F383541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 187 | 252 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100000611|Ga0068855_10000061123 |
| Length | 302 |
| Sequence | MKLTLGFSPCPNDTFIFDALIHHKIDTEGLEFEVHYDDVETLNQKAMRGELDITKLSYHAFAYVADRYVLLDAGSALGFGVGPLLIFKPPIQRFIKSTDKETFSGKSGSCEKTDLVSTISRHRIGIPGKYTTANFLLSLFFPDWTNKTELVFSDIENALLNGEIDLGLIIHENRFTYQDKGLEKLVDLGELWEKQTGCAIPLGGIVANRNLSLEVQHKINRILRRSVEFAFENPKSGLEFIRAHAQEMSEEVMYKHIELYVNKYSVDLGEEGKKAIKLLFDTAHEKNIIPEIKENIFITDFN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 4 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 5 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 6 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 7 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 8 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 9 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 10 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 11 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 12 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 13 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 14 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 15 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 16 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 17 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 18 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 19 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 20 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 21 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 22 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 23 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 24 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 25 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 26 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 27 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 28 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 29 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 30 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 31 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 32 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 33 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 34 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 35 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 138 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 139 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 140 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 144 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 149 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 150 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 170 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 171 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 172 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 177 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 178 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 179 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 186 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 187 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90 |
| Metatranscriptomes | 0 |
