F383588

General Info

Members Datasets Scaffolds Average Seq Length
280 186 560 161

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100425783|Ga0068871_1004257832
Length 178
Sequence MRIERGRVVSLSYELRDRDGQPLEDDGAQMAYLHGYGGIFPKVEEALEGKEVGAEATLTLEPLDAFGEYDAELLRVEPRDRFPETLEVGMRFEGVPGENERGQPPRGQDSEDAQIYTVTDIAADQVVVDGNHPLAGERLWFKCSVTAVRDATPAELEHGHVHDEVPVTVLPPPDAARS

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 0
Rhizosphere 96.07
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100425783 3300006358 Bacteria 1186
2 Ga0070690_100800515 3300005330 Bacteria 731
3 Ga0070677_10300799 3300005333 Bacteria 815
4 Ga0068869_100635216 3300005334 Bacteria 905
5 Ga0068869_100771337 3300005334 Bacteria 825
6 Ga0070680_100072067 3300005336 Bacteria 2840
7 Ga0070682_100599055 3300005337 Bacteria 870
8 Ga0070689_100041352 3300005340 Bacteria 3538
9 Ga0070689_100343312 3300005340 Bacteria 1251
10 Ga0070687_100171519 3300005343 Bacteria 1292
11 Ga0070661_100334164 3300005344 Bacteria 1186
12 Ga0070669_101130720 3300005353 Bacteria 675
13 Ga0070675_100023502 3300005354 Bacteria 4930
14 Ga0070675_100340132 3300005354 Bacteria 1329
15 Ga0070675_100492431 3300005354 Bacteria 1104
16 Ga0070674_100398557 3300005356 Bacteria 1124
17 Ga0070674_100714524 3300005356 Bacteria 858
18 Ga0070674_100891804 3300005356 Bacteria 774
19 Ga0070673_100049139 3300005364 Bacteria 3292
20 Ga0070688_100169742 3300005365 Bacteria 1504
21 Ga0070688_100612309 3300005365 Bacteria 835
22 Ga0070714_100041802 3300005435 Bacteria 3870
23 Ga0070713_100004098 3300005436 Bacteria 9709
24 Ga0070713_100181762 3300005436 Bacteria 1890
25 Ga0070713_100570335 3300005436 Bacteria 1073
26 Ga0070713_101437989 3300005436 Bacteria 669
27 Ga0070701_10043124 3300005438 Bacteria 2306
28 Ga0070711_100010591 3300005439 Bacteria 5711
29 Ga0070700_100484432 3300005441 Bacteria 948
30 Ga0070700_101369896 3300005441 Bacteria 597
31 Ga0070678_100157229 3300005456 Bacteria 1837
32 Ga0070678_100214739 3300005456 Bacteria 1596
33 Ga0070678_100479896 3300005456 Bacteria 1094
34 Ga0070678_101372928 3300005456 Bacteria 659
35 Ga0070681_10036491 3300005458 Bacteria 4936
36 Ga0070681_10380192 3300005458 Bacteria 1323
37 Ga0068867_100539313 3300005459 Bacteria 1009
38 Ga0070685_10022479 3300005466 Bacteria 3439
39 Ga0070707_100910573 3300005468 Bacteria 844
40 Ga0070698_100927632 3300005471 Bacteria 817
41 Ga0070699_100213417 3300005518 Bacteria 1719
42 Ga0070679_100156879 3300005530 Bacteria 2251
43 Ga0070679_101017317 3300005530 Unclassified 773
44 Ga0070684_100144398 3300005535 Bacteria 2153
45 Ga0070684_100303384 3300005535 Bacteria 1465
46 Ga0068853_100014992 3300005539 Bacteria 6367
47 Ga0070672_100137397 3300005543 Bacteria 2013
48 Ga0070686_100434122 3300005544 Bacteria 1006
49 Ga0070686_100580541 3300005544 Bacteria 881
50 Ga0070696_100026751 3300005546 Bacteria 3926
51 Ga0070693_100016323 3300005547 Bacteria 3841
52 Ga0070693_100158095 3300005547 Bacteria 1441
53 Ga0070665_100094367 3300005548 Bacteria 2997
54 Ga0070665_100163502 3300005548 Bacteria 2228
55 Ga0070704_100308874 3300005549 Bacteria 1321
56 Ga0070704_100878497 3300005549 Bacteria 805
