F383614

General Info

Members Datasets Scaffolds Average Seq Length
280 193 266 306

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10005168|Ga0105240_1000516813
Length 356
Sequence MAFPPKRADDVTGAEVCLLPVPGFGRLTGWRWRLYDRRWLGGGGMVKLATVRRSGGRMAILRRGLAAVAALTLLSTTPALSKPPEFTHWIDGTTPNEPETQVQAIDGDTFVIRQSVETNFEAPFLYLLFGQDSALLLDTGAGGLRIRPTIERLIGEWQAKHGGHAIHLVIAHSHGHGDHHAGDDEFRDRADTEIVGLAPEQVAAFFHIPDWPRSEVRFDLGGRILYIIPTPGHEPAHIMVYDGRTQLLLSGDMLYPGRLYVPLDRFAEFQASADRLARFAQTHPVRALLGAHIEMTTSPGQDYPMRAATHPSEHPLPLPPAAIGELKDAVDKAGPMPAIDRHADFIVYPRPPKPPS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
12 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
13 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
14 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
15 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
16 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
183 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
186 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
187 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
191 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
192 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
193 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 0
Isolates 5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.93
Nodule 0
Rhizoplane 5
Rhizosphere 67.14
Stem 0
Stem Tuber 0
Unclassified 18.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1771442 2162886007 Bacteria 2650
2 JGI24736J21556_1017723 3300001904 Bacteria 1129
3 JGI24739J22299_10002639 3300001989 Bacteria 6899
4 JGI24739J22299_10024932 3300001989 Bacteria 2105
5 JGI24735J21928_10000092 3300002067 Bacteria 33882
6 JGI24738J21930_10005618 3300002075 Bacteria 2992
7 JGI25153J46596_10000075 3300003215 Bacteria 114168
8 rootH2_10199807 3300003320 Bacteria 2520
9 rootH1_10032147 3300003323 Bacteria 1591
10 Ga0055542_1002321 3300003762 Bacteria 6539
11 Ga0065165_1021299 3300005262 Bacteria 2257
12 Ga0065704_10070869 3300005289 Bacteria 15226
13 Ga0070658_10000312 3300005327 Bacteria 41829
14 Ga0070658_10000540 3300005327 Bacteria 32841
15 Ga0070658_10003686 3300005327 Bacteria 12531
16 Ga0070676_10265830 3300005328 Bacteria 1150
17 Ga0068869_100000194 3300005334 Bacteria 31498
18 Ga0070666_10039099 3300005335 Bacteria 3160
19 Ga0070660_100002017 3300005339 Bacteria 14000
20 Ga0070660_100003706 3300005339 Bacteria 10553
21 Ga0070660_100240986 3300005339 Bacteria 1473
22 Ga0070668_100000019 3300005347 Bacteria 98356
23 Ga0070669_100000193 3300005353 Bacteria 53850
24 Ga0070669_100001408 3300005353 Bacteria 17375
25 Ga0070671_100013859 3300005355 Bacteria 6504
26 Ga0070671_100139836 3300005355 Bacteria 2043
27 Ga0070674_100001046 3300005356 Bacteria 14479
28 Ga0070674_100038901 3300005356 Bacteria 3209
29 Ga0070673_100000001 3300005364 Bacteria 239842
30 Ga0070659_100131697 3300005366 Bacteria 2031
31 Ga0070667_100000094 3300005367 Bacteria 111140
32 Ga0070667_100002907 3300005367 Bacteria 14722
33 Ga0070663_100000946 3300005455 Bacteria 15784
34 Ga0070663_100358059 3300005455 Bacteria 1183
35 Ga0070678_100000290 3300005456 Bacteria 23248
36 Ga0070662_100000531 3300005457 Bacteria 23047
37 Ga0068867_100002256 3300005459 Bacteria 13557
38 Ga0068867_100225300 3300005459 Bacteria 1513
39 Ga0068853_100001690 3300005539 Bacteria 16164
40 Ga0070665_100090368 3300005548 Bacteria 3068
41 Ga0068855_100044366 3300005563 Bacteria 5262
42 Ga0068855_100100264 3300005563 Bacteria 3335
43 Ga0068857_100013310 3300005577 Bacteria 7164
44 Ga0068854_100000151 3300005578 Bacteria 48172
45 Ga0068854_100039992 3300005578 Bacteria 3306
46 Ga0068856_100010170 3300005614 Bacteria 9144
47 Ga0068852_100000303 3300005616 Bacteria 33151
48 Ga0068859_100667407 3300005617 Bacteria 1131
49 Ga0068861_100001768 3300005719 Bacteria 13896
50 Ga0068863_100000057 3300005841 Bacteria 123606
51 Ga0081539_10080326 3300005985 Bacteria 1716
52 Ga0075366_10030038 3300006195 Bacteria 3194
53 Ga0097621_100006171 3300006237 Bacteria 8492
54 Ga0068871_100003487 3300006358 Bacteria 10810
55 Ga0068865_100000047 3300006881 Bacteria 68268
