F383625

General Info

Members Datasets Scaffolds Average Seq Length
280 155 560 213

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10090587|Ga0111539_100905872
Length 243
Sequence MAPTDLASDLDTVSTTCGSGWVNDDNHAWSLRLTHPLPQVVLTVSKWVYMMKKMVAEPPKKANARTTTATAEPFDGATVEKMASQCVTLETELGAIEIAFMPEVAPESVRNFLNLTATGALDTTTFSRVVKGFVIQGGNLSTSEKWSAELAKRMGRRLPDEPGLVKHVRGIVSMARTDEPNSATTHFFILVGPGPHLDSKFSAFGTVTKGIEVADAINQAPVEGEKPEKPVKINRAVVVPCKK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
121 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
122 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
123 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
124 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
128 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
129 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
130 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
131 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
134 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
135 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
138 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
139 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
142 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
143 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
144 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
145 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.79
Rhizosphere 98.21
Stem 0
Stem Tuber 0
Unclassified 15.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10090587 3300009094 Bacteria 3594
2 CNAas_1000100 3300000532 Bacteria 6946
3 JGI24751J29686_10000074 3300002459 Bacteria 56035
4 Ga0065714_10064450 3300005288 Bacteria 77548
5 Ga0065704_10013247 3300005289 Unclassified 1775
6 Ga0065704_10185258 3300005289 Unclassified 1216
7 Ga0065712_10067784 3300005290 Bacteria 36245
8 Ga0065715_10091213 3300005293 Bacteria 5981
9 Ga0065715_10094393 3300005293 Bacteria 4316
10 Ga0065707_10161480 3300005295 Bacteria 1559
11 Ga0070676_10039601 3300005328 Bacteria 2726
12 Ga0070676_10092176 3300005328 Bacteria 1858
13 Ga0070670_100001763 3300005331 Bacteria 17603
14 Ga0070670_100877321 3300005331 Bacteria 812
15 Ga0068869_100092638 3300005334 Unclassified 2275
16 Ga0070680_100020305 3300005336 Bacteria 5272
17 Ga0070680_100676261 3300005336 Unclassified 888
18 Ga0070682_100003337 3300005337 Bacteria 8898
19 Ga0070682_100072378 3300005337 Unclassified 2209
20 Ga0070689_100002181 3300005340 Bacteria 12680
21 Ga0070687_100389560 3300005343 Unclassified 910
22 Ga0070692_10020993 3300005345 Bacteria 3174
23 Ga0070692_10036441 3300005345 Bacteria 2496
24 Ga0070692_10164535 3300005345 Bacteria 1274
25 Ga0070669_100051734 3300005353 Bacteria 3004
26 Ga0070669_100150679 3300005353 Bacteria 1800
27 Ga0070675_100448896 3300005354 Bacteria 1156
28 Ga0070673_100118690 3300005364 Bacteria 2203
29 Ga0070703_10004159 3300005406 Unclassified 4078
30 Ga0070701_10126796 3300005438 Bacteria 1445
31 Ga0070701_10146524 3300005438 Bacteria 1355
32 Ga0070701_10222911 3300005438 Bacteria 1125
33 Ga0070705_100001672 3300005440 Bacteria 11606
