F383541

General Info

Members Datasets Scaffolds Average Seq Length
280 187 252 283

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000611|Ga0068855_10000061123
Length 302
Sequence MKLTLGFSPCPNDTFIFDALIHHKIDTEGLEFEVHYDDVETLNQKAMRGELDITKLSYHAFAYVADRYVLLDAGSALGFGVGPLLIFKPPIQRFIKSTDKETFSGKSGSCEKTDLVSTISRHRIGIPGKYTTANFLLSLFFPDWTNKTELVFSDIENALLNGEIDLGLIIHENRFTYQDKGLEKLVDLGELWEKQTGCAIPLGGIVANRNLSLEVQHKINRILRRSVEFAFENPKSGLEFIRAHAQEMSEEVMYKHIELYVNKYSVDLGEEGKKAIKLLFDTAHEKNIIPEIKENIFITDFN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
19 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
20 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
21 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
22 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
23 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
24 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
25 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
26 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
27 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
28 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
29 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
30 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
34 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
35 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
138 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
139 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
140 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
177 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.93
Nodule 0
Rhizoplane 0
Rhizosphere 82.14
Stem 0
Stem Tuber 0
Unclassified 8.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2961947 2162886007 Bacteria 5971
2 SwRhRL2b_contig_661255 2162886007 Bacteria 1604
3 JGI24736J21556_1001942 3300001904 Bacteria 3678
4 JGI25162J39368_1000747 3300002737 Bacteria 22242
5 JGI25162J39368_1000964 3300002737 Bacteria 18324
6 JGI25152J39213_1000043 3300002773 Bacteria 87508
7 JGI25150J39212_1000023 3300002774 Bacteria 130663
8 JGI25151J46595_10000082 3300003187 Bacteria 130832
9 JGI25406J46586_10028247 3300003203 Bacteria 2140
10 JGI25165J46597_1002842 3300003214 Bacteria 4959
11 JGI25153J46596_10000060 3300003215 Bacteria 131744
12 rootH1_10171538 3300003316 Bacteria 1610
13 rootH2_10001273 3300003320 Bacteria 179792
14 rootH2_10014937 3300003320 Bacteria 2799
15 rootH2_10141477 3300003320 Bacteria 5929
16 rootH2_10187552 3300003320 Bacteria 1070
17 Ga0055536_1000002 3300003781 Bacteria 605605
18 Ga0055530_10000739 3300003791 Bacteria 27214
19 Ga0065714_10003630 3300005288 Bacteria 23830
20 Ga0065714_10006668 3300005288 Bacteria 3190
21 Ga0065714_10006998 3300005288 Bacteria 3043
22 Ga0065714_10064525 3300005288 Bacteria 41731
23 Ga0065714_10066979 3300005288 Bacteria 6029
24 Ga0065704_10000206 3300005289 Bacteria 121672
25 Ga0065704_10089388 3300005289 Bacteria 2863
26 Ga0065704_10145614 3300005289 Bacteria 1475
27 Ga0070676_10014740 3300005328 Bacteria 4300
28 Ga0068868_100007394 3300005338 Bacteria 7824
29 Ga0070660_100020336 3300005339 Bacteria 4877
30 Ga0070675_100307788 3300005354 Bacteria 1397
31 Ga0070688_100048215 3300005365 Bacteria 2646
32 Ga0070659_100000412 3300005366 Bacteria 32519
33 Ga0070659_100028966 3300005366 Bacteria 4278
34 Ga0068867_100021781 3300005459 Bacteria 4576
35 Ga0070685_10036112 3300005466 Unclassified 2792
36 Ga0070699_100000172 3300005518 Bacteria 62043
37 Ga0068853_100021233 3300005539 Bacteria 5409
38 Ga0070672_100272634 3300005543 Unclassified 1429
39 Ga0070665_100000118 3300005548 Bacteria 149830
40 Ga0068855_100000611 3300005563 Bacteria 43912
41 Ga0068855_100019618 3300005563 Bacteria 8121
42 Ga0068855_100111943 3300005563 Bacteria 3133
43 Ga0068855_100296006 3300005563 Bacteria 1793
44 Ga0068857_100046904 3300005577 Bacteria 3835
45 Ga0068856_100000006 3300005614 Bacteria 223827
46 Ga0068852_100271379 3300005616 Bacteria 1632
47 Ga0068861_100418828 3300005719 Bacteria 1193