56 Ga0097620_100002146 3300006931 Bacteria 20056
57 Ga0097620_100667556 3300006931 Bacteria 1131
58 Ga0105250_10009740 3300009092 Bacteria 4034
59 Ga0105240_10005168 3300009093 Bacteria 19518
60 Ga0105240_10023282 3300009093 Bacteria 8197
61 Ga0105240_10039998 3300009093 Bacteria 6002
62 Ga0105240_10140586 3300009093 Bacteria 2887
63 Ga0105243_10006913 3300009148 Bacteria 8743
64 Ga0105241_10138061 3300009174 Bacteria 1981
65 Ga0105248_10003782 3300009177 Bacteria 16760
66 Ga0105237_10002081 3300009545 Bacteria 25310
67 Ga0105237_10016001 3300009545 Bacteria 7800
68 Ga0105249_10071778 3300009553 Bacteria 3200
69 Ga0105239_10000361 3300010375 Bacteria 66473
70 Ga0105239_10003794 3300010375 Bacteria 18396
71 Ga0105239_10201976 3300010375 Bacteria 2227
72 Ga0105246_10284550 3300011119 Bacteria 1328
73 Ga0157373_10009138 3300013100 Bacteria 7330
74 Ga0157370_10000095 3300013104 Bacteria 100727
75 Ga0157369_10004035 3300013105 Bacteria 17401
76 Ga0157374_10041599 3300013296 Bacteria 4236
77 Ga0157378_10055185 3300013297 Bacteria 3538
78 Ga0163162_10047512 3300013306 Bacteria 4302
79 Ga0157372_10062965 3300013307 Bacteria 4157
80 Ga0157375_10040973 3300013308 Bacteria 4469
81 Ga0157376_10004370 3300014969 Bacteria 9831
82 Ga0163161_10001317 3300017792 Bacteria 18501
83 Ga0207427_100649 3300025231 Bacteria 16841
84 Ga0209026_1001630 3300025250 Bacteria 9544
85 Ga0209148_1000114 3300025254 Bacteria 192073
86 Ga0209233_1000003 3300025261 Bacteria 1607366
87 Ga0209455_1000316 3300025272 Bacteria 48052
88 Ga0209758_1000007 3300025297 Bacteria 1270410
89 Ga0207696_1016911 3300025711 Bacteria 2428
90 Ga0207713_1026421 3300025735 Bacteria 2661
91 Ga0207680_10019192 3300025903 Bacteria 3652
92 Ga0207647_10001365 3300025904 Bacteria 18758
93 Ga0207647_10071195 3300025904 Bacteria 2098
94 Ga0207645_10008275 3300025907 Bacteria 7270
95 Ga0207705_10000184 3300025909 Bacteria 65262
96 Ga0207705_10000346 3300025909 Bacteria 41835
97 Ga0207705_10006625 3300025909 Bacteria 8573
98 Ga0207695_10006628 3300025913 Bacteria 14955
99 Ga0207695_10014261 3300025913 Bacteria 9426
100 Ga0207695_10030767 3300025913 Bacteria 5905
101 Ga0207695_10097341 3300025913 Bacteria 2943
102 Ga0207695_10262073 3300025913 Bacteria 1626
103 Ga0207671_10025033 3300025914 Bacteria 4485
104 Ga0207657_10005345 3300025919 Bacteria 13452
105 Ga0207657_10011251 3300025919 Bacteria 8892
106 Ga0207657_10204988 3300025919 Bacteria 1585
107 Ga0207681_10000176 3300025923 Bacteria 52358
108 Ga0207681_10004669 3300025923 Bacteria 8427
109 Ga0207694_10401695 3300025924 Bacteria 1139
110 Ga0207650_10236068 3300025925 Bacteria 1476
111 Ga0207687_10038848 3300025927 Bacteria 3255
112 Ga0207644_10004325 3300025931 Bacteria 9210
113 Ga0207644_10149768 3300025931 Bacteria 1805
114 Ga0207690_10085084 3300025932 Bacteria 2219
115 Ga0207690_10311949 3300025932 Bacteria 1234
116 Ga0207706_10019636 3300025933 Bacteria 6079
117 Ga0207706_10161963 3300025933 Bacteria 1966
118 Ga0207706_10202316 3300025933 Bacteria 1742
119 Ga0207686_10000298 3300025934 Bacteria 36166
120 Ga0207709_10000005 3300025935 Bacteria 806813
121 Ga0207709_10003046 3300025935 Bacteria 10154
122 Ga0207709_10061265 3300025935 Bacteria 2350
123 Ga0207669_10000059 3300025937 Bacteria 54857
124 Ga0207669_10084421 3300025937 Bacteria 2046
125 Ga0207704_10000006 3300025938 Bacteria 220005
126 Ga0207711_10005981 3300025941 Bacteria 10285
127 Ga0207689_10003627 3300025942 Bacteria 14110
128 Ga0207667_10000071 3300025949 Bacteria 178355
129 Ga0207667_10036383 3300025949 Bacteria 5277
130 Ga0207667_10152016 3300025949 Bacteria 2382
131 Ga0207651_10000001 3300025960 Bacteria 516823
132 Ga0207668_10000059 3300025972 Bacteria 91172
133 Ga0207668_10006231 3300025972 Bacteria 7044
134 Ga0207640_10000263 3300025981 Bacteria 35443
135 Ga0207640_10010577 3300025981 Bacteria 5205
136 Ga0207640_10033856 3300025981 Bacteria 3183
137 Ga0207640_10182179 3300025981 Bacteria 1576
138 Ga0207658_10000072 3300025986 Bacteria 112469
139 Ga0207639_10001049 3300026041 Bacteria 18782
140 Ga0207678_10000351 3300026067 Bacteria 41854
141 Ga0207678_10120801 3300026067 Bacteria 2236