57 Ga0068855_100023600 3300005563 Bacteria 7367
58 Ga0068855_100033226 3300005563 Bacteria 6158
59 Ga0068855_100070751 3300005563 Bacteria 4058
60 Ga0068855_100848671 3300005563 Bacteria 968
61 Ga0068857_100102355 3300005577 Bacteria 2571
62 Ga0068854_100298657 3300005578 Bacteria 1302
63 Ga0068854_100607192 3300005578 Bacteria 935
64 Ga0068854_100618887 3300005578 Bacteria 926
65 Ga0068856_100001616 3300005614 Bacteria 23579
66 Ga0070702_100133671 3300005615 Bacteria 1571
67 Ga0068852_100322460 3300005616 Bacteria 1501
68 Ga0068859_100080853 3300005617 Bacteria 3291
69 Ga0068859_100470086 3300005617 Bacteria 1353
70 Ga0068864_100663064 3300005618 Bacteria 1017
71 Ga0068861_100211549 3300005719 Bacteria 1634
72 Ga0068870_10062818 3300005840 Bacteria 2002
73 Ga0068863_100142027 3300005841 Bacteria 2295
74 Ga0068863_100928161 3300005841 Bacteria 871
75 Ga0068858_100071045 3300005842 Bacteria 3227
76 Ga0068858_100177628 3300005842 Bacteria 2009
77 Ga0068858_100390638 3300005842 Bacteria 1336
78 Ga0068860_100395953 3300005843 Bacteria 1366
79 Ga0068862_101309436 3300005844 Bacteria 726
80 Ga0070717_10166793 3300006028 Bacteria 1913
81 Ga0075364_10052193 3300006051 Bacteria 2672
82 Ga0075432_10027326 3300006058 Bacteria 1964
83 Ga0070716_100162083 3300006173 Bacteria 1450
84 Ga0075362_10267154 3300006177 Bacteria 844
85 Ga0075367_10219764 3300006178 Unclassified 1189
86 Ga0075366_10032260 3300006195 Bacteria 3084
87 Ga0075366_10666642 3300006195 Unclassified 646
88 Ga0097621_100011933 3300006237 Bacteria 6427
89 Ga0097621_100045297 3300006237 Bacteria 3552
90 Ga0097621_100201278 3300006237 Bacteria 1729
91 Ga0075370_10113301 3300006353 Bacteria 1576
92 Ga0068871_100010980 3300006358 Bacteria 6634
93 Ga0068871_100043125 3300006358 Bacteria 3624
94 Ga0068871_100816717 3300006358 Bacteria 860
95 Ga0075428_100007799 3300006844 Bacteria 11865
96 Ga0075434_101152203 3300006871 Bacteria 788
97 Ga0075429_100774943 3300006880 Bacteria 840
98 Ga0068865_100449808 3300006881 Bacteria 1065
99 Ga0075436_100100322 3300006914 Bacteria 2016
100 Ga0097620_100080847 3300006931 Bacteria 3291
101 Ga0097620_100470120 3300006931 Bacteria 1353
102 Ga0105240_10026607 3300009093 Bacteria 7591
103 Ga0105240_10190378 3300009093 Bacteria 2413
104 Ga0105240_10524633 3300009093 Bacteria 1314
105 Ga0111539_10002368 3300009094 Bacteria 25057
106 Ga0111539_10416594 3300009094 Bacteria 1565
107 Ga0105245_10034392 3300009098 Bacteria 4495
108 Ga0105245_10121324 3300009098 Bacteria 2442
109 Ga0105245_10173980 3300009098 Bacteria 2052
110 Ga0105245_11138469 3300009098 Bacteria 827
111 Ga0105243_10072747 3300009148 Bacteria 2783
112 Ga0105243_10175768 3300009148 Bacteria 1858
113 Ga0105243_10352989 3300009148 Bacteria 1351
114 Ga0105243_10860492 3300009148 Bacteria 898
115 Ga0105242_10094795 3300009176 Bacteria 2518
116 Ga0105242_10157818 3300009176 Bacteria 1983
117 Ga0105242_10443422 3300009176 Bacteria 1222
118 Ga0105248_10050278 3300009177 Bacteria 4675
119 Ga0105248_10167527 3300009177 Bacteria 2476
120 Ga0105238_10067980 3300009551 Bacteria 3564
121 Ga0105249_10218239 3300009553 Bacteria 1875
122 Ga0105249_10357737 3300009553 Bacteria 1481