48 Ga0068870_10098532 3300005840 Bacteria 1647
49 Ga0068863_100189155 3300005841 Unclassified 1978
50 Ga0068858_100009152 3300005842 Bacteria 9471
51 Ga0068860_100519130 3300005843 Bacteria 1191
52 Ga0068862_100001533 3300005844 Bacteria 21121
53 Ga0097621_100000285 3300006237 Bacteria 34046
54 Ga0068871_100000080 3300006358 Bacteria 53930
55 Ga0068871_100139594 3300006358 Bacteria 2060
56 Ga0075431_100322484 3300006847 Bacteria 1557
57 Ga0075433_10026165 3300006852 Bacteria 4937
58 Ga0075434_100000213 3300006871 Bacteria 39624
59 Ga0075434_100193584 3300006871 Unclassified 2054
60 Ga0075429_100394119 3300006880 Bacteria 1212
61 Ga0075436_100367954 3300006914 Unclassified 1038
62 Ga0075435_100206251 3300007076 Unclassified 1666
63 Ga0105251_10062823 3300009011 Bacteria 1743
64 Ga0105244_10088478 3300009036 Bacteria 1525
65 Ga0105240_10048169 3300009093 Bacteria 5388
66 Ga0105240_10091089 3300009093 Bacteria 3726
67 Ga0105240_10618990 3300009093 Bacteria 1190
68 Ga0111539_10005859 3300009094 Bacteria 15880
69 Ga0111539_10013986 3300009094 Bacteria 10028
70 Ga0111539_10046784 3300009094 Bacteria 5174
71 Ga0105245_10538538 3300009098 Unclassified 1188
72 Ga0114129_10027105 3300009147 Bacteria 8113
73 Ga0114129_10057047 3300009147 Bacteria 5468
74 Ga0105243_10000046 3300009148 Bacteria 155277
75 Ga0105243_10404872 3300009148 Bacteria 1268
76 Ga0105241_10058615 3300009174 Bacteria 2958
77 Ga0105248_10209314 3300009177 Unclassified 2197
78 Ga0105237_10000088 3300009545 Bacteria 124518
79 Ga0105237_10003145 3300009545 Bacteria 19862
80 Ga0105237_10018569 3300009545 Bacteria 7194
81 Ga0105237_10020764 3300009545 Bacteria 6765
82 Ga0105237_10580519 3300009545 Bacteria 1128
83 Ga0105238_10003441 3300009551 Bacteria 15759
84 Ga0105239_10002395 3300010375 Bacteria 23910
85 Ga0105239_10014398 3300010375 Bacteria 8776
86 Ga0105246_10446865 3300011119 Bacteria 1085
87 Ga0157373_10000376 3300013100 Bacteria 35743
88 Ga0157373_10000546 3300013100 Bacteria 29458
89 Ga0157373_10025311 3300013100 Bacteria 4294
90 Ga0157371_10000151 3300013102 Bacteria 101401
91 Ga0157371_10000888 3300013102 Bacteria 33749
92 Ga0157371_10001845 3300013102 Bacteria 21336
93 Ga0157371_10179124 3300013102 Bacteria 1516
94 Ga0157370_10000597 3300013104 Bacteria 45043
95 Ga0157370_10012044 3300013104 Bacteria 9002
96 Ga0157370_10057676 3300013104 Bacteria 3691
97 Ga0157370_10069775 3300013104 Bacteria 3319
98 Ga0157370_10072526 3300013104 Bacteria 3248
99 Ga0157370_10084198 3300013104 Bacteria 2989
100 Ga0157370_10187446 3300013104 Bacteria 1920
101 Ga0157370_10251321 3300013104 Bacteria 1635
102 Ga0157369_10000050 3300013105 Bacteria 167294
103 Ga0157374_10001208 3300013296 Bacteria 22108
104 Ga0157378_10017834 3300013297 Bacteria 6232
105 Ga0163162_10000011 3300013306 Bacteria 299877
106 Ga0163162_10000012 3300013306 Bacteria 292674
107 Ga0163162_10006625 3300013306 Bacteria 11224
108 Ga0157372_10007865 3300013307 Bacteria 11331
109 Ga0157372_10235544 3300013307 Bacteria 2123
110 Ga0157372_10801778 3300013307 Bacteria 1094
111 Ga0157375_10015704 3300013308 Bacteria 6784
112 Ga0157375_10061932 3300013308 Bacteria 3716
113 Ga0157375_10543000 3300013308 Bacteria 1324
114 Ga0182008_10000020 3300014497 Bacteria 228333
115 Ga0182008_10000296 3300014497 Bacteria 39012
116 Ga0182008_10000342 3300014497 Bacteria 36331
117 Ga0157376_10033232 3300014969 Bacteria 4150
118 Ga0182006_1000242 3300015261 Bacteria 50864
119 Ga0182006_1000310 3300015261 Bacteria 42614
120 Ga0182007_10000008 3300015262 Bacteria 332953
121 Ga0182007_10014401 3300015262 Bacteria 2983
122 Ga0183373_1002 3300015682 Bacteria 990153
123 Ga0163161_10000330 3300017792 Bacteria 40454
124 Ga0163161_10000565 3300017792 Bacteria 29834
125 Ga0163161_10002836 3300017792 Bacteria 12297
126 Ga0163161_10004569 3300017792 Bacteria 9637
127 Ga0163161_10031172 3300017792 Bacteria 3797
128 Ga0163161_10146436 3300017792 Bacteria 1792
129 Ga0163161_10233620 3300017792 Bacteria 1428
