292371 Ga0501044_0292371_583_1092 148
268 3300049824 Ga0501045_0000023 Ga0501045_0000023_35933_36442 148
269 3300050507 nmdc:mga05p37_12846_c1 nmdc:mga05p37_12846_c1_977_1486 148
270 3300050507 nmdc:mga05p37_13614_c1 nmdc:mga05p37_13614_c1_8458_8967 148
271 3300050507 nmdc:mga05p37_152446_c1 nmdc:mga05p37_152446_c1_1399_1908 148
272 3300050507 nmdc:mga05p37_25757_c1 nmdc:mga05p37_25757_c1_6317_6826 148
273 3300050508 nmdc:mga09592_24475_c1 nmdc:mga09592_24475_c1_3572_4081 148
274 3300050508 nmdc:mga09592_681087_c1 nmdc:mga09592_681087_c1_292_801 148
275 3300050510 nmdc:mga06r32_619292_c1 nmdc:mga06r32_619292_c1_216_725 148
276 3300050512 nmdc:mga0n895_89418_c1 nmdc:mga0n895_89418_c1_1070_1579 148
277 3300054114 Ga0501084_0000432 Ga0501084_0000432_4048_4557 148
278 3300060353 Ga0501082_0110143 Ga0501082_0110143_979_1488 148
279 3300060353 Ga0501082_0948907 Ga0501082_0948907_208_717 148
280 3300061734 Ga0530510_0000100 Ga0530510_0000100_13585_14094 148

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.6819 49 81
5jrl-assembly2.cif.gz_B crystal structure of the sphingopyxin i lasso peptide isopeptidase spi-isop (native) 0.6062 46 81
7sfz-assembly1.cif.gz_B crystal structure of mis18a-yippee domain 0.6041 51 82
6euj-assembly3.cif.gz_B the gh43, beta 1,3 galactosidase, bt0265 0.5586 49 88
5ltd-assembly1.cif.gz_A phosphate-bound pichia angusta atg18 0.5525 60 77
ID Description Score Start End Superfamily
af_Q149M9_1223_1377_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7315 51 77 2.120.10.30
af_F4I9T0_2331_2603_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.71 48 80 2.130.10.10
af_Q7ZUV2_124_320_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6922 51 78 2.130.10.10
af_D4A0Q3_80_363_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6787 60 77 2.130.10.10
af_Q10SD2_84_328_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6462 50 77 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5J4T9W0-F1-model_v4 Uncharacterized protein 0.7092 49 83
AF-A0A7C3UYD2-F1-model_v4 T9SS type A sorting domain-containing protein 0.646 51 86
AF-A0A7V2RME0-F1-model_v4 Uncharacterized protein 0.6436 47 87
AF-R7QFL8-F1-model_v4 Uncharacterized protein 0.6333 44 89
AF-A0A699MM05-F1-model_v4 deleted 0.6166 46 84

Feature Viewer

pLDDT pTM Quality
74.59 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map