34 Ga0070705_100035814 3300005440 Bacteria 2785
35 Ga0070705_100227158 3300005440 Unclassified 1296
36 Ga0070705_100665051 3300005440 Bacteria 814
37 Ga0070700_100000392 3300005441 Bacteria 22584
38 Ga0070700_100033448 3300005441 Bacteria 3097
39 Ga0070700_100046507 3300005441 Unclassified 2681
40 Ga0070700_100052662 3300005441 Bacteria 2538
41 Ga0070700_100407777 3300005441 Bacteria 1024
42 Ga0070694_100008672 3300005444 Bacteria 6227
43 Ga0070694_100029079 3300005444 Bacteria 3604
44 Ga0070694_100045868 3300005444 Bacteria 2931
45 Ga0070694_100049298 3300005444 Bacteria 2836
46 Ga0070694_100092860 3300005444 Bacteria 2121
47 Ga0070662_100096851 3300005457 Bacteria 2226
48 Ga0068867_100068323 3300005459 Bacteria 2652
49 Ga0068867_100073230 3300005459 Bacteria 2565
50 Ga0068867_100406256 3300005459 Bacteria 1150
51 Ga0070706_100087021 3300005467 Bacteria 2896
52 Ga0070698_100119121 3300005471 Bacteria 2601
53 Ga0070699_100303376 3300005518 Unclassified 1433
54 Ga0070672_100174107 3300005543 Bacteria 1791
55 Ga0070672_100315887 3300005543 Bacteria 1327
56 Ga0070686_100003705 3300005544 Bacteria 8396
57 Ga0070686_100426145 3300005544 Unclassified 1015
58 Ga0070695_100054162 3300005545 Bacteria 2581
59 Ga0070695_100191105 3300005545 Unclassified 1457
60 Ga0070695_100237084 3300005545 Bacteria 1322
61 Ga0070695_100286120 3300005545 Bacteria 1213
62 Ga0070695_100563552 3300005545 Unclassified 889
63 Ga0070696_100035937 3300005546 Bacteria 3413
64 Ga0070696_100303254 3300005546 Bacteria 1224
65 Ga0070693_100019797 3300005547 Bacteria 3537
66 Ga0070693_100027893 3300005547 Bacteria 3065
67 Ga0070693_100412595 3300005547 Unclassified 939
68 Ga0070704_100035739 3300005549 Bacteria 3380
69 Ga0070704_100083865 3300005549 Bacteria 2354
70 Ga0070704_100128428 3300005549 Bacteria 1960
71 Ga0070704_100339830 3300005549 Bacteria 1264
72 Ga0070704_100366699 3300005549 Bacteria 1220
73 Ga0068854_100332607 3300005578 Bacteria 1238
74 Ga0068854_101100789 3300005578 Unclassified 708
75 Ga0070702_100103081 3300005615 Bacteria 1754
76 Ga0068859_100019970 3300005617 Bacteria 6727
77 Ga0068859_100027349 3300005617 Bacteria 5721
78 Ga0068859_100042848 3300005617 Bacteria 4547
79 Ga0068859_100161505 3300005617 Bacteria 2319
80 Ga0068859_100854648 3300005617 Bacteria 996
81 Ga0068864_100015017 3300005618 Bacteria 6437
82 Ga0068864_100532507 3300005618 Bacteria 1134
83 Ga0068866_10093428 3300005718 Bacteria 1643
84 Ga0068861_100010814 3300005719 Bacteria 6343
85 Ga0068861_100045557 3300005719 Bacteria 3303
86 Ga0068861_100447634 3300005719 Bacteria 1157
87 Ga0068863_100039386 3300005841 Bacteria 4497
88 Ga0068863_100152611 3300005841 Bacteria 2211
89 Ga0068858_100046934 3300005842 Bacteria 4004
90 Ga0068858_100129088 3300005842 Bacteria 2369
91 Ga0068860_100169033 3300005843 Bacteria 2111
92 Ga0068860_100315779 3300005843 Bacteria 1533
93 Ga0068860_100499079 3300005843 Bacteria 1215
94 Ga0068862_100065728 3300005844 Unclassified 3124
95 Ga0068862_100187504 3300005844 Unclassified 1859
96 Ga0068862_100566214 3300005844 Bacteria 1087
97 Ga0081539_10004138 3300005985 Bacteria 16498