123 Ga0157335_1006483 3300012492 Bacteria 850
124 Ga0157373_10412094 3300013100 Bacteria 969
125 Ga0157370_10006530 3300013104 Bacteria 12842
126 Ga0157370_10663560 3300013104 Bacteria 953
127 Ga0157370_11175346 3300013104 Bacteria 692
128 Ga0157369_10194922 3300013105 Bacteria 2128
129 Ga0157369_10227441 3300013105 Bacteria 1951
130 Ga0157374_10282051 3300013296 Bacteria 1640
131 Ga0157378_10060464 3300013297 Bacteria 3381
132 Ga0157378_10596505 3300013297 Bacteria 1115
133 Ga0163162_10155607 3300013306 Bacteria 2406
134 Ga0163162_10866117 3300013306 Bacteria 1018
135 Ga0157372_10206924 3300013307 Bacteria 2274
136 Ga0157375_10059148 3300013308 Bacteria 3795
137 Ga0157375_10397743 3300013308 Bacteria 1544
138 Ga0163163_10002600 3300014325 Bacteria 15303
139 Ga0157380_10125663 3300014326 Bacteria 2180
140 Ga0157380_10371956 3300014326 Bacteria 1345
141 Ga0157380_10828363 3300014326 Bacteria 945
142 Ga0157377_10003048 3300014745 Bacteria 7510
143 Ga0157379_10059602 3300014968 Bacteria 3413
144 Ga0157376_10274167 3300014969 Bacteria 1586
145 Ga0157376_11943658 3300014969 Bacteria 626
146 Ga0157376_12397825 3300014969 Bacteria 567
147 Ga0163161_10824429 3300017792 Bacteria 781
148 Ga0207682_10044853 3300025893 Bacteria 1813
149 Ga0207682_10088309 3300025893 Bacteria 1340
150 Ga0207692_10380285 3300025898 Unclassified 876
151 Ga0207688_10050285 3300025901 Bacteria 2333
152 Ga0207685_10175120 3300025905 Bacteria 990
153 Ga0207699_10077219 3300025906 Bacteria 2054
154 Ga0207707_10131773 3300025912 Bacteria 2186
155 Ga0207707_10357839 3300025912 Bacteria 1257
156 Ga0207695_10073723 3300025913 Bacteria 3477
157 Ga0207660_10077770 3300025917 Bacteria 2430
158 Ga0207660_10161686 3300025917 Bacteria 1728
159 Ga0207662_10157336 3300025918 Bacteria 1449
160 Ga0207662_10412865 3300025918 Bacteria 917
161 Ga0207662_10508055 3300025918 Bacteria 831
162 Ga0207657_10138250 3300025919 Bacteria 1992
163 Ga0207652_10027333 3300025921 Bacteria 4753
164 Ga0207646_10945500 3300025922 Bacteria 763
165 Ga0207646_11686017 3300025922 Unclassified 545
166 Ga0207694_10043120 3300025924 Bacteria 3482
167 Ga0207659_10111592 3300025926 Bacteria 2079
168 Ga0207687_10028806 3300025927 Bacteria 3732
169 Ga0207687_10114294 3300025927 Bacteria 2009
170 Ga0207687_10833284 3300025927 Bacteria 787
171 Ga0207700_10248275 3300025928 Bacteria 1519
172 Ga0207700_10461381 3300025928 Bacteria 1121
173 Ga0207700_10672690 3300025928 Bacteria 923
174 Ga0207664_10032308 3300025929 Bacteria 4010
175 Ga0207686_10048901 3300025934 Bacteria 2622
176 Ga0207709_10324233 3300025935 Bacteria 1154
177 Ga0207670_10191264 3300025936 Bacteria 1549
178 Ga0207669_10547652 3300025937 Bacteria 933
179 Ga0207704_11130827 3300025938 Bacteria 666
180 Ga0207691_10000699 3300025940 Bacteria 33182
181 Ga0207711_10068787 3300025941 Bacteria 3067
182 Ga0207689_10026293 3300025942 Bacteria 4874
183 Ga0207689_10152449 3300025942 Bacteria 1905
184 Ga0207667_10007975 3300025949 Bacteria 12628
185 Ga0207667_10273929 3300025949 Bacteria 1725
186 Ga0207667_10306152 3300025949 Bacteria 1623
187 Ga0207712_10855225 3300025961 Bacteria 802
188 Ga0207640_10073564 3300025981 Bacteria 2310