142 Ga0207702_10009114 3300026078 Bacteria 8355
143 Ga0207641_10000096 3300026088 Bacteria 123585
144 Ga0207648_10004651 3300026089 Bacteria 14047
145 Ga0207648_10075330 3300026089 Bacteria 2942
146 Ga0207674_10016839 3300026116 Bacteria 7988
147 Ga0207675_100000016 3300026118 Bacteria 126353
148 Ga0207683_10001779 3300026121 Bacteria 19072
149 Ga0207698_10004700 3300026142 Bacteria 8353
150 Ga0207698_10150005 3300026142 Bacteria 2022
151 Ga0268266_10007677 3300028379 Bacteria 9685
152 Ga0268265_10012808 3300028380 Bacteria 5693
153 Ga0268264_10011899 3300028381 Bacteria 7168
154 Ga0307517_10006006 3300028786 Bacteria 18095
155 Ga0307513_10016728 3300031456 Bacteria 8826
156 Ga0307412_10000539 3300031911 Bacteria 22481
157 Ga0307412_10191724 3300031911 Bacteria 1546
158 Ga0307411_10279999 3300032005 Bacteria 1327
159 Ga0395899_0000754 3300037312 Bacteria 32025
160 Ga0395900_0088021 3300037418 Bacteria 3192
161 Ga0395905_0077124 3300037471 Bacteria 3123
162 Ga0439448_0017056 3300042005 Bacteria 2215
163 Ga0466972_0003465 3300044658 Bacteria 7828
164 Ga0466966_0023364 3300044684 Bacteria 4048
165 Ga0466961_0025600 3300044693 Bacteria 3793
166 Ga0466964_0110838 3300044706 Bacteria 1223
167 Ga0466970_0002464 3300044765 Bacteria 8950
168 Ga0466957_0078467 3300044842 Bacteria 2053
169 Ga0466960_0006865 3300044901 Bacteria 4590
170 Ga0466959_0287489 3300045049 Bacteria 1127
171 Ga0495650_0000116 3300046471 Bacteria 189814
172 Ga0495650_0000645 3300046471 Bacteria 46135
173 Ga0495584_0058826 3300046491 Bacteria 1933
174 Ga0495585_0001312 3300046492 Bacteria 19806
175 Ga0495607_0032619 3300046501 Bacteria 3177
176 Ga0495583_0001297 3300046506 Bacteria 26035
177 Ga0495583_0001480 3300046506 Bacteria 23510
178 Ga0495606_0000936 3300046507 Bacteria 43004
179 Ga0495606_0001811 3300046507 Bacteria 27176
180 Ga0495606_0104614 3300046507 Bacteria 1717
181 Ga0495610_0000013 3300046512 Bacteria 465872
182 Ga0495616_0000192 3300046513 Bacteria 50986
183 Ga0495620_0014768 3300046515 Bacteria 3960
184 Ga0495632_0000370 3300046519 Bacteria 42724
185 Ga0495643_0002339 3300046522 Bacteria 15224
186 Ga0495643_0015187 3300046522 Bacteria 4559
187 Ga0495648_0000498 3300046524 Bacteria 42255
188 Ga0495663_0000949 3300046525 Bacteria 9678
189 Ga0495642_0005579 3300046528 Bacteria 4834
190 Ga0495668_0010372 3300046616 Bacteria 5639
191 Ga0495611_0043679 3300046648 Bacteria 2004
192 Ga0495625_0002639 3300046660 Bacteria 19152
193 Ga0495625_0046653 3300046660 Bacteria 3125
194 Ga0495649_0022272 3300046694 Bacteria 3546
195 Ga0495649_0031690 3300046694 Bacteria 2914
196 Ga0495600_0016684 3300046809 Bacteria 4665
197 Ga0495683_0000453 3300047323 Bacteria 32191
198 Ga0495687_000285 3300047443 Bacteria 66562
199 Ga0495681_0000017 3300047470 Bacteria 178067
200 Ga0495681_0001533 3300047470 Bacteria 17242
201 Ga0496102_0000092 3300048905 Bacteria 125879
202 Ga0496102_0000445 3300048905 Bacteria 47017
203 Ga0496103_0000021 3300048906 Bacteria 229062
204 Ga0496103_0000432 3300048906 Bacteria 36457
205 Ga0496104_0000131 3300048907 Bacteria 69658
206 Ga0496104_0010902 3300048907 Bacteria 8130
207 Ga0496105_0000111 3300048908 Bacteria 55868
208 Ga0496109_0122152 3300048912 Bacteria 2427
209 Ga0496110_0009175 3300048913 Bacteria 7990
210 Ga0496112_0034238 3300048915 Bacteria 4942
211 Ga0496113_0002186 3300048916 Bacteria 11286
212 Ga0496114_0001167 3300048917 Bacteria 19860
213 Ga0496115_0000038 3300048918 Bacteria 125104
214 Ga0496116_0006962 3300048919 Bacteria 10131
215 Ga0496117_0000173 3300048920 Bacteria 133415
216 Ga0496117_0004836 3300048920 Bacteria 14564
217 Ga0496118_0000131 3300048921 Bacteria 133116
218 Ga0496118_0021609 3300048921 Bacteria 5657
219 Ga0496118_0028591 3300048921 Bacteria 4692
220 Ga0496118_0045859 3300048921 Bacteria 3405
221 Ga0496119_0000339 3300048922 Bacteria 65402
222 Ga0496119_0020390 3300048922 Bacteria 4838
223 Ga0496120_0000334 3300048923 Bacteria 78728
224 Ga0496120_0003689 3300048923 Bacteria 13679
225 Ga0496120_0048733 3300048923 Bacteria 2436
226 Ga0496121_0000072 3300048924 Bacteria 244975
227 Ga0496121_0000209 3300048924 Bacteria 129740