| Isolates | 10 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.93 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 82.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2961947 | 2162886007 | Bacteria | 5971 |
| 2 | SwRhRL2b_contig_661255 | 2162886007 | Bacteria | 1604 |
| 3 | JGI24736J21556_1001942 | 3300001904 | Bacteria | 3678 |
| 4 | JGI25162J39368_1000747 | 3300002737 | Bacteria | 22242 |
| 5 | JGI25162J39368_1000964 | 3300002737 | Bacteria | 18324 |
| 6 | JGI25152J39213_1000043 | 3300002773 | Bacteria | 87508 |
| 7 | JGI25150J39212_1000023 | 3300002774 | Bacteria | 130663 |
| 8 | JGI25151J46595_10000082 | 3300003187 | Bacteria | 130832 |
| 9 | JGI25406J46586_10028247 | 3300003203 | Bacteria | 2140 |
| 10 | JGI25165J46597_1002842 | 3300003214 | Bacteria | 4959 |
| 11 | JGI25153J46596_10000060 | 3300003215 | Bacteria | 131744 |
| 12 | rootH1_10171538 | 3300003316 | Bacteria | 1610 |
| 13 | rootH2_10001273 | 3300003320 | Bacteria | 179792 |
| 14 | rootH2_10014937 | 3300003320 | Bacteria | 2799 |
| 15 | rootH2_10141477 | 3300003320 | Bacteria | 5929 |
| 16 | rootH2_10187552 | 3300003320 | Bacteria | 1070 |
| 17 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 18 | Ga0055530_10000739 | 3300003791 | Bacteria | 27214 |
| 19 | Ga0065714_10003630 | 3300005288 | Bacteria | 23830 |
| 20 | Ga0065714_10006668 | 3300005288 | Bacteria | 3190 |
| 21 | Ga0065714_10006998 | 3300005288 | Bacteria | 3043 |
| 22 | Ga0065714_10064525 | 3300005288 | Bacteria | 41731 |
| 23 | Ga0065714_10066979 | 3300005288 | Bacteria | 6029 |
| 24 | Ga0065704_10000206 | 3300005289 | Bacteria | 121672 |
| 25 | Ga0065704_10089388 | 3300005289 | Bacteria | 2863 |
| 26 | Ga0065704_10145614 | 3300005289 | Bacteria | 1475 |
| 27 | Ga0070676_10014740 | 3300005328 | Bacteria | 4300 |
| 28 | Ga0068868_100007394 | 3300005338 | Bacteria | 7824 |
| 29 | Ga0070660_100020336 | 3300005339 | Bacteria | 4877 |
| 30 | Ga0070675_100307788 | 3300005354 | Bacteria | 1397 |
| 31 | Ga0070688_100048215 | 3300005365 | Bacteria | 2646 |
| 32 | Ga0070659_100000412 | 3300005366 | Bacteria | 32519 |
| 33 | Ga0070659_100028966 | 3300005366 | Bacteria | 4278 |
| 34 | Ga0068867_100021781 | 3300005459 | Bacteria | 4576 |
| 35 | Ga0070685_10036112 | 3300005466 | Unclassified | 2792 |
| 36 | Ga0070699_100000172 | 3300005518 | Bacteria | 62043 |
| 37 | Ga0068853_100021233 | 3300005539 | Bacteria | 5409 |
| 38 | Ga0070672_100272634 | 3300005543 | Unclassified | 1429 |
| 39 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 40 | Ga0068855_100000611 | 3300005563 | Bacteria | 43912 |
| 41 | Ga0068855_100019618 | 3300005563 | Bacteria | 8121 |
| 42 | Ga0068855_100111943 | 3300005563 | Bacteria | 3133 |
| 43 | Ga0068855_100296006 | 3300005563 | Bacteria | 1793 |
| 44 | Ga0068857_100046904 | 3300005577 | Bacteria | 3835 |
| 45 | Ga0068856_100000006 | 3300005614 | Bacteria | 223827 |
| 46 | Ga0068852_100271379 | 3300005616 | Bacteria | 1632 |
| 47 | Ga0068861_100418828 | 3300005719 | Bacteria | 1193 |
| 48 | Ga0068870_10098532 | 3300005840 | Bacteria | 1647 |
| 49 | Ga0068863_100189155 | 3300005841 | Unclassified | 1978 |
| 50 | Ga0068858_100009152 | 3300005842 | Bacteria | 9471 |
| 51 | Ga0068860_100519130 | 3300005843 | Bacteria | 1191 |
| 52 | Ga0068862_100001533 | 3300005844 | Bacteria | 21121 |
| 53 | Ga0097621_100000285 | 3300006237 | Bacteria | 34046 |
| 54 | Ga0068871_100000080 | 3300006358 | Bacteria | 53930 |