130 Ga0163161_10319382 3300017792 Bacteria 1227
131 Ga0207427_100072 3300025231 Bacteria 158364
132 Ga0209437_100026 3300025233 Bacteria 542698
133 Ga0209437_100144 3300025233 Bacteria 164794
134 Ga0207425_1000051 3300025245 Bacteria 166795
135 Ga0209129_1000121 3300025258 Bacteria 135404
136 Ga0209129_1014702 3300025258 Bacteria 1653
137 Ga0209233_1000111 3300025261 Bacteria 260262
138 Ga0209233_1002603 3300025261 Bacteria 6554
139 Ga0209233_1013211 3300025261 Bacteria 2362
140 Ga0209676_1000022 3300025292 Bacteria 605659
141 Ga0209025_1000160 3300025294 Bacteria 166795
142 Ga0209758_1000147 3300025297 Bacteria 166795
143 Ga0209050_1000020 3300025298 Bacteria 605671
144 Ga0207647_10000103 3300025904 Bacteria 65792
145 Ga0207643_10086182 3300025908 Bacteria 1825
146 Ga0207705_10206569 3300025909 Unclassified 1489
147 Ga0207695_10007414 3300025913 Bacteria 13973
148 Ga0207695_10015443 3300025913 Bacteria 8988
149 Ga0207671_10000744 3300025914 Bacteria 41309
150 Ga0207671_10010967 3300025914 Bacteria 7424
151 Ga0207671_10012803 3300025914 Bacteria 6723
152 Ga0207657_10089742 3300025919 Bacteria 2566
153 Ga0207681_10060642 3300025923 Bacteria 2597
154 Ga0207650_10186489 3300025925 Unclassified 1655
155 Ga0207690_10000049 3300025932 Bacteria 113589
156 Ga0207690_10004182 3300025932 Bacteria 8526
157 Ga0207709_10000020 3300025935 Bacteria 392366
158 Ga0207709_10252343 3300025935 Bacteria 1289
159 Ga0207704_10000065 3300025938 Bacteria 69867
160 Ga0207667_10000477 3300025949 Bacteria 53347
161 Ga0207667_10010697 3300025949 Bacteria 10708
162 Ga0207667_10089426 3300025949 Bacteria 3183
163 Ga0207640_10035481 3300025981 Bacteria 3122
164 Ga0207677_10026155 3300026023 Bacteria 3655
165 Ga0207639_10007063 3300026041 Bacteria 7658
166 Ga0207639_10015609 3300026041 Bacteria 5359
167 Ga0207702_10000023 3300026078 Bacteria 189234
168 Ga0207641_10125920 3300026088 Bacteria 2294
169 Ga0207648_10001417 3300026089 Bacteria 26440
170 Ga0207674_10084236 3300026116 Bacteria 3178
171 Ga0207675_100507880 3300026118 Bacteria 1201
172 Ga0207683_10008658 3300026121 Bacteria 8702
173 Ga0207698_10012985 3300026142 Bacteria 5477
174 Ga0207698_10456319 3300026142 Bacteria 1235
175 Ga0207428_10037186 3300027907 Bacteria 3963
176 Ga0207428_10255859 3300027907 Bacteria 1305
177 Ga0268266_10000121 3300028379 Bacteria 154995
178 Ga0268265_10009722 3300028380 Bacteria 6491
179 Ga0307515_10016181 3300028794 Bacteria 13677
180 Ga0316177_1127916 3300030731 Bacteria 11558
181 Ga0316183_1100732 3300030742 Bacteria 40906
182 Ga0316181_1246477 3300030744 Bacteria 962
183 Ga0316181_1267984 3300030744 Bacteria 1441
184 Ga0316182_1306507 3300030745 Bacteria 980
185 Ga0307408_100000209 3300031548 Bacteria 62437
186 Ga0307408_100000393 3300031548 Bacteria 39808
187 Ga0307405_10000017 3300031731 Bacteria 195149
188 Ga0307405_10012446 3300031731 Bacteria 4504
189 Ga0307407_10000002 3300031903 Bacteria 323084
190 Ga0307412_10000001 3300031911 Bacteria 822691
191 Ga0307412_10000724 3300031911 Bacteria 19071
192 Ga0307412_10008869 3300031911 Bacteria 5760
193 Ga0307412_10078796 3300031911 Bacteria 2271
194 Ga0307412_10095876 3300031911 Bacteria 2087
195 Ga0307416_100000005 3300032002 Bacteria 477728
196 Ga0307414_10012466 3300032004 Bacteria 5027
197 Ga0307414_10013334 3300032004 Bacteria 4890
198 Ga0307414_10038285 3300032004 Bacteria 3219
199 Ga0307414_10080037 3300032004 Bacteria 2388
200 Ga0307414_10195014 3300032004 Bacteria 1642
201 Ga0307414_10197286 3300032004 Bacteria 1634
202 Ga0307414_10269579 3300032004 Bacteria 1425
203 Ga0307411_10050719 3300032005 Unclassified 2704
204 Ga0307507_10004342 3300033179 Bacteria 25343
205 Ga0307510_10000419 3300033180 Bacteria 40732
206 Ga0373953_0174656 3300035117 Bacteria 926
207 Ga0395899_0007040 3300037312 Bacteria 8703
208 Ga0395900_0001352 3300037418 Bacteria 29621
209 Ga0395900_0321112 3300037418 Bacteria 1528
210 Ga0395905_0000246 3300037471 Bacteria 81356
211 Ga0395901_0000184 3300038443 Bacteria 81257