189 Ga0207640_10831731 3300025981 Bacteria 802
190 Ga0207703_10053939 3300026035 Bacteria 3268
191 Ga0207703_10334153 3300026035 Bacteria 1391
192 Ga0207703_10985698 3300026035 Bacteria 808
193 Ga0207639_10273952 3300026041 Bacteria 1481
194 Ga0207708_10082492 3300026075 Bacteria 2472
195 Ga0207641_10116224 3300026088 Bacteria 2380
196 Ga0207641_10544768 3300026088 Bacteria 1131
197 Ga0207641_11051470 3300026088 Bacteria 812
198 Ga0207648_10048539 3300026089 Bacteria 3716
199 Ga0207648_10627558 3300026089 Bacteria 992
200 Ga0207676_10112749 3300026095 Bacteria 2279
201 Ga0207676_10225800 3300026095 Bacteria 1671
202 Ga0207675_100404777 3300026118 Bacteria 1345
203 Ga0207683_10091472 3300026121 Bacteria 2710
204 Ga0207683_10539187 3300026121 Bacteria 1078
205 Ga0207683_11554703 3300026121 Bacteria 610
206 Ga0207698_10469837 3300026142 Bacteria 1218
207 Ga0207698_10572729 3300026142 Bacteria 1110
208 Ga0207428_10009721 3300027907 Bacteria 8618
209 Ga0268266_10064632 3300028379 Bacteria 3162
210 Ga0268266_10132625 3300028379 Bacteria 2229
211 Ga0268264_10168579 3300028381 Bacteria 1978
212 Ga0265330_10182841 3300031235 Bacteria 888
213 Ga0265331_10059601 3300031250 Bacteria 1805
214 Ga0307408_100158386 3300031548 Bacteria 1796
215 Ga0307408_100163676 3300031548 Bacteria 1769
216 Ga0307412_10666393 3300031911 Unclassified 889
217 Ga0307409_100345118 3300031995 Bacteria 1403
218 Ga0307416_100037862 3300032002 Bacteria 3716
219 Ga0307416_100327005 3300032002 Bacteria 1539
220 Ga0307416_100607576 3300032002 Bacteria 1174
221 Ga0307416_100786556 3300032002 Bacteria 1046
222 Ga0307416_101268874 3300032002 Bacteria 842
223 Ga0307416_102404965 3300032002 Bacteria 626
224 Ga0307411_10240176 3300032005 Bacteria 1418
225 Ga0373928_0198443 3300035084 Bacteria 578
226 Ga0373952_0058693 3300035092 Unclassified 935
227 Ga0373953_0259384 3300035117 Bacteria 756
228 Ga0373954_0294107 3300035118 Bacteria 801
229 Ga0373956_0057855 3300035119 Bacteria 1753
230 Ga0373931_0535993 3300035691 Unclassified 759
231 Ga0373935_0317367 3300035692 Bacteria 1105
232 Ga0373927_0093666 3300035695 Bacteria 1952
233 Ga0373933_0393230 3300035724 Bacteria 904
234 Ga0373937_0026905 3300036401 Bacteria 5199
235 Ga0373937_0143818 3300036401 Bacteria 2232
236 Ga0373925_0025478 3300037068 Bacteria 4321
237 Ga0373925_0516633 3300037068 Bacteria 981
238 Ga0436365_1391334 3300039437 Bacteria 1621
239 Ga0451853_2972470 3300041512 Bacteria 2264
240 Ga0439441_002523 3300042001 Bacteria 2592
241 Ga0451577_0111738 3300042876 Bacteria 2445
242 Ga0451577_0360749 3300042876 Bacteria 1318
243 Ga0451576_0550737 3300045051 Bacteria 1212
244 Ga0495651_0054210 3300046462 Bacteria 3085
245 Ga0495608_0016130 3300046511 Bacteria 5167
246 Ga0495652_0096509 3300046529 Bacteria 2407
247 Ga0495587_0011288 3300046536 Bacteria 5662
248 Ga0495598_0028915 3300046537 Bacteria 1541
249 Ga0495621_0010091 3300046539 Bacteria 2882
250 Ga0495645_0005237 3300046543 Bacteria 8884
251 Ga0495667_0008575 3300046559 Bacteria 6937
252 Ga0495657_0269571 3300046675 Bacteria 1021
253 Ga0495599_0000518 3300046678 Bacteria 22134
254 Ga0495623_0025136 3300046679 Bacteria 3836