| 55 | Ga0068871_100139594 | 3300006358 | Bacteria | 2060 |
| 56 | Ga0075431_100322484 | 3300006847 | Bacteria | 1557 |
| 57 | Ga0075433_10026165 | 3300006852 | Bacteria | 4937 |
| 58 | Ga0075434_100000213 | 3300006871 | Bacteria | 39624 |
| 59 | Ga0075434_100193584 | 3300006871 | Unclassified | 2054 |
| 60 | Ga0075429_100394119 | 3300006880 | Bacteria | 1212 |
| 61 | Ga0075436_100367954 | 3300006914 | Unclassified | 1038 |
| 62 | Ga0075435_100206251 | 3300007076 | Unclassified | 1666 |
| 63 | Ga0105251_10062823 | 3300009011 | Bacteria | 1743 |
| 64 | Ga0105244_10088478 | 3300009036 | Bacteria | 1525 |
| 65 | Ga0105240_10048169 | 3300009093 | Bacteria | 5388 |
| 66 | Ga0105240_10091089 | 3300009093 | Bacteria | 3726 |
| 67 | Ga0105240_10618990 | 3300009093 | Bacteria | 1190 |
| 68 | Ga0111539_10005859 | 3300009094 | Bacteria | 15880 |
| 69 | Ga0111539_10013986 | 3300009094 | Bacteria | 10028 |
| 70 | Ga0111539_10046784 | 3300009094 | Bacteria | 5174 |
| 71 | Ga0105245_10538538 | 3300009098 | Unclassified | 1188 |
| 72 | Ga0114129_10027105 | 3300009147 | Bacteria | 8113 |
| 73 | Ga0114129_10057047 | 3300009147 | Bacteria | 5468 |
| 74 | Ga0105243_10000046 | 3300009148 | Bacteria | 155277 |
| 75 | Ga0105243_10404872 | 3300009148 | Bacteria | 1268 |
| 76 | Ga0105241_10058615 | 3300009174 | Bacteria | 2958 |
| 77 | Ga0105248_10209314 | 3300009177 | Unclassified | 2197 |
| 78 | Ga0105237_10000088 | 3300009545 | Bacteria | 124518 |
| 79 | Ga0105237_10003145 | 3300009545 | Bacteria | 19862 |
| 80 | Ga0105237_10018569 | 3300009545 | Bacteria | 7194 |
| 81 | Ga0105237_10020764 | 3300009545 | Bacteria | 6765 |
| 82 | Ga0105237_10580519 | 3300009545 | Bacteria | 1128 |
| 83 | Ga0105238_10003441 | 3300009551 | Bacteria | 15759 |
| 84 | Ga0105239_10002395 | 3300010375 | Bacteria | 23910 |
| 85 | Ga0105239_10014398 | 3300010375 | Bacteria | 8776 |
| 86 | Ga0105246_10446865 | 3300011119 | Bacteria | 1085 |
| 87 | Ga0157373_10000376 | 3300013100 | Bacteria | 35743 |
| 88 | Ga0157373_10000546 | 3300013100 | Bacteria | 29458 |
| 89 | Ga0157373_10025311 | 3300013100 | Bacteria | 4294 |
| 90 | Ga0157371_10000151 | 3300013102 | Bacteria | 101401 |
| 91 | Ga0157371_10000888 | 3300013102 | Bacteria | 33749 |
| 92 | Ga0157371_10001845 | 3300013102 | Bacteria | 21336 |
| 93 | Ga0157371_10179124 | 3300013102 | Bacteria | 1516 |
| 94 | Ga0157370_10000597 | 3300013104 | Bacteria | 45043 |
| 95 | Ga0157370_10012044 | 3300013104 | Bacteria | 9002 |
| 96 | Ga0157370_10057676 | 3300013104 | Bacteria | 3691 |
| 97 | Ga0157370_10069775 | 3300013104 | Bacteria | 3319 |
| 98 | Ga0157370_10072526 | 3300013104 | Bacteria | 3248 |
| 99 | Ga0157370_10084198 | 3300013104 | Bacteria | 2989 |
| 100 | Ga0157370_10187446 | 3300013104 | Bacteria | 1920 |
| 101 | Ga0157370_10251321 | 3300013104 | Bacteria | 1635 |
| 102 | Ga0157369_10000050 | 3300013105 | Bacteria | 167294 |
| 103 | Ga0157374_10001208 | 3300013296 | Bacteria | 22108 |
| 104 | Ga0157378_10017834 | 3300013297 | Bacteria | 6232 |
| 105 | Ga0163162_10000011 | 3300013306 | Bacteria | 299877 |
| 106 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 107 | Ga0163162_10006625 | 3300013306 | Bacteria | 11224 |
| 108 | Ga0157372_10007865 | 3300013307 | Bacteria | 11331 |
| 109 | Ga0157372_10235544 | 3300013307 | Bacteria | 2123 |