228 Ga0496121_0004513 3300048924 Bacteria 18645
229 Ga0496121_0005868 3300048924 Bacteria 15550
230 Ga0496121_0007529 3300048924 Bacteria 13129
231 Ga0496121_0030059 3300048924 Bacteria 5001
232 Ga0496122_0001686 3300048925 Bacteria 34241
233 Ga0496122_0004078 3300048925 Bacteria 18506
234 Ga0496122_0009525 3300048925 Bacteria 10210
235 Ga0496123_0000367 3300048926 Bacteria 84634
236 Ga0496123_0073637 3300048926 Bacteria 2118
237 Ga0496123_0106195 3300048926 Bacteria 1618
238 Ga0496124_0000166 3300048927 Bacteria 133634
239 Ga0496124_0001053 3300048927 Bacteria 43548
240 Ga0496124_0003751 3300048927 Bacteria 18305
241 Ga0496124_0006240 3300048927 Bacteria 13059
242 Ga0496124_0262966 3300048927 Bacteria 1268
243 Ga0496125_0000390 3300048928 Bacteria 81748
244 Ga0496125_0002118 3300048928 Bacteria 26680
245 Ga0496125_0018577 3300048928 Bacteria 6601
246 Ga0496126_0000222 3300048929 Bacteria 123936
247 Ga0496126_0000367 3300048929 Bacteria 93102
248 Ga0496126_0007283 3300048929 Bacteria 12162
249 Ga0496126_0035226 3300048929 Bacteria 4693
250 Ga0496126_0139622 3300048929 Bacteria 2087
251 Ga0500643_000503 3300053087 Bacteria 27831
252 Ga0500643_007250 3300053087 Bacteria 4509
253 Ga0500595_002611 3300053119 Bacteria 8786
254 Ga0500608_013041 3300053122 Bacteria 3671
255 Ga0500608_045005 3300053122 Bacteria 2120
256 Ga0500559_0020525 3300053136 Bacteria 2794
257 Ga0500559_0030105 3300053136 Bacteria 2326
258 Ga0500564_033485 3300053138 Bacteria 2371
259 Ga0500573_0093843 3300053140 Bacteria 1693
260 Ga0500604_0010815 3300053151 Bacteria 2444
261 Ga0500616_0023686 3300053153 Bacteria 3418
262 Ga0500627_0001916 3300053158 Bacteria 5977
263 Ga0500636_0000360 3300053177 Bacteria 24978
264 Ga0500567_000338 3300053723 Bacteria 15258
265 Ga0500625_000007 3300053729 Bacteria 177638
266 Ga0500661_023069 3300055283 Bacteria 1102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10140586 Ga0105240_101405862 283
2 3300025913 Ga0207695_10097341 Ga0207695_100973412 283
3 3300025935 Ga0207709_10061265 Ga0207709_100612652 284
4 3300044842 Ga0466957_0078467 Ga0466957_0078467_708_1637 284
5 3300005616 Ga0068852_100000303 Ga0068852_1000003033 286
6 3300026142 Ga0207698_10004700 Ga0207698_1000470011 286
7 3300013105 Ga0157369_10004035 Ga0157369_100040359 288
8 3300025231 Ga0207427_100649 Ga0207427_10064912 288
9 3300025250 Ga0209026_1001630 Ga0209026_10016306 288
10 3300025261 Ga0209233_1000003 Ga0209233_1000003540 288
11 3300037418 Ga0395900_0088021 Ga0395900_0088021_34_972 288
12 3300005339 Ga0070660_100003706 Ga0070660_10000370615 289
13 3300005563 Ga0068855_100044366 Ga0068855_1000443666 289
14 3300005577 Ga0068857_100013310 Ga0068857_1000133108 289
15 3300010375 Ga0105239_10201976 Ga0105239_102019763 289
16 3300025919 Ga0207657_10005345 Ga0207657_1000534510 289
17 3300025949 Ga0207667_10036383 Ga0207667_100363836 289
18 3300026116 Ga0207674_10016839 Ga0207674_100168399 289
19 3300037312 Ga0395899_0000754 Ga0395899_0000754_20013_20951 289
20 3300037471 Ga0395905_0077124 Ga0395905_0077124_2111_3052 290
21 3300046648 Ga0495611_0043679 Ga0495611_0043679_87_986 290
22 3300005356 Ga0070674_100038901 Ga0070674_1000389013 291
23 3300005614 Ga0068856_100010170 Ga0068856_1000101704 291
24 3300009093 Ga0105240_10023282 Ga0105240_100232821 291
25 3300010375 Ga0105239_10000361 Ga0105239_1000036119 291
26 3300025913 Ga0207695_10014261 Ga0207695_100142613 291
27 3300025937 Ga0207669_10084421 Ga0207669_100844212 291
28 3300026078 Ga0207702_10009114 Ga0207702_100091145 291
29 3300031911 Ga0307412_10191724 Ga0307412_101917242 291
30 3300032005 Ga0307411_10279999 Ga0307411_102799991 291
31 3300048924 Ga0496121_0000072 Ga0496121_0000072_78009_78995 291
32 3300048929 Ga0496126_0007283 Ga0496126_0007283_10334_11320 291
33 iso_pu_bacteria 2928526807 2928529184 291
34 iso_pu_bacteria 2928968154 2928968725 291
35 3300046501 Ga0495607_0032619 Ga0495607_0032619_153_1097 292
36 3300005335 Ga0070666_10039099 Ga0070666_100390992 293
37 3300005347 Ga0070668_100000019 Ga0070668_10000001915 293
38 3300005353 Ga0070669_100001408 Ga0070669_1000014086 293