255 Ga0495604_0221489 3300047317 Bacteria 1302
256 Ga0495602_0233776 3300048088 Bacteria 1379
257 Ga0501034_1149201 3300049571 Bacteria 656
258 Ga0501036_1157236 3300049572 Bacteria 631
259 Ga0501047_0252851 3300049581 Bacteria 1610
260 Ga0501067_0227294 3300049583 Bacteria 1039
261 Ga0501069_0000252 3300049585 Bacteria 24198
262 Ga0501070_0003938 3300049586 Bacteria 12795
263 Ga0501072_0128267 3300049588 Bacteria 2021
264 Ga0501073_0001212 3300049589 Bacteria 18789
265 Ga0501074_0002516 3300049590 Bacteria 12787
266 Ga0501080_0081918 3300049742 Bacteria 2997
267 Ga0501080_0133589 3300049742 Bacteria 2297
268 Ga0501083_0006965 3300049744 Bacteria 8019
269 Ga0501035_0410176 3300049822 Bacteria 1126
270 Ga0501044_0133501 3300049823 Bacteria 2475
271 nmdc:mga0k408_76868_c1 3300050493 Bacteria 1952
272 nmdc:mga08y16_3242_c1 3300050511 Bacteria 16850
273 nmdc:mga0rr50_295854_c1 3300050513 Bacteria 1353
274 nmdc:mga08x19_82729_c1 3300050514 Bacteria 2109
275 nmdc:mga0a205_174048_c1 3300050515 Bacteria 2048
276 nmdc:mga0sz30_48069_c1 3300050516 Bacteria 1804
277 Ga0495595_0054811 3300053084 Bacteria 1854
278 Ga0500641_0061688 3300053096 Bacteria 1562
279 Ga0501084_0686926 3300054114 Bacteria 863
280 Ga0501082_0236640 3300060353 Bacteria 1589
281 Ga0068871_100425783
282 Ga0070690_100800515
283 Ga0070677_10300799
284 Ga0068869_100635216
285 Ga0068869_100771337
286 Ga0070680_100072067
287 Ga0070682_100599055
288 Ga0070689_100041352
289 Ga0070689_100343312
290 Ga0070687_100171519
291 Ga0070661_100334164
292 Ga0070669_101130720
293 Ga0070675_100023502
294 Ga0070675_100340132
295 Ga0070675_100492431
296 Ga0070674_100398557
297 Ga0070674_100714524
298 Ga0070674_100891804
299 Ga0070673_100049139
300 Ga0070688_100169742
301 Ga0070688_100612309
302 Ga0070714_100041802
303 Ga0070713_100004098
304 Ga0070713_100181762
305 Ga0070713_100570335
306 Ga0070713_101437989
307 Ga0070701_10043124
308 Ga0070711_100010591
309 Ga0070700_100484432
310 Ga0070700_101369896
311 Ga0070678_100157229
312 Ga0070678_100214739
313 Ga0070678_100479896
314 Ga0070678_101372928
315 Ga0070681_10036491
316 Ga0070681_10380192
317 Ga0068867_100539313
318 Ga0070685_10022479
319 Ga0070707_100910573
320 Ga0070698_100927632
321 Ga0070699_100213417
322 Ga0070679_100156879
323 Ga0070679_101017317
324 Ga0070684_100144398
325 Ga0070684_100303384
326 Ga0068853_100014992
327 Ga0070672_100137397
328 Ga0070686_100434122
329 Ga0070686_100580541
330 Ga0070696_100026751
331 Ga0070693_100016323
332 Ga0070693_100158095
333 Ga0070665_100094367
334 Ga0070665_100163502
335 Ga0070704_100308874
336 Ga0070704_100878497
337 Ga0068855_100023600
338 Ga0068855_100033226
339 Ga0068855_100070751
340 Ga0068855_100848671
341 Ga0068857_100102355
342 Ga0068854_100298657
343 Ga0068854_100607192
344 Ga0068854_100618887
345 Ga0068856_100001616
346 Ga0070702_100133671
347 Ga0068852_100322460
348 Ga0068859_100080853
349 Ga0068859_100470086
350 Ga0068864_100663064
351 Ga0068861_100211549
352 Ga0068870_10062818
353 Ga0068863_100142027
354 Ga0068863_100928161
355 Ga0068858_100071045
356 Ga0068858_100177628
357 Ga0068858_100390638
358 Ga0068860_100395953