| 110 | Ga0157372_10801778 | 3300013307 | Bacteria | 1094 |
| 111 | Ga0157375_10015704 | 3300013308 | Bacteria | 6784 |
| 112 | Ga0157375_10061932 | 3300013308 | Bacteria | 3716 |
| 113 | Ga0157375_10543000 | 3300013308 | Bacteria | 1324 |
| 114 | Ga0182008_10000020 | 3300014497 | Bacteria | 228333 |
| 115 | Ga0182008_10000296 | 3300014497 | Bacteria | 39012 |
| 116 | Ga0182008_10000342 | 3300014497 | Bacteria | 36331 |
| 117 | Ga0157376_10033232 | 3300014969 | Bacteria | 4150 |
| 118 | Ga0182006_1000242 | 3300015261 | Bacteria | 50864 |
| 119 | Ga0182006_1000310 | 3300015261 | Bacteria | 42614 |
| 120 | Ga0182007_10000008 | 3300015262 | Bacteria | 332953 |
| 121 | Ga0182007_10014401 | 3300015262 | Bacteria | 2983 |
| 122 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 123 | Ga0163161_10000330 | 3300017792 | Bacteria | 40454 |
| 124 | Ga0163161_10000565 | 3300017792 | Bacteria | 29834 |
| 125 | Ga0163161_10002836 | 3300017792 | Bacteria | 12297 |
| 126 | Ga0163161_10004569 | 3300017792 | Bacteria | 9637 |
| 127 | Ga0163161_10031172 | 3300017792 | Bacteria | 3797 |
| 128 | Ga0163161_10146436 | 3300017792 | Bacteria | 1792 |
| 129 | Ga0163161_10233620 | 3300017792 | Bacteria | 1428 |
| 130 | Ga0163161_10319382 | 3300017792 | Bacteria | 1227 |
| 131 | Ga0207427_100072 | 3300025231 | Bacteria | 158364 |
| 132 | Ga0209437_100026 | 3300025233 | Bacteria | 542698 |
| 133 | Ga0209437_100144 | 3300025233 | Bacteria | 164794 |
| 134 | Ga0207425_1000051 | 3300025245 | Bacteria | 166795 |
| 135 | Ga0209129_1000121 | 3300025258 | Bacteria | 135404 |
| 136 | Ga0209129_1014702 | 3300025258 | Bacteria | 1653 |
| 137 | Ga0209233_1000111 | 3300025261 | Bacteria | 260262 |
| 138 | Ga0209233_1002603 | 3300025261 | Bacteria | 6554 |
| 139 | Ga0209233_1013211 | 3300025261 | Bacteria | 2362 |
| 140 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 141 | Ga0209025_1000160 | 3300025294 | Bacteria | 166795 |
| 142 | Ga0209758_1000147 | 3300025297 | Bacteria | 166795 |
| 143 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 144 | Ga0207647_10000103 | 3300025904 | Bacteria | 65792 |
| 145 | Ga0207643_10086182 | 3300025908 | Bacteria | 1825 |
| 146 | Ga0207705_10206569 | 3300025909 | Unclassified | 1489 |
| 147 | Ga0207695_10007414 | 3300025913 | Bacteria | 13973 |
| 148 | Ga0207695_10015443 | 3300025913 | Bacteria | 8988 |
| 149 | Ga0207671_10000744 | 3300025914 | Bacteria | 41309 |
| 150 | Ga0207671_10010967 | 3300025914 | Bacteria | 7424 |
| 151 | Ga0207671_10012803 | 3300025914 | Bacteria | 6723 |
| 152 | Ga0207657_10089742 | 3300025919 | Bacteria | 2566 |
| 153 | Ga0207681_10060642 | 3300025923 | Bacteria | 2597 |
| 154 | Ga0207650_10186489 | 3300025925 | Unclassified | 1655 |
| 155 | Ga0207690_10000049 | 3300025932 | Bacteria | 113589 |
| 156 | Ga0207690_10004182 | 3300025932 | Bacteria | 8526 |
| 157 | Ga0207709_10000020 | 3300025935 | Bacteria | 392366 |
| 158 | Ga0207709_10252343 | 3300025935 | Bacteria | 1289 |
| 159 | Ga0207704_10000065 | 3300025938 | Bacteria | 69867 |
| 160 | Ga0207667_10000477 | 3300025949 | Bacteria | 53347 |
| 161 | Ga0207667_10010697 | 3300025949 | Bacteria | 10708 |
| 162 | Ga0207667_10089426 | 3300025949 | Bacteria | 3183 |
| 163 | Ga0207640_10035481 | 3300025981 | Bacteria | 3122 |
| 164 | Ga0207677_10026155 | 3300026023 | Bacteria