212 Ga0395901_0014385 3300038443 Bacteria 8054
213 Ga0495650_0056453 3300046471 Bacteria 1593
214 Ga0495607_0190729 3300046501 Bacteria 1021
215 Ga0495606_0128677 3300046507 Bacteria 1507
216 Ga0495610_0000054 3300046512 Bacteria 140031
217 Ga0495610_0000292 3300046512 Bacteria 52555
218 Ga0495616_0000433 3300046513 Bacteria 31968
219 Ga0495631_0022308 3300046518 Bacteria 2943
220 Ga0495631_0085723 3300046518 Bacteria 1357
221 Ga0495648_0053592 3300046524 Bacteria 2443
222 Ga0495609_0061908 3300046538 Bacteria 1653
223 Ga0495625_0242112 3300046660 Bacteria 1174
224 Ga0495671_0134556 3300046692 Bacteria 1205
225 Ga0495649_0040703 3300046694 Bacteria 2543
226 Ga0495687_007696 3300047443 Bacteria 6290
227 Ga0495684_0261297 3300047471 Bacteria 1256
228 Ga0495686_0000306 3300047472 Bacteria 83341
229 Ga0495686_0001597 3300047472 Bacteria 23929
230 Ga0495686_0046616 3300047472 Bacteria 2739
231 Ga0496116_0001204 3300048919 Bacteria 30298
232 Ga0496117_0002757 3300048920 Bacteria 21518
233 Ga0496122_0000817 3300048925 Bacteria 59596
234 Ga0496123_0008229 3300048926 Bacteria 9615
235 Ga0496125_0029453 3300048928 Bacteria 4933
236 Ga0495678_008245 3300049459 Bacteria 5281
237 Ga0501048_0291814 3300049582 Bacteria 1160
238 Ga0501198_001244 3300049649 Bacteria 3288
239 Ga0501240_002373 3300049673 Bacteria 1991
240 Ga0501249_002594 3300049679 Bacteria 3642
241 nmdc:mga05p37_319310_c1 3300050507 Bacteria 1839
242 nmdc:mga05p37_333234_c1 3300050507 Bacteria 1792
243 nmdc:mga06r32_441389_c1 3300050510 Bacteria 1282
244 nmdc:mga08y16_21591_c1 3300050511 Bacteria 6798
245 nmdc:mga08y16_448055_c1 3300050511 Bacteria 1317
246 nmdc:mga0n895_181953_c1 3300050512 Unclassified 2133
247 nmdc:mga0n895_7906_c1 3300050512 Bacteria 9168
248 nmdc:mga0rr50_72259_c1 3300050513 Unclassified 2634
249 nmdc:mga0a205_6492_c1 3300050515 Bacteria 10574
250 Ga0500651_0001978 3300053093 Bacteria 10625
251 Ga0500608_000417 3300053122 Bacteria 16208
252 Ga0500622_0002663 3300053156 Bacteria 12672

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049673 Ga0501240_002373 Ga0501240_002373_44_811 240
2 3300050512 nmdc:mga0n895_181953_c1 nmdc:mga0n895_181953_c1_879_1685 240
3 3300038443 Ga0395901_0014385 Ga0395901_0014385_6109_6882 253
4 3300006871 Ga0075434_100193584 Ga0075434_1001935843 255
5 3300046538 Ga0495609_0061908 Ga0495609_0061908_52_906 257
6 3300047471 Ga0495684_0261297 Ga0495684_0261297_197_988 257
7 3300050510 nmdc:mga06r32_441389_c1 nmdc:mga06r32_441389_c1_42_836 258
8 3300031548 Ga0307408_100000209 Ga0307408_10000020958 270
9 3300005466 Ga0070685_10036112 Ga0070685_100361124 271
10 3300005543 Ga0070672_100272634 Ga0070672_1002726342 271
11 3300005843 Ga0068860_100519130 Ga0068860_1005191302 271
12 3300035117 Ga0373953_0174656 Ga0373953_0174656_55_888 271
13 iso_pu_bacteria 2739367656 2739615135 271
14 3300005841 Ga0068863_100189155 Ga0068863_1001891552 272
15 3300005842 Ga0068858_100009152 Ga0068858_10000915210 272
16 3300009094 Ga0111539_10005859 Ga0111539_1000585910 272
17 3300009098 Ga0105245_10538538 Ga0105245_105385382 272
18 3300009177 Ga0105248_10209314 Ga0105248_102093142 272
19 3300014969 Ga0157376_10033232 Ga0157376_100332326 272
20 3300025925 Ga0207650_10186489 Ga0207650_101864892 272
21 3300026088 Ga0207641_10125920 Ga0207641_101259202 272
22 3300027907 Ga0207428_10037186 Ga0207428_100371866 272
23 3300050511 nmdc:mga08y16_21591_c1 nmdc:mga08y16_21591_c1_5755_6591 272
24 iso_pu_bacteria 2945997725 2945997878 272
25 3300003203 JGI25406J46586_10028247 JGI25406J46586_100282472 273
26 3300003316 rootH1_10171538 rootH1_101715382 273
27 3300005365 Ga0070688_100048215 Ga0070688_1000482152 273
28 3300005518 Ga0070699_100000172 Ga0070699_10000017248 273
29 3300005719 Ga0068861_100418828 Ga0068861_1004188282 273
30 3300005844 Ga0068862_100001533 Ga0068862_10000153318 273
31 3300006358 Ga0068871_100139594 Ga0068871_1001395942 273
32 3300006847 Ga0075431_100322484 Ga0075431_1003224842 273