98 Ga0081539_10061522 3300005985 Bacteria 2056
99 Ga0097621_100276368 3300006237 Bacteria 1477
100 Ga0075430_100077217 3300006846 Bacteria 2791
101 Ga0075433_10082783 3300006852 Bacteria 2831
102 Ga0075433_10140881 3300006852 Bacteria 2143
103 Ga0075433_10319652 3300006852 Bacteria 1373
104 Ga0075433_10553878 3300006852 Bacteria 1011
105 Ga0075434_100142280 3300006871 Bacteria 2419
106 Ga0075434_100184237 3300006871 Bacteria 2108
107 Ga0075434_100710927 3300006871 Bacteria 1022
108 Ga0075429_100245851 3300006880 Unclassified 1566
109 Ga0068865_100267907 3300006881 Bacteria 1355
110 Ga0075436_100020742 3300006914 Bacteria 4509
111 Ga0097620_100019971 3300006931 Bacteria 6727
112 Ga0097620_100027350 3300006931 Bacteria 5721
113 Ga0097620_100042848 3300006931 Bacteria 4547
114 Ga0097620_100161498 3300006931 Bacteria 2319
115 Ga0097620_100248662 3300006931 Bacteria 1868
116 Ga0097620_100854687 3300006931 Bacteria 996
117 Ga0111539_10013191 3300009094 Bacteria 10332
118 Ga0111539_10287952 3300009094 Bacteria 1912
119 Ga0105247_10024628 3300009101 Bacteria 3628
120 Ga0114129_10046515 3300009147 Bacteria 6098
121 Ga0114129_10068095 3300009147 Bacteria 4965
122 Ga0114129_10159028 3300009147 Bacteria 3088
123 Ga0114129_10527208 3300009147 Bacteria 1539
124 Ga0114129_11305162 3300009147 Bacteria 899
125 Ga0105243_10312368 3300009148 Bacteria 1429
126 Ga0105243_10418012 3300009148 Bacteria 1250
127 Ga0105241_10021425 3300009174 Bacteria 4777
128 Ga0105241_10190809 3300009174 Unclassified 1706
129 Ga0105241_11131849 3300009174 Unclassified 738
130 Ga0105248_10052003 3300009177 Bacteria 4597
131 Ga0105248_10118493 3300009177 Bacteria 2986
132 Ga0105237_10001285 3300009545 Bacteria 33426
133 Ga0105238_10268227 3300009551 Bacteria 1687
134 Ga0105249_10020568 3300009553 Bacteria 5902
135 Ga0105246_10134127 3300011119 Unclassified 1853
136 Ga0157373_10013614 3300013100 Bacteria 5967
137 Ga0157378_10033129 3300013297 Bacteria 4566
138 Ga0157378_10095500 3300013297 Bacteria 2708
139 Ga0157378_10106203 3300013297 Unclassified 2568
140 Ga0157378_10206100 3300013297 Bacteria 1862
141 Ga0157378_10627728 3300013297 Bacteria 1088
142 Ga0163162_10080041 3300013306 Bacteria 3334
143 Ga0163162_10125814 3300013306 Unclassified 2669
144 Ga0163162_10472796 3300013306 Bacteria 1385
145 Ga0163162_10646819 3300013306 Bacteria 1181
146 Ga0157372_10016718 3300013307 Bacteria 7875
147 Ga0157375_10025047 3300013308 Bacteria 5535
148 Ga0157375_10151065 3300013308 Bacteria 2458
149 Ga0157375_10616752 3300013308 Unclassified 1243
150 Ga0157375_11109347 3300013308 Unclassified 926
151 Ga0163163_10000773 3300014325 Bacteria 27136
152 Ga0163163_11241845 3300014325 Bacteria 808
153 Ga0163163_11243693 3300014325 Bacteria 807
154 Ga0157380_10074452 3300014326 Bacteria 2757
155 Ga0207653_10000852 3300025885 Bacteria 10185
156 Ga0207642_10257923 3300025899 Bacteria 993
157 Ga0207647_10016123 3300025904 Bacteria 5105
158 Ga0207645_10069088 3300025907 Bacteria 2260
159 Ga0207645_10233898 3300025907 Bacteria 1213
160 Ga0207643_10001012 3300025908 Bacteria 16739
161 Ga0207671_10008344 3300025914 Bacteria 8796