39 3300005367 Ga0070667_100000094 Ga0070667_10000009431 293
40 3300005841 Ga0068863_100000057 Ga0068863_10000005731 293
41 3300025903 Ga0207680_10019192 Ga0207680_100191923 293
42 3300025913 Ga0207695_10262073 Ga0207695_102620731 293
43 3300025923 Ga0207681_10004669 Ga0207681_100046696 293
44 3300025924 Ga0207694_10401695 Ga0207694_104016952 293
45 3300025972 Ga0207668_10000059 Ga0207668_1000005962 293
46 3300025986 Ga0207658_10000072 Ga0207658_1000007287 293
47 3300026088 Ga0207641_10000096 Ga0207641_1000009630 293
48 3300028381 Ga0268264_10011899 Ga0268264_100118997 293
49 3300031456 Ga0307513_10016728 Ga0307513_100167284 293
50 3300046507 Ga0495606_0000936 Ga0495606_0000936_11593_12483 293
51 iso_pu_bacteria 2599185359 2600228842 294
52 iso_pu_bacteria 2818991466 2819714678 294
53 3300005334 Ga0068869_100000194 Ga0068869_10000019413 295
54 3300005364 Ga0070673_100000001 Ga0070673_100000001238 295
55 3300005459 Ga0068867_100002256 Ga0068867_1000022563 295
56 3300006881 Ga0068865_100000047 Ga0068865_10000004728 295
57 3300013297 Ga0157378_10055185 Ga0157378_100551853 295
58 3300013308 Ga0157375_10040973 Ga0157375_100409735 295
59 3300014969 Ga0157376_10004370 Ga0157376_100043705 295
60 3300025907 Ga0207645_10008275 Ga0207645_100082754 295
61 3300025927 Ga0207687_10038848 Ga0207687_100388484 295
62 3300025934 Ga0207686_10000298 Ga0207686_1000029829 295
63 3300025935 Ga0207709_10003046 Ga0207709_100030466 295
64 3300025938 Ga0207704_10000006 Ga0207704_1000000637 295
65 3300025942 Ga0207689_10003627 Ga0207689_100036276 295
66 3300025960 Ga0207651_10000001 Ga0207651_10000001236 295
67 3300026089 Ga0207648_10004651 Ga0207648_100046514 295
68 3300048926 Ga0496123_0106195 Ga0496123_0106195_400_1296 295
69 3300048927 Ga0496124_0003751 Ga0496124_0003751_10244_11140 295
70 3300005327 Ga0070658_10000540 Ga0070658_1000054019 296
71 3300009177 Ga0105248_10003782 Ga0105248_1000378216 296
72 3300009545 Ga0105237_10002081 Ga0105237_1000208119 296
73 3300017792 Ga0163161_10001317 Ga0163161_1000131713 296
74 3300025909 Ga0207705_10000184 Ga0207705_1000018428 296
75 3300048924 Ga0496121_0004513 Ga0496121_0004513_17381_18280 296
76 3300005327 Ga0070658_10003686 Ga0070658_100036864 297
77 3300005366 Ga0070659_100131697 Ga0070659_1001316972 297
78 3300005455 Ga0070663_100000946 Ga0070663_1000009463 297
79 3300005539 Ga0068853_100001690 Ga0068853_1000016903 297
80 3300005578 Ga0068854_100000151 Ga0068854_1000001512 297
81 3300006237 Ga0097621_100006171 Ga0097621_1000061715 297
82 3300006358 Ga0068871_100003487 Ga0068871_1000034877 297
83 3300009174 Ga0105241_10138061 Ga0105241_101380612 297
84 3300009545 Ga0105237_10016001 Ga0105237_100160013 297
85 3300010375 Ga0105239_10003794 Ga0105239_1000379410 297
86 3300013100 Ga0157373_10009138 Ga0157373_100091388 297
87 3300013296 Ga0157374_10041599 Ga0157374_100415992 297
88 3300025272 Ga0209455_1000316 Ga0209455_100031633 297
89 3300025909 Ga0207705_10006625 Ga0207705_100066254 297
90 3300025914 Ga0207671_10025033 Ga0207671_100250333 297
91 3300025932 Ga0207690_10311949 Ga0207690_103119491 297
92 3300025981 Ga0207640_10000263 Ga0207640_1000026324 297
93 3300025981 Ga0207640_10010577 Ga0207640_100105773 297
94 3300026041 Ga0207639_10001049 Ga0207639_1000104913 297
95 3300026067 Ga0207678_10000351 Ga0207678_1000035128 297
96 3300031911 Ga0307412_10000539 Ga0307412_1000053910 297
97 3300048923 Ga0496120_0048733 Ga0496120_0048733_1232_2137 297
98 3300048926 Ga0496123_0073637 Ga0496123_0073637_162_1067 297
99 3300048927 Ga0496124_0001053 Ga0496124_0001053_11865_12770 297
100 3300048927 Ga0496124_0262966 Ga0496124_0262966_110_1015 297
101 3300048929 Ga0496126_0139622 Ga0496126_0139622_1100_2005 297
102 iso_pu_bacteria 2928959182 2928961703 297
103 3300005455 Ga0070663_100358059 Ga0070663_1003580592 298
104 3300005617 Ga0068859_100667407 Ga0068859_1006674072 298
105 3300006931 Ga0097620_100667556 Ga0097620_1006675562 298
106 3300011119 Ga0105246_10284550 Ga0105246_102845502 298
107 3300025932 Ga0207690_10085084 Ga0207690_100850843 298
108 3300025933 Ga0207706_10161963 Ga0207706_101619632 298
109 3300025933 Ga0207706_10202316 Ga0207706_102023162 298