33 3300006852 Ga0075433_10026165 Ga0075433_100261652 273
34 3300006871 Ga0075434_100000213 Ga0075434_10000021317 273
35 3300006880 Ga0075429_100394119 Ga0075429_1003941192 273
36 3300006914 Ga0075436_100367954 Ga0075436_1003679542 273
37 3300007076 Ga0075435_100206251 Ga0075435_1002062512 273
38 3300009094 Ga0111539_10013986 Ga0111539_1001398610 273
39 3300009094 Ga0111539_10046784 Ga0111539_100467845 273
40 3300009147 Ga0114129_10027105 Ga0114129_100271057 273
41 3300009147 Ga0114129_10057047 Ga0114129_100570474 273
42 3300009148 Ga0105243_10404872 Ga0105243_104048722 273
43 3300011119 Ga0105246_10446865 Ga0105246_104468651 273
44 3300025909 Ga0207705_10206569 Ga0207705_102065692 273
45 3300025923 Ga0207681_10060642 Ga0207681_100606425 273
46 3300025935 Ga0207709_10252343 Ga0207709_102523432 273
47 3300026118 Ga0207675_100507880 Ga0207675_1005078801 273
48 3300027907 Ga0207428_10255859 Ga0207428_102558592 273
49 3300028380 Ga0268265_10009722 Ga0268265_100097228 273
50 3300030744 Ga0316181_1246477 Ga0316181_12464772 273
51 3300031731 Ga0307405_10012446 Ga0307405_100124465 273
52 3300031911 Ga0307412_10008869 Ga0307412_100088691 273
53 3300032004 Ga0307414_10197286 Ga0307414_101972862 273
54 3300049582 Ga0501048_0291814 Ga0501048_0291814_306_1148 273
55 3300049649 Ga0501198_001244 Ga0501198_001244_2093_2956 273
56 3300050507 nmdc:mga05p37_319310_c1 nmdc:mga05p37_319310_c1_384_1223 273
57 3300050507 nmdc:mga05p37_333234_c1 nmdc:mga05p37_333234_c1_382_1221 273
58 3300050511 nmdc:mga08y16_448055_c1 nmdc:mga08y16_448055_c1_299_1141 273
59 3300050512 nmdc:mga0n895_7906_c1 nmdc:mga0n895_7906_c1_1496_2350 273
60 3300050513 nmdc:mga0rr50_72259_c1 nmdc:mga0rr50_72259_c1_1151_2005 273
61 3300050515 nmdc:mga0a205_6492_c1 nmdc:mga0a205_6492_c1_9687_10541 273
62 iso_pu_bacteria 2895498888 2895500276 273
63 3300005339 Ga0070660_100020336 Ga0070660_1000203362 275
64 3300005366 Ga0070659_100000412 Ga0070659_1000004126 275
65 3300013308 Ga0157375_10543000 Ga0157375_105430002 275
66 3300025919 Ga0207657_10089742 Ga0207657_100897422 275
67 3300025932 Ga0207690_10000049 Ga0207690_1000004961 275
68 iso_pu_bacteria 2585427687 2586206416 275
69 iso_pu_bacteria 2738541283 2738755958 275
70 iso_pu_bacteria 2738541302 2738852874 275
71 iso_pu_bacteria 2739367651 2739586818 275
72 iso_pu_bacteria 2739367663 2739645728 275
73 iso_pu_bacteria 2818991437 2819547240 275
74 iso_pu_bacteria 2842722452 2842726991 275
75 iso_pu_bacteria 2842903701 2842905065 275
76 iso_pu_bacteria 2842909656 2842911007 275
77 iso_pu_bacteria 2849281842 2849283867 275
78 iso_pu_bacteria 2857627736 2857627930 275
79 iso_pu_bacteria 2904445276 2904447721 275
80 iso_pu_bacteria 2904780799 2904782354 275
81 iso_pu_bacteria 2919177583 2919178448 275
82 iso_pu_bacteria 2954016120 2954020361 275
83 3300017792 Ga0163161_10002836 Ga0163161_100028368 276
84 3300046512 Ga0495610_0000054 Ga0495610_0000054_101069_101908 276
85 iso_pu_bacteria 2898713307 2898714583 276
86 3300003320 rootH2_10001273 rootH2_10001273158 277
87 3300033180 Ga0307510_10000419 Ga0307510_1000041922 277
88 3300046518 Ga0495631_0022308 Ga0495631_0022308_1642_2478 277
89 3300046660 Ga0495625_0242112 Ga0495625_0242112_289_1125 277
90 3300046694 Ga0495649_0040703 Ga0495649_0040703_634_1470 277
91 3300053122 Ga0500608_000417 Ga0500608_000417_6326_7162 277
92 iso_pu_bacteria 2738541284 2738761380 277
93 iso_pu_bacteria 2775506987 2776616008 277
94 iso_pu_bacteria 2852627209 2852628199 277
95 iso_pu_bacteria 2887375801 2887379614 277
96 iso_pu_bacteria 2890737413 2890739238 277
97 iso_pu_bacteria 2896317667 2896320344 277
98 iso_pu_bacteria 2896344016 2896344870 277
99 iso_pu_bacteria 2902048731 2902049614 277
100 3300003320 rootH2_10141477 rootH2_101414776 278
101 3300003320 rootH2_10187552 rootH2_101875522 278
102 3300003781 Ga0055536_1000002 Ga0055536_100000247 278
103 3300003791 Ga0055530_10000739 Ga0055530_1000073914 278
104 3300005548 Ga0070665_100000118 Ga0070665_100000118143 278