162 Ga0207660_10052659 3300025917 Bacteria 2898
163 Ga0207660_10349335 3300025917 Bacteria 1185
164 Ga0207662_10007661 3300025918 Bacteria 5884
165 Ga0207662_10053268 3300025918 Bacteria 2410
166 Ga0207662_10094545 3300025918 Bacteria 1844
167 Ga0207662_10215654 3300025918 Unclassified 1248
168 Ga0207694_10331996 3300025924 Bacteria 1256
169 Ga0207650_10000028 3300025925 Bacteria 236867
170 Ga0207659_10319801 3300025926 Bacteria 1280
171 Ga0207709_10049601 3300025935 Bacteria 2563
172 Ga0207670_10006139 3300025936 Bacteria 6646
173 Ga0207691_10184057 3300025940 Bacteria 1824
174 Ga0207711_10014080 3300025941 Bacteria 6644
175 Ga0207711_10208727 3300025941 Bacteria 1784
176 Ga0207689_10106924 3300025942 Unclassified 2299
177 Ga0207651_10106910 3300025960 Bacteria 2090
178 Ga0207712_10256191 3300025961 Bacteria 1417
179 Ga0207640_10068810 3300025981 Bacteria 2374
180 Ga0207703_10113649 3300026035 Bacteria 2314
181 Ga0207703_10575499 3300026035 Unclassified 1064
182 Ga0207708_10000426 3300026075 Bacteria 32859
183 Ga0207708_10002961 3300026075 Bacteria 12514
184 Ga0207708_10017688 3300026075 Bacteria 5365
185 Ga0207708_10091069 3300026075 Bacteria 2351
186 Ga0207708_10096569 3300026075 Unclassified 2283
187 Ga0207708_10206068 3300026075 Unclassified 1570
188 Ga0207641_10284112 3300026088 Bacteria 1557
189 Ga0207641_10538943 3300026088 Unclassified 1137
190 Ga0207648_10256799 3300026089 Bacteria 1559
191 Ga0207648_10333085 3300026089 Bacteria 1366
192 Ga0207676_10005660 3300026095 Bacteria 8849
193 Ga0207674_10029592 3300026116 Bacteria 5766
194 Ga0207674_10386362 3300026116 Bacteria 1353
195 Ga0207675_100013887 3300026118 Bacteria 7508
196 Ga0207675_100016675 3300026118 Bacteria 6859
197 Ga0207675_100129600 3300026118 Bacteria 2391
198 Ga0207428_10019557 3300027907 Bacteria 5770
199 Ga0207428_10427278 3300027907 Unclassified 968
200 Ga0268265_10078880 3300028380 Bacteria 2591
201 Ga0268265_10224220 3300028380 Unclassified 1647
202 Ga0268265_10910388 3300028380 Bacteria 864
203 Ga0268264_10238864 3300028381 Bacteria 1682
204 Ga0314311_1205231 3300030733 Bacteria 1209
205 Ga0307408_100001988 3300031548 Bacteria 14764
206 Ga0307408_100472854 3300031548 Bacteria 1092
207 Ga0307405_10001871 3300031731 Bacteria 9038
208 Ga0307413_10029309 3300031824 Bacteria 3077
209 Ga0307413_10046038 3300031824 Bacteria 2591
210 Ga0307410_10097375 3300031852 Bacteria 2102
211 Ga0307410_10122928 3300031852 Bacteria 1896
212 Ga0307406_10092461 3300031901 Bacteria 2040
213 Ga0307406_10161478 3300031901 Unclassified 1611
214 Ga0307406_10224030 3300031901 Bacteria 1400
215 Ga0307406_10234490 3300031901 Bacteria 1372
216 Ga0307412_10576498 3300031911 Bacteria 949
217 Ga0307416_100335109 3300032002 Unclassified 1522
218 Ga0307414_10460046 3300032004 Unclassified 1118
219 Ga0307411_10085493 3300032005 Bacteria 2185
220 Ga0307411_10231189 3300032005 Bacteria 1441
221 Ga0307415_100000724 3300032126 Bacteria 14783
222 Ga0373961_0016618 3300035241 Bacteria 1898
223 Ga0395900_0031934 3300037418 Bacteria 5413
224 Ga0395898_0157658 3300037466 Bacteria 2171