110 3300026067 Ga0207678_10120801 Ga0207678_101208012 298
111 3300042005 Ga0439448_0017056 Ga0439448_0017056_380_1291 298
112 3300048921 Ga0496118_0021609 Ga0496118_0021609_2708_3619 298
113 3300048922 Ga0496119_0020390 Ga0496119_0020390_292_1203 298
114 3300048928 Ga0496125_0018577 Ga0496125_0018577_1944_2855 298
115 3300048929 Ga0496126_0035226 Ga0496126_0035226_2770_3681 298
116 iso_pu_bacteria 2643221622 2644127056 298
117 iso_pu_bacteria 2739367664 2739649589 298
118 iso_pu_bacteria 2739367865 2740028062 298
119 iso_pu_bacteria 2928100450 2928103775 298
120 3300044684 Ga0466966_0023364 Ga0466966_0023364_1374_2312 301
121 3300053122 Ga0500608_045005 Ga0500608_045005_452_1378 301
122 2162886007 SwRhRL2b_contig_1771442 SwRhRL2b_0514.00007370 302
123 3300001904 JGI24736J21556_1017723 JGI24736J21556_10177231 302
124 3300001989 JGI24739J22299_10002639 JGI24739J22299_100026392 302
125 3300001989 JGI24739J22299_10024932 JGI24739J22299_100249322 302
126 3300002067 JGI24735J21928_10000092 JGI24735J21928_100000924 302
127 3300002075 JGI24738J21930_10005618 JGI24738J21930_100056182 302
128 3300003215 JGI25153J46596_10000075 JGI25153J46596_1000007586 302
129 3300003320 rootH2_10199807 rootH2_101998072 302
130 3300003323 rootH1_10032147 rootH1_100321472 302
131 3300003762 Ga0055542_1002321 Ga0055542_10023215 302
132 3300005262 Ga0065165_1021299 Ga0065165_10212992 302
133 3300005289 Ga0065704_10070869 Ga0065704_100708692 302
134 3300005327 Ga0070658_10000312 Ga0070658_1000031226 302
135 3300005328 Ga0070676_10265830 Ga0070676_102658301 302
136 3300005339 Ga0070660_100002017 Ga0070660_10000201710 302
137 3300005339 Ga0070660_100240986 Ga0070660_1002409862 302
138 3300005353 Ga0070669_100000193 Ga0070669_10000019342 302
139 3300005355 Ga0070671_100013859 Ga0070671_1000138591 302
140 3300005355 Ga0070671_100139836 Ga0070671_1001398362 302
141 3300005356 Ga0070674_100001046 Ga0070674_10000104620 302
142 3300005367 Ga0070667_100002907 Ga0070667_1000029076 302
143 3300005456 Ga0070678_100000290 Ga0070678_10000029016 302
144 3300005457 Ga0070662_100000531 Ga0070662_1000005313 302
145 3300005459 Ga0068867_100225300 Ga0068867_1002253001 302
146 3300005548 Ga0070665_100090368 Ga0070665_1000903682 302
147 3300005563 Ga0068855_100100264 Ga0068855_1001002642 302
148 3300005578 Ga0068854_100039992 Ga0068854_1000399922 302
149 3300005719 Ga0068861_100001768 Ga0068861_10000176812 302
150 3300005985 Ga0081539_10080326 Ga0081539_100803263 302
151 3300006195 Ga0075366_10030038 Ga0075366_100300383 302
152 3300006931 Ga0097620_100002146 Ga0097620_10000214610 302
153 3300009092 Ga0105250_10009740 Ga0105250_100097403 302
154 3300009093 Ga0105240_10005168 Ga0105240_1000516813 302
155 3300009093 Ga0105240_10039998 Ga0105240_100399983 302
156 3300009148 Ga0105243_10006913 Ga0105243_100069134 302
157 3300009553 Ga0105249_10071778 Ga0105249_100717782 302
158 3300013104 Ga0157370_10000095 Ga0157370_1000009569 302
159 3300013306 Ga0163162_10047512 Ga0163162_100475122 302
160 3300013307 Ga0157372_10062965 Ga0157372_100629652 302
161 3300025254 Ga0209148_1000114 Ga0209148_1000114166 302
162 3300025297 Ga0209758_1000007 Ga0209758_10000071107 302
163 3300025711 Ga0207696_1016911 Ga0207696_10169113 302
164 3300025735 Ga0207713_1026421 Ga0207713_10264213 302
165 3300025904 Ga0207647_10001365 Ga0207647_100013654 302
166 3300025904 Ga0207647_10071195 Ga0207647_100711951 302
167 3300025909 Ga0207705_10000346 Ga0207705_1000034624 302
168 3300025913 Ga0207695_10006628 Ga0207695_100066288 302
169 3300025913 Ga0207695_10030767 Ga0207695_100307676 302
170 3300025919 Ga0207657_10011251 Ga0207657_100112513 302
171 3300025919 Ga0207657_10204988 Ga0207657_102049882 302
172 3300025923 Ga0207681_10000176 Ga0207681_1000017641 302
173 3300025925 Ga0207650_10236068 Ga0207650_102360682 302
174 3300025931 Ga0207644_10004325 Ga0207644_100043252 302
175 3300025931 Ga0207644_10149768 Ga0207644_101497682 302
176 3300025933 Ga0207706_10019636 Ga0207706_100196364 302
177 3300025935 Ga0207709_10000005 Ga0207709_10000005781 302
178 3300025937 Ga0207669_10000059 Ga0207669_1000005932 302