359 Ga0068862_101309436
360 Ga0070717_10166793
361 Ga0075364_10052193
362 Ga0075432_10027326
363 Ga0070716_100162083
364 Ga0075362_10267154
365 Ga0075367_10219764
366 Ga0075366_10032260
367 Ga0075366_10666642
368 Ga0097621_100011933
369 Ga0097621_100045297
370 Ga0097621_100201278
371 Ga0075370_10113301
372 Ga0068871_100010980
373 Ga0068871_100043125
374 Ga0068871_100816717
375 Ga0075428_100007799
376 Ga0075434_101152203
377 Ga0075429_100774943
378 Ga0068865_100449808
379 Ga0075436_100100322
380 Ga0097620_100080847
381 Ga0097620_100470120
382 Ga0105240_10026607
383 Ga0105240_10190378
384 Ga0105240_10524633
385 Ga0111539_10002368
386 Ga0111539_10416594
387 Ga0105245_10034392
388 Ga0105245_10121324
389 Ga0105245_10173980
390 Ga0105245_11138469
391 Ga0105243_10072747
392 Ga0105243_10175768
393 Ga0105243_10352989
394 Ga0105243_10860492
395 Ga0105242_10094795
396 Ga0105242_10157818
397 Ga0105242_10443422
398 Ga0105248_10050278
399 Ga0105248_10167527
400 Ga0105238_10067980
401 Ga0105249_10218239
402 Ga0105249_10357737
403 Ga0157335_1006483
404 Ga0157373_10412094
405 Ga0157370_10006530
406 Ga0157370_10663560
407 Ga0157370_11175346
408 Ga0157369_10194922
409 Ga0157369_10227441
410 Ga0157374_10282051
411 Ga0157378_10060464
412 Ga0157378_10596505
413 Ga0163162_10155607
414 Ga0163162_10866117
415 Ga0157372_10206924
416 Ga0157375_10059148
417 Ga0157375_10397743
418 Ga0163163_10002600
419 Ga0157380_10125663
420 Ga0157380_10371956
421 Ga0157380_10828363
422 Ga0157377_10003048
423 Ga0157379_10059602
424 Ga0157376_10274167
425 Ga0157376_11943658
426 Ga0157376_12397825
427 Ga0163161_10824429
428 Ga0207682_10044853
429 Ga0207682_10088309
430 Ga0207692_10380285
431 Ga0207688_10050285
432 Ga0207685_10175120
433 Ga0207699_10077219
434 Ga0207707_10131773
435 Ga0207707_10357839
436 Ga0207695_10073723
437 Ga0207660_10077770
438 Ga0207660_10161686
439 Ga0207662_10157336
440 Ga0207662_10412865
441 Ga0207662_10508055
442 Ga0207657_10138250
443 Ga0207652_10027333
444 Ga0207646_10945500
445 Ga0207646_11686017
446 Ga0207694_10043120
447 Ga0207659_10111592
448 Ga0207687_10028806
449 Ga0207687_10114294
450 Ga0207687_10833284
451 Ga0207700_10248275
452 Ga0207700_10461381
453 Ga0207700_10672690
454 Ga0207664_10032308
455 Ga0207686_10048901
456 Ga0207709_10324233
457 Ga0207670_10191264
458 Ga0207669_10547652
459 Ga0207704_11130827
460 Ga0207691_10000699
461 Ga0207711_10068787
462 Ga0207689_10026293
463 Ga0207689_10152449
464 Ga0207667_10007975
465 Ga0207667_10273929
466 Ga0207667_10306152
467 Ga0207712_10855225
468 Ga0207640_10073564
469 Ga0207640_10831731
470 Ga0207703_10053939
471 Ga0207703_10334153
472 Ga0207703_10985698
473 Ga0207639_10273952
474 Ga0207708_10082492
475 Ga0207641_10116224
476 Ga0207641_10544768
477 Ga0207641_11051470
478 Ga0207648_10048539
479 Ga0207648_10627558
480 Ga0207676_10112749
481 Ga0207676_10225800
482 Ga0207675_100404777
483 Ga0207683_10091472
484 Ga0207683_10539187
485 Ga0207683_11554703
486 Ga0207698_10469837
487 Ga0207698_10572729
488 Ga0207428_10009721
489 Ga0268266_10064632
490 Ga0268266_10132625
491 Ga0268264_10168579
492 Ga0265330_10182841
493 Ga0265331_10059601
494 Ga0307408_100158386