225 Ga0439458_0050530 3300042157 Bacteria 1025
226 Ga0451577_0972516 3300042876 Bacteria 763
227 Ga0496103_0326469 3300048906 Bacteria 987
228 Ga0496104_0109099 3300048907 Bacteria 2653
229 Ga0496110_0628515 3300048913 Bacteria 973
230 Ga0496113_0362056 3300048916 Bacteria 1164
231 Ga0496113_0673961 3300048916 Unclassified 826
232 Ga0501291_009632 3300049514 Bacteria 1358
233 Ga0501292_010295 3300049515 Bacteria 1398
234 Ga0501295_004543 3300049518 Bacteria 1813
235 Ga0501298_004141 3300049521 Bacteria 2275
236 Ga0501299_005311 3300049522 Bacteria 1973
237 Ga0501039_0280909 3300049575 Bacteria 1309
238 Ga0501075_0255949 3300049591 Bacteria 1334
239 Ga0501202_007711 3300049652 Bacteria 1950
240 Ga0501206_034668 3300049653 Bacteria 761
241 Ga0501209_031636 3300049656 Bacteria 1345
242 Ga0501216_014489 3300049660 Bacteria 1318
243 Ga0501217_000759 3300049661 Bacteria 5601
244 Ga0501223_001495 3300049663 Bacteria 5391
245 Ga0501223_029585 3300049663 Unclassified 1065
246 Ga0501224_007457 3300049664 Bacteria 1594
247 Ga0501227_000071 3300049665 Bacteria 15600
248 Ga0501230_016963 3300049667 Bacteria 1227
249 Ga0501235_000856 3300049669 Bacteria 6231
250 Ga0501249_016019 3300049679 Bacteria 1607
251 Ga0501249_064247 3300049679 Unclassified 852
252 Ga0501249_080947 3300049679 Unclassified 764
253 Ga0501257_024584 3300049686 Bacteria 1431
254 Ga0501221_008563 3300049704 Bacteria 1780
255 Ga0501225_0006242 3300049705 Bacteria 3482
256 Ga0501234_016378 3300049707 Bacteria 1169
257 Ga0501245_003539 3300049708 Bacteria 2123
258 Ga0501265_009346 3300049762 Bacteria 1184
259 Ga0501270_004310 3300049767 Bacteria 1590
260 Ga0501283_004007 3300049779 Bacteria 1972
261 Ga0501035_0883683 3300049822 Unclassified 709
262 Ga0501204_018871 3300049850 Unclassified 885
263 nmdc:mga05p37_271159_c1 3300050507 Bacteria 2027
264 nmdc:mga05p37_435074_c1 3300050507 Bacteria 1523
265 nmdc:mga05p37_580356_c1 3300050507 Bacteria 1270
266 nmdc:mga05p37_85657_c1 3300050507 Bacteria 3883
267 nmdc:mga05p37_979266_c1 3300050507 Bacteria 901
268 nmdc:mga06r32_258512_c1 3300050510 Bacteria 1729
269 nmdc:mga08y16_189151_c1 3300050511 Bacteria 2136
270 nmdc:mga08y16_249247_c1 3300050511 Bacteria 1835
271 nmdc:mga08y16_333247_c1 3300050511 Bacteria 1561
272 nmdc:mga08y16_399771_c1 3300050511 Bacteria 1406
273 nmdc:mga0n895_215931_c1 3300050512 Bacteria 1947
274 nmdc:mga0n895_289629_c1 3300050512 Bacteria 1660
275 nmdc:mga0n895_533452_c1 3300050512 Bacteria 1180
276 nmdc:mga08x19_16643_c1 3300050514 Bacteria 2801
277 Ga0501084_0116395 3300054114 Bacteria 2247
278 Ga0501084_0484124 3300054114 Bacteria 1046
279 Ga0501082_0652149 3300060353 Unclassified 921
280 Ga0530510_0099220 3300061734 Bacteria 2129
281 Ga0111539_10090587
282 CNAas_1000100
283 JGI24751J29686_10000074
284 Ga0065714_10064450
285 Ga0065704_10013247
286 Ga0065704_10185258
287 Ga0065712_10067784
288 Ga0065715_10091213
289 Ga0065715_10094393
290 Ga0065707_10161480
291 Ga0070676_10039601
292 Ga0070676_10092176
293 Ga0070670_100001763
294 Ga0070670_100877321
295 Ga0068869_100092638
296 Ga0070680_100020305
297 Ga0070680_100676261