179 3300025941 Ga0207711_10005981 Ga0207711_1000598111 302
180 3300025949 Ga0207667_10000071 Ga0207667_1000007160 302
181 3300025949 Ga0207667_10152016 Ga0207667_101520162 302
182 3300025972 Ga0207668_10006231 Ga0207668_100062316 302
183 3300025981 Ga0207640_10033856 Ga0207640_100338562 302
184 3300025981 Ga0207640_10182179 Ga0207640_101821792 302
185 3300026089 Ga0207648_10075330 Ga0207648_100753302 302
186 3300026118 Ga0207675_100000016 Ga0207675_10000001645 302
187 3300026121 Ga0207683_10001779 Ga0207683_1000177915 302
188 3300026142 Ga0207698_10150005 Ga0207698_101500052 302
189 3300028379 Ga0268266_10007677 Ga0268266_100076772 302
190 3300028380 Ga0268265_10012808 Ga0268265_100128082 302
191 3300028786 Ga0307517_10006006 Ga0307517_1000600611 302
192 3300044658 Ga0466972_0003465 Ga0466972_0003465_5904_6845 302
193 3300044693 Ga0466961_0025600 Ga0466961_0025600_491_1432 302
194 3300044706 Ga0466964_0110838 Ga0466964_0110838_90_1031 302
195 3300044765 Ga0466970_0002464 Ga0466970_0002464_125_1066 302
196 3300044901 Ga0466960_0006865 Ga0466960_0006865_1040_1981 302
197 3300045049 Ga0466959_0287489 Ga0466959_0287489_72_1013 302
198 3300046471 Ga0495650_0000116 Ga0495650_0000116_52436_53371 302
199 3300046471 Ga0495650_0000645 Ga0495650_0000645_22087_23022 302
200 3300046491 Ga0495584_0058826 Ga0495584_0058826_903_1838 302
201 3300046492 Ga0495585_0001312 Ga0495585_0001312_8000_8935 302
202 3300046506 Ga0495583_0001297 Ga0495583_0001297_1575_2510 302
203 3300046506 Ga0495583_0001480 Ga0495583_0001480_11349_12284 302
204 3300046507 Ga0495606_0001811 Ga0495606_0001811_6536_7471 302
205 3300046507 Ga0495606_0104614 Ga0495606_0104614_163_1098 302
206 3300046512 Ga0495610_0000013 Ga0495610_0000013_339907_340836 302
207 3300046513 Ga0495616_0000192 Ga0495616_0000192_29258_30280 302
208 3300046515 Ga0495620_0014768 Ga0495620_0014768_1748_2677 302
209 3300046519 Ga0495632_0000370 Ga0495632_0000370_29080_30009 302
210 3300046522 Ga0495643_0002339 Ga0495643_0002339_6642_7577 302
211 3300046522 Ga0495643_0015187 Ga0495643_0015187_1865_2800 302
212 3300046524 Ga0495648_0000498 Ga0495648_0000498_9659_10594 302
213 3300046525 Ga0495663_0000949 Ga0495663_0000949_6462_7397 302
214 3300046528 Ga0495642_0005579 Ga0495642_0005579_2178_3113 302
215 3300046616 Ga0495668_0010372 Ga0495668_0010372_4002_4937 302
216 3300046660 Ga0495625_0002639 Ga0495625_0002639_8920_9864 302
217 3300046660 Ga0495625_0046653 Ga0495625_0046653_62_997 302
218 3300046694 Ga0495649_0022272 Ga0495649_0022272_1192_2127 302
219 3300046694 Ga0495649_0031690 Ga0495649_0031690_478_1407 302
220 3300046809 Ga0495600_0016684 Ga0495600_0016684_917_1852 302
221 3300047323 Ga0495683_0000453 Ga0495683_0000453_20185_21120 302
222 3300047443 Ga0495687_000285 Ga0495687_000285_53011_53946 302
223 3300047470 Ga0495681_0000017 Ga0495681_0000017_56181_57116 302
224 3300047470 Ga0495681_0001533 Ga0495681_0001533_6767_7702 302
225 3300048905 Ga0496102_0000092 Ga0496102_0000092_103984_104919 302
226 3300048905 Ga0496102_0000445 Ga0496102_0000445_16130_17038 302
227 3300048906 Ga0496103_0000021 Ga0496103_0000021_65509_66417 302
228 3300048906 Ga0496103_0000432 Ga0496103_0000432_8381_9316 302
229 3300048907 Ga0496104_0000131 Ga0496104_0000131_9801_10709 302
230 3300048907 Ga0496104_0010902 Ga0496104_0010902_5835_6770 302
231 3300048908 Ga0496105_0000111 Ga0496105_0000111_7600_8508 302
232 3300048912 Ga0496109_0122152 Ga0496109_0122152_50_985 302
233 3300048913 Ga0496110_0009175 Ga0496110_0009175_2099_3034 302
234 3300048915 Ga0496112_0034238 Ga0496112_0034238_853_1761 302
235 3300048916 Ga0496113_0002186 Ga0496113_0002186_3995_4903 302
236 3300048917 Ga0496114_0001167 Ga0496114_0001167_8369_9304 302
237 3300048918 Ga0496115_0000038 Ga0496115_0000038_22293_23228 302
238 3300048919 Ga0496116_0006962 Ga0496116_0006962_4222_5157 302
239 3300048920 Ga0496117_0000173 Ga0496117_0000173_30377_31312 302
240 3300048920 Ga0496117_0004836 Ga0496117_0004836_8691_9599 302
241 3300048921 Ga0496118_0000131 Ga0496118_0000131_101937_102872 302
242 3300048921 Ga0496118_0028591 Ga0496118_0028591_2181_3113 302