105 3300005563 Ga0068855_100019618 Ga0068855_1000196186 278
106 3300005840 Ga0068870_10098532 Ga0068870_100985322 278
107 3300009093 Ga0105240_10048169 Ga0105240_100481692 278
108 3300009093 Ga0105240_10091089 Ga0105240_100910894 278
109 3300013307 Ga0157372_10007865 Ga0157372_100078654 278
110 3300025292 Ga0209676_1000022 Ga0209676_1000022493 278
111 3300025298 Ga0209050_1000020 Ga0209050_100002046 278
112 3300025908 Ga0207643_10086182 Ga0207643_100861823 278
113 3300025913 Ga0207695_10007414 Ga0207695_100074149 278
114 3300025913 Ga0207695_10015443 Ga0207695_100154436 278
115 3300025949 Ga0207667_10010697 Ga0207667_100106977 278
116 3300028379 Ga0268266_10000121 Ga0268266_1000012114 278
117 3300032004 Ga0307414_10080037 Ga0307414_100800372 278
118 3300032005 Ga0307411_10050719 Ga0307411_100507193 278
119 3300046507 Ga0495606_0128677 Ga0495606_0128677_387_1265 278
120 2162886007 SwRhRL2b_contig_661255 SwRhRL2b_0499.00005490 279
121 3300001904 JGI24736J21556_1001942 JGI24736J21556_10019422 279
122 3300002737 JGI25162J39368_1000964 JGI25162J39368_10009648 279
123 3300002773 JGI25152J39213_1000043 JGI25152J39213_100004324 279
124 3300002774 JGI25150J39212_1000023 JGI25150J39212_1000023102 279
125 3300003187 JGI25151J46595_10000082 JGI25151J46595_10000082102 279
126 3300003214 JGI25165J46597_1002842 JGI25165J46597_10028422 279
127 3300003215 JGI25153J46596_10000060 JGI25153J46596_10000060103 279
128 3300003320 rootH2_10014937 rootH2_100149372 279
129 3300005288 Ga0065714_10006668 Ga0065714_100066684 279
130 3300005288 Ga0065714_10064525 Ga0065714_1006452529 279
131 3300005289 Ga0065704_10145614 Ga0065704_101456142 279
132 3300005328 Ga0070676_10014740 Ga0070676_100147406 279
133 3300005338 Ga0068868_100007394 Ga0068868_1000073947 279
134 3300005354 Ga0070675_100307788 Ga0070675_1003077882 279
135 3300005366 Ga0070659_100028966 Ga0070659_1000289663 279
136 3300005459 Ga0068867_100021781 Ga0068867_1000217812 279
137 3300005563 Ga0068855_100111943 Ga0068855_1001119433 279
138 3300005563 Ga0068855_100296006 Ga0068855_1002960062 279
139 3300005577 Ga0068857_100046904 Ga0068857_1000469044 279
140 3300006237 Ga0097621_100000285 Ga0097621_10000028518 279
141 3300006358 Ga0068871_100000080 Ga0068871_10000008039 279
142 3300009011 Ga0105251_10062823 Ga0105251_100628232 279
143 3300009036 Ga0105244_10088478 Ga0105244_100884782 279
144 3300009148 Ga0105243_10000046 Ga0105243_10000046106 279
145 3300009174 Ga0105241_10058615 Ga0105241_100586154 279
146 3300009545 Ga0105237_10000088 Ga0105237_1000008856 279
147 3300009545 Ga0105237_10003145 Ga0105237_1000314513 279
148 3300009545 Ga0105237_10580519 Ga0105237_105805191 279
149 3300009551 Ga0105238_10003441 Ga0105238_100034415 279
150 3300013100 Ga0157373_10025311 Ga0157373_100253113 279
151 3300013102 Ga0157371_10000151 Ga0157371_1000015137 279
152 3300013102 Ga0157371_10179124 Ga0157371_101791242 279
153 3300013104 Ga0157370_10000597 Ga0157370_1000059711 279
154 3300013104 Ga0157370_10012044 Ga0157370_100120442 279
155 3300013104 Ga0157370_10057676 Ga0157370_100576763 279
156 3300013104 Ga0157370_10072526 Ga0157370_100725264 279
157 3300013104 Ga0157370_10084198 Ga0157370_100841983 279
158 3300013104 Ga0157370_10187446 Ga0157370_101874462 279
159 3300013104 Ga0157370_10251321 Ga0157370_102513212 279
160 3300013105 Ga0157369_10000050 Ga0157369_1000005060 279
161 3300013296 Ga0157374_10001208 Ga0157374_1000120814 279
162 3300013297 Ga0157378_10017834 Ga0157378_100178346 279
163 3300013306 Ga0163162_10000011 Ga0163162_10000011233 279
164 3300013307 Ga0157372_10235544 Ga0157372_102355443 279
165 3300013307 Ga0157372_10801778 Ga0157372_108017781 279
166 3300013308 Ga0157375_10015704 Ga0157375_100157042 279
167 3300014497 Ga0182008_10000296 Ga0182008_1000029611 279
168 3300014497 Ga0182008_10000342 Ga0182008_1000034214 279
169 3300015261 Ga0182006_1000242 Ga0182006_100024232 279
170 3300015261 Ga0182006_1000310 Ga0182006_100031034 279