298 Ga0070682_100003337
299 Ga0070682_100072378
300 Ga0070689_100002181
301 Ga0070687_100389560
302 Ga0070692_10020993
303 Ga0070692_10036441
304 Ga0070692_10164535
305 Ga0070669_100051734
306 Ga0070669_100150679
307 Ga0070675_100448896
308 Ga0070673_100118690
309 Ga0070703_10004159
310 Ga0070701_10126796
311 Ga0070701_10146524
312 Ga0070701_10222911
313 Ga0070705_100001672
314 Ga0070705_100035814
315 Ga0070705_100227158
316 Ga0070705_100665051
317 Ga0070700_100000392
318 Ga0070700_100033448
319 Ga0070700_100046507
320 Ga0070700_100052662
321 Ga0070700_100407777
322 Ga0070694_100008672
323 Ga0070694_100029079
324 Ga0070694_100045868
325 Ga0070694_100049298
326 Ga0070694_100092860
327 Ga0070662_100096851
328 Ga0068867_100068323
329 Ga0068867_100073230
330 Ga0068867_100406256
331 Ga0070706_100087021
332 Ga0070698_100119121
333 Ga0070699_100303376
334 Ga0070672_100174107
335 Ga0070672_100315887
336 Ga0070686_100003705
337 Ga0070686_100426145
338 Ga0070695_100054162
339 Ga0070695_100191105
340 Ga0070695_100237084
341 Ga0070695_100286120
342 Ga0070695_100563552
343 Ga0070696_100035937
344 Ga0070696_100303254
345 Ga0070693_100019797
346 Ga0070693_100027893
347 Ga0070693_100412595
348 Ga0070704_100035739
349 Ga0070704_100083865
350 Ga0070704_100128428
351 Ga0070704_100339830
352 Ga0070704_100366699
353 Ga0068854_100332607
354 Ga0068854_101100789
355 Ga0070702_100103081
356 Ga0068859_100019970
357 Ga0068859_100027349
358 Ga0068859_100042848
359 Ga0068859_100161505
360 Ga0068859_100854648
361 Ga0068864_100015017
362 Ga0068864_100532507
363 Ga0068866_10093428
364 Ga0068861_100010814
365 Ga0068861_100045557
366 Ga0068861_100447634
367 Ga0068863_100039386
368 Ga0068863_100152611
369 Ga0068858_100046934
370 Ga0068858_100129088
371 Ga0068860_100169033
372 Ga0068860_100315779
373 Ga0068860_100499079
374 Ga0068862_100065728
375 Ga0068862_100187504
376 Ga0068862_100566214
377 Ga0081539_10004138
378 Ga0081539_10061522
379 Ga0097621_100276368
380 Ga0075430_100077217
381 Ga0075433_10082783
382 Ga0075433_10140881
383 Ga0075433_10319652
384 Ga0075433_10553878
385 Ga0075434_100142280
386 Ga0075434_100184237
387 Ga0075434_100710927
388 Ga0075429_100245851
389 Ga0068865_100267907
390 Ga0075436_100020742
391 Ga0097620_100019971
392 Ga0097620_100027350
393 Ga0097620_100042848
394 Ga0097620_100161498
395 Ga0097620_100248662
396 Ga0097620_100854687
397 Ga0111539_10013191
398 Ga0111539_10287952
399 Ga0105247_10024628
400 Ga0114129_10046515
401 Ga0114129_10068095
402 Ga0114129_10159028
403 Ga0114129_10527208
404 Ga0114129_11305162
405 Ga0105243_10312368
406 Ga0105243_10418012
407 Ga0105241_10021425
408 Ga0105241_10190809
409 Ga0105241_11131849
410 Ga0105248_10052003
411 Ga0105248_10118493
412 Ga0105237_10001285
413 Ga0105238_10268227
414 Ga0105249_10020568
415 Ga0105246_10134127
416 Ga0157373_10013614
417 Ga0157378_10033129
418 Ga0157378_10095500
419 Ga0157378_10106203
420 Ga0157378_10206100
421 Ga0157378_10627728
422 Ga0163162_10080041
423 Ga0163162_10125814
424 Ga0163162_10472796
425 Ga0163162_10646819
426 Ga0157372_10016718
427 Ga0157375_10025047
428 Ga0157375_10151065