243 3300048921 Ga0496118_0045859 Ga0496118_0045859_496_1404 302
244 3300048922 Ga0496119_0000339 Ga0496119_0000339_52680_53588 302
245 3300048923 Ga0496120_0000334 Ga0496120_0000334_5213_6121 302
246 3300048923 Ga0496120_0003689 Ga0496120_0003689_9474_10409 302
247 3300048924 Ga0496121_0000209 Ga0496121_0000209_101915_102850 302
248 3300048924 Ga0496121_0005868 Ga0496121_0005868_9740_10648 302
249 3300048924 Ga0496121_0007529 Ga0496121_0007529_2375_3307 302
250 3300048924 Ga0496121_0030059 Ga0496121_0030059_1368_2303 302
251 3300048925 Ga0496122_0001686 Ga0496122_0001686_32455_33390 302
252 3300048925 Ga0496122_0004078 Ga0496122_0004078_8977_9885 302
253 3300048925 Ga0496122_0009525 Ga0496122_0009525_4977_5909 302
254 3300048926 Ga0496123_0000367 Ga0496123_0000367_74750_75658 302
255 3300048927 Ga0496124_0000166 Ga0496124_0000166_102105_103040 302
256 3300048927 Ga0496124_0006240 Ga0496124_0006240_2817_3725 302
257 3300048928 Ga0496125_0000390 Ga0496125_0000390_17611_18546 302
258 3300048928 Ga0496125_0002118 Ga0496125_0002118_11801_12709 302
259 3300048929 Ga0496126_0000222 Ga0496126_0000222_21067_22002 302
260 3300048929 Ga0496126_0000367 Ga0496126_0000367_16154_17062 302
261 3300053087 Ga0500643_000503 Ga0500643_000503_18398_19333 302
262 3300053087 Ga0500643_007250 Ga0500643_007250_3184_4119 302
263 3300053119 Ga0500595_002611 Ga0500595_002611_546_1481 302
264 3300053122 Ga0500608_013041 Ga0500608_013041_2495_3430 302
265 3300053136 Ga0500559_0020525 Ga0500559_0020525_1488_2423 302
266 3300053136 Ga0500559_0030105 Ga0500559_0030105_1311_2246 302
267 3300053138 Ga0500564_033485 Ga0500564_033485_232_1167 302
268 3300053140 Ga0500573_0093843 Ga0500573_0093843_50_985 302
269 3300053151 Ga0500604_0010815 Ga0500604_0010815_837_1772 302
270 3300053153 Ga0500616_0023686 Ga0500616_0023686_2072_3067 302
271 3300053158 Ga0500627_0001916 Ga0500627_0001916_1258_2280 302
272 3300053177 Ga0500636_0000360 Ga0500636_0000360_18986_19921 302
273 3300053723 Ga0500567_000338 Ga0500567_000338_5874_6809 302
274 3300053729 Ga0500625_000007 Ga0500625_000007_61178_62113 302
275 3300055283 Ga0500661_023069 Ga0500661_023069_104_1039 302
276 iso_pu_bacteria 2738541275 2738711622 302
277 iso_pu_bacteria 2738541301 2738850047 302
278 iso_pu_bacteria 2738541304 2738865776 302
279 iso_pu_bacteria 2738543022 2739298294 302
280 iso_pu_bacteria 2738543033 2739359972 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

119

292

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dja-assembly1.cif.gz_A zn-dependent 5/b/6 metallo-beta-lactamase from bacillus cereus 0.7513 46 277
3i0v-assembly1.cif.gz_A bacillus cereus metallo-beta-lactamase: apo form 0.7471 49 277
4c1c-assembly1.cif.gz_A crystal structure of the metallo-beta-lactamase bcii with d-captopril 0.7441 46 239
2nzf-assembly1.cif.gz_A structure of beta-lactamase ii from bacillus cereus. r121h, c221s double mutant. space group c2. 0.7397 46 277
2uyx-assembly1.cif.gz_A metallo-beta-lactamase (1bc2) single point mutant d120s 0.7343 46 277
ID Description Score Start End Superfamily
af_Q9VJ60_3_124_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.7851 49 78 3.10.110.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7593 156 239 3.60.15.10
af_Q17596_1_214_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7336 47 235 3.60.15.10
af_Q9UT36_7_256_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.725 66 239 3.60.15.10
af_A4HZ66_7_206_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7163 42 239 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7W6BWW1-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.989 31 300 GO:0016787
AF-A0A4R1UIP4-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9809 66 302 GO:0016787
AF-A0A7W6BWW1-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9782 31 300 GO:0016787
AF-A0A518BJP9-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) 0.977 35 294 GO:0004416
AF-A0A4R2H666-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9743 35 297 GO:0016787

Feature Viewer

pLDDT pTM Quality
87.89 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map