171 3300015262 Ga0182007_10000008 Ga0182007_10000008231 279
172 3300015262 Ga0182007_10014401 Ga0182007_100144012 279
173 3300015682 Ga0183373_1002 Ga0183373_1002504 279
174 3300017792 Ga0163161_10000565 Ga0163161_1000056512 279
175 3300017792 Ga0163161_10004569 Ga0163161_100045698 279
176 3300017792 Ga0163161_10031172 Ga0163161_100311723 279
177 3300025231 Ga0207427_100072 Ga0207427_10007255 279
178 3300025233 Ga0209437_100026 Ga0209437_100026287 279
179 3300025245 Ga0207425_1000051 Ga0207425_1000051135 279
180 3300025258 Ga0209129_1000121 Ga0209129_1000121102 279
181 3300025261 Ga0209233_1000111 Ga0209233_1000111181 279
182 3300025261 Ga0209233_1002603 Ga0209233_10026031 279
183 3300025261 Ga0209233_1013211 Ga0209233_10132112 279
184 3300025294 Ga0209025_1000160 Ga0209025_100016025 279
185 3300025297 Ga0209758_1000147 Ga0209758_100014725 279
186 3300025904 Ga0207647_10000103 Ga0207647_1000010349 279
187 3300025914 Ga0207671_10000744 Ga0207671_1000074426 279
188 3300025932 Ga0207690_10004182 Ga0207690_100041823 279
189 3300025935 Ga0207709_10000020 Ga0207709_10000020236 279
190 3300025938 Ga0207704_10000065 Ga0207704_1000006523 279
191 3300025949 Ga0207667_10089426 Ga0207667_100894262 279
192 3300026023 Ga0207677_10026155 Ga0207677_100261552 279
193 3300026041 Ga0207639_10007063 Ga0207639_100070636 279
194 3300026089 Ga0207648_10001417 Ga0207648_1000141720 279
195 3300026116 Ga0207674_10084236 Ga0207674_100842361 279
196 3300026121 Ga0207683_10008658 Ga0207683_100086586 279
197 3300026142 Ga0207698_10012985 Ga0207698_100129856 279
198 3300028794 Ga0307515_10016181 Ga0307515_100161817 279
199 3300030731 Ga0316177_1127916 Ga0316177_112791612 279
200 3300030742 Ga0316183_1100732 Ga0316183_110073217 279
201 3300030745 Ga0316182_1306507 Ga0316182_13065071 279
202 3300031731 Ga0307405_10000017 Ga0307405_1000001778 279
203 3300031903 Ga0307407_10000002 Ga0307407_1000000231 279
204 3300031911 Ga0307412_10078796 Ga0307412_100787963 279
205 3300031911 Ga0307412_10095876 Ga0307412_100958763 279
206 3300032002 Ga0307416_100000005 Ga0307416_10000000531 279
207 3300032004 Ga0307414_10038285 Ga0307414_100382853 279
208 3300032004 Ga0307414_10269579 Ga0307414_102695791 279
209 3300037418 Ga0395900_0321112 Ga0395900_0321112_222_1070 279
210 3300046512 Ga0495610_0000292 Ga0495610_0000292_19653_20501 279
211 3300047443 Ga0495687_007696 Ga0495687_007696_4276_5124 279
212 3300047472 Ga0495686_0001597 Ga0495686_0001597_13146_13994 279
213 3300048919 Ga0496116_0001204 Ga0496116_0001204_24519_25388 279
214 3300048920 Ga0496117_0002757 Ga0496117_0002757_13967_14857 279
215 3300048925 Ga0496122_0000817 Ga0496122_0000817_29112_29957 279
216 3300048926 Ga0496123_0008229 Ga0496123_0008229_4931_5776 279
217 3300048928 Ga0496125_0029453 Ga0496125_0029453_2595_3440 279
218 3300049679 Ga0501249_002594 Ga0501249_002594_1862_2710 279
219 iso_pu_bacteria 2721755487 2722725642 279
220 3300002737 JGI25162J39368_1000747 JGI25162J39368_10007472 280
221 3300005288 Ga0065714_10006998 Ga0065714_100069984 280
222 3300005616 Ga0068852_100271379 Ga0068852_1002713792 280
223 3300009093 Ga0105240_10618990 Ga0105240_106189902 280
224 3300009545 Ga0105237_10018569 Ga0105237_100185698 280
225 3300009545 Ga0105237_10020764 Ga0105237_100207648 280
226 3300010375 Ga0105239_10002395 Ga0105239_1000239511 280
227 3300010375 Ga0105239_10014398 Ga0105239_100143986 280
228 3300013100 Ga0157373_10000546 Ga0157373_1000054619 280
229 3300013306 Ga0163162_10000012 Ga0163162_10000012154 280
230 3300013306 Ga0163162_10006625 Ga0163162_100066252 280
231 3300013308 Ga0157375_10061932 Ga0157375_100619325 280
232 3300017792 Ga0163161_10000330 Ga0163161_1000033023 280
233 3300017792 Ga0163161_10233620 Ga0163161_102336201 280
234 3300017792 Ga0163161_10319382 Ga0163161_103193822 280
235 3300025233 Ga0209437_100144 Ga0209437_100144140 280
236 3300025258 Ga0209129_1014702 Ga0209129_10147021 280
237 3300025914 Ga0207671_10010967 Ga0207671_100109673 280
238 3300025914 Ga0207671_10012803 Ga0207671_100128032 280