429 Ga0157375_10616752
430 Ga0157375_11109347
431 Ga0163163_10000773
432 Ga0163163_11241845
433 Ga0163163_11243693
434 Ga0157380_10074452
435 Ga0207653_10000852
436 Ga0207642_10257923
437 Ga0207647_10016123
438 Ga0207645_10069088
439 Ga0207645_10233898
440 Ga0207643_10001012
441 Ga0207671_10008344
442 Ga0207660_10052659
443 Ga0207660_10349335
444 Ga0207662_10007661
445 Ga0207662_10053268
446 Ga0207662_10094545
447 Ga0207662_10215654
448 Ga0207694_10331996
449 Ga0207650_10000028
450 Ga0207659_10319801
451 Ga0207709_10049601
452 Ga0207670_10006139
453 Ga0207691_10184057
454 Ga0207711_10014080
455 Ga0207711_10208727
456 Ga0207689_10106924
457 Ga0207651_10106910
458 Ga0207712_10256191
459 Ga0207640_10068810
460 Ga0207703_10113649
461 Ga0207703_10575499
462 Ga0207708_10000426
463 Ga0207708_10002961
464 Ga0207708_10017688
465 Ga0207708_10091069
466 Ga0207708_10096569
467 Ga0207708_10206068
468 Ga0207641_10284112
469 Ga0207641_10538943
470 Ga0207648_10256799
471 Ga0207648_10333085
472 Ga0207676_10005660
473 Ga0207674_10029592
474 Ga0207674_10386362
475 Ga0207675_100013887
476 Ga0207675_100016675
477 Ga0207675_100129600
478 Ga0207428_10019557
479 Ga0207428_10427278
480 Ga0268265_10078880
481 Ga0268265_10224220
482 Ga0268265_10910388
483 Ga0268264_10238864
484 Ga0314311_1205231
485 Ga0307408_100001988
486 Ga0307408_100472854
487 Ga0307405_10001871
488 Ga0307413_10029309
489 Ga0307413_10046038
490 Ga0307410_10097375
491 Ga0307410_10122928
492 Ga0307406_10092461
493 Ga0307406_10161478
494 Ga0307406_10224030
495 Ga0307406_10234490
496 Ga0307412_10576498
497 Ga0307416_100335109
498 Ga0307414_10460046
499 Ga0307411_10085493
500 Ga0307411_10231189
501 Ga0307415_100000724
502 Ga0373961_0016618
503 Ga0395900_0031934
504 Ga0395898_0157658
505 Ga0439458_0050530
506 Ga0451577_0972516
507 Ga0496103_0326469
508 Ga0496104_0109099
509 Ga0496110_0628515
510 Ga0496113_0362056
511 Ga0496113_0673961
512 Ga0501291_009632
513 Ga0501292_010295
514 Ga0501295_004543
515 Ga0501298_004141
516 Ga0501299_005311
517 Ga0501039_0280909
518 Ga0501075_0255949
519 Ga0501202_007711
520 Ga0501206_034668
521 Ga0501209_031636
522 Ga0501216_014489
523 Ga0501217_000759
524 Ga0501223_001495
525 Ga0501223_029585
526 Ga0501224_007457
527 Ga0501227_000071
528 Ga0501230_016963
529 Ga0501235_000856
530 Ga0501249_016019
531 Ga0501249_064247
532 Ga0501249_080947
533 Ga0501257_024584
534 Ga0501221_008563
535 Ga0501225_0006242
536 Ga0501234_016378
537 Ga0501245_003539
538 Ga0501265_009346
539 Ga0501270_004310
540 Ga0501283_004007
541 Ga0501035_0883683
542 Ga0501204_018871
543 nmdc:mga05p37_271159_c1
544 nmdc:mga05p37_435074_c1
545 nmdc:mga05p37_580356_c1
546 nmdc:mga05p37_85657_c1
547 nmdc:mga05p37_979266_c1
548 nmdc:mga06r32_258512_c1
549 nmdc:mga08y16_189151_c1
550 nmdc:mga08y16_249247_c1
551 nmdc:mga08y16_333247_c1
552 nmdc:mga08y16_399771_c1
553 nmdc:mga0n895_215931_c1
554 nmdc:mga0n895_289629_c1
555 nmdc:mga0n895_533452_c1
556 nmdc:mga08x19_16643_c1
557 Ga0501084_0116395
558 Ga0501084_0484124
559 Ga0501082_0652149
560 Ga0530510_0099220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

86

238

0.91

Map