495 Ga0307408_100163676
496 Ga0307412_10666393
497 Ga0307409_100345118
498 Ga0307416_100037862
499 Ga0307416_100327005
500 Ga0307416_100607576
501 Ga0307416_100786556
502 Ga0307416_101268874
503 Ga0307416_102404965
504 Ga0307411_10240176
505 Ga0373928_0198443
506 Ga0373952_0058693
507 Ga0373953_0259384
508 Ga0373954_0294107
509 Ga0373956_0057855
510 Ga0373931_0535993
511 Ga0373935_0317367
512 Ga0373927_0093666
513 Ga0373933_0393230
514 Ga0373937_0026905
515 Ga0373937_0143818
516 Ga0373925_0025478
517 Ga0373925_0516633
518 Ga0436365_1391334
519 Ga0451853_2972470
520 Ga0439441_002523
521 Ga0451577_0111738
522 Ga0451577_0360749
523 Ga0451576_0550737
524 Ga0495651_0054210
525 Ga0495608_0016130
526 Ga0495652_0096509
527 Ga0495587_0011288
528 Ga0495598_0028915
529 Ga0495621_0010091
530 Ga0495645_0005237
531 Ga0495667_0008575
532 Ga0495657_0269571
533 Ga0495599_0000518
534 Ga0495623_0025136
535 Ga0495604_0221489
536 Ga0495602_0233776
537 Ga0501034_1149201
538 Ga0501036_1157236
539 Ga0501047_0252851
540 Ga0501067_0227294
541 Ga0501069_0000252
542 Ga0501070_0003938
543 Ga0501072_0128267
544 Ga0501073_0001212
545 Ga0501074_0002516
546 Ga0501080_0081918
547 Ga0501080_0133589
548 Ga0501083_0006965
549 Ga0501035_0410176
550 Ga0501044_0133501
551 nmdc:mga0k408_76868_c1
552 nmdc:mga08y16_3242_c1
553 nmdc:mga0rr50_295854_c1
554 nmdc:mga08x19_82729_c1
555 nmdc:mga0a205_174048_c1
556 nmdc:mga0sz30_48069_c1
557 Ga0495595_0054811
558 Ga0500641_0061688
559 Ga0501084_0686926
560 Ga0501082_0236640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4odq-assembly1.cif.gz_A structure of slyd delta-if from thermus thermophilus in complex with s3 peptide 0.8922 1 162
4odk-assembly1.cif.gz_A structure of slyd from thermus thermophilus in complex with t1 peptide 0.8855 1 162
4odk-assembly1.cif.gz_A structure of slyd from thermus thermophilus in complex with t1 peptide 0.8535 1 162
7oxj-assembly1.cif.gz_A ttslyd with m8a pseudo-wild-type s2 peptide 0.8465 1 168
7oxj-assembly1.cif.gz_A ttslyd with m8a pseudo-wild-type s2 peptide 0.8414 1 168
ID Description Score Start End Superfamily
2k8iA01 Alpha Beta;Roll;Chitinase A; domain 3; 0.8518 1 161 3.10.50.40
4dt4A01 Alpha Beta;Roll;Chitinase A; domain 3; 0.8506 8 145 3.10.50.40
2k8iA01 Alpha Beta;Roll;Chitinase A; domain 3; 0.8364 1 161 3.10.50.40
4odpA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.8346 1 168 3.10.50.40
4odpA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.8193 1 168 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A6M4H4K5-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.933 1 157 GO:0005737
GO:0006457
GO:0140839
GO:0140840
AF-A0A136KBK1-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.92 1 150 GO:0005737
GO:0042026
GO:0140839
GO:0140840
AF-A0A0K2GE27-F1-model_v4 FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8) (Metallochaperone SlyD) 0.9079 1 151 GO:0005737
GO:0042026
GO:0140839
GO:0140840
AF-A0A6I1QNT0-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9044 4 147 GO:0005737
GO:0042026
GO:0140839
GO:0140840
AF-A0A6M4GUR2-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9032 8 167 GO:0005737
GO:0006457
GO:0140839
GO:0140840

Map