239 3300025981 Ga0207640_10035481 Ga0207640_100354814 280
240 3300026142 Ga0207698_10456319 Ga0207698_104563192 280
241 3300031548 Ga0307408_100000393 Ga0307408_10000039336 280
242 3300031911 Ga0307412_10000724 Ga0307412_1000072412 280
243 3300032004 Ga0307414_10012466 Ga0307414_100124662 280
244 3300033179 Ga0307507_10004342 Ga0307507_100043429 280
245 3300046471 Ga0495650_0056453 Ga0495650_0056453_171_1043 280
246 3300046501 Ga0495607_0190729 Ga0495607_0190729_151_1002 280
247 3300046513 Ga0495616_0000433 Ga0495616_0000433_13087_13947 280
248 3300046518 Ga0495631_0085723 Ga0495631_0085723_469_1329 280
249 3300046524 Ga0495648_0053592 Ga0495648_0053592_359_1219 280
250 3300046692 Ga0495671_0134556 Ga0495671_0134556_132_992 280
251 3300047472 Ga0495686_0046616 Ga0495686_0046616_534_1406 280
252 3300049459 Ga0495678_008245 Ga0495678_008245_1007_1867 280
253 2162886007 SwRhRL2b_contig_2961947 SwRhRL2b_0276.00008640 281
254 3300005288 Ga0065714_10003630 Ga0065714_1000363014 281
255 3300005288 Ga0065714_10066979 Ga0065714_100669792 281
256 3300005289 Ga0065704_10000206 Ga0065704_1000020672 281
257 3300005289 Ga0065704_10089388 Ga0065704_100893883 281
258 3300005539 Ga0068853_100021233 Ga0068853_1000212334 281
259 3300005563 Ga0068855_100000611 Ga0068855_10000061123 281
260 3300005614 Ga0068856_100000006 Ga0068856_10000000641 281
261 3300013100 Ga0157373_10000376 Ga0157373_1000037623 281
262 3300013102 Ga0157371_10000888 Ga0157371_1000088822 281
263 3300013102 Ga0157371_10001845 Ga0157371_100018459 281
264 3300013104 Ga0157370_10069775 Ga0157370_100697752 281
265 3300014497 Ga0182008_10000020 Ga0182008_1000002042 281
266 3300017792 Ga0163161_10146436 Ga0163161_101464363 281
267 3300025949 Ga0207667_10000477 Ga0207667_1000047728 281
268 3300026041 Ga0207639_10015609 Ga0207639_100156093 281
269 3300026078 Ga0207702_10000023 Ga0207702_1000002325 281
270 3300030744 Ga0316181_1267984 Ga0316181_12679841 281
271 3300031911 Ga0307412_10000001 Ga0307412_10000001358 281
272 3300032004 Ga0307414_10013334 Ga0307414_100133346 281
273 3300032004 Ga0307414_10195014 Ga0307414_101950142 281
274 3300037312 Ga0395899_0007040 Ga0395899_0007040_6062_6922 281
275 3300037418 Ga0395900_0001352 Ga0395900_0001352_6139_6999 281
276 3300037471 Ga0395905_0000246 Ga0395905_0000246_74318_75178 281
277 3300038443 Ga0395901_0000184 Ga0395901_0000184_74259_75119 281
278 3300047472 Ga0495686_0000306 Ga0495686_0000306_67802_68692 281
279 3300053093 Ga0500651_0001978 Ga0500651_0001978_3161_4006 281
280 3300053156 Ga0500622_0002663 Ga0500622_0002663_181_1065 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02621

VitK2_biosynth

Menaquinone biosynthesis

3

285

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.96 2 270
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9599 3 278
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9495 3 278
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.9424 2 270
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.8082 2 273
ID Description Score Start End Superfamily
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9343 3 278 3.40.190.10
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9189 3 278 3.40.190.10
1zbmA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9181 2 270 3.40.190.10
1zbmA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8915 2 270 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8758 80 177 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A519ZF11-F1-model_v4 1,4-dihydroxy-6-naphthoate synthase 0.9917 59 278 GO:0009234
GO:0016829
AF-A0A3M0YUJ9-F1-model_v4 1,4-dihydroxy-6-naphthoate synthase 0.9908 1 258 GO:0009234
GO:0016829
AF-A0A4Q3F9A6-F1-model_v4 deleted 0.9879 51 279
AF-A0A7Y5R4Q2-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9876 1 262 GO:0009234
GO:0016830
AF-A0A7T9I7Z1-F1-model_v4 deleted 0.9872 2 275

Feature Viewer

pLDDT pTM Quality
92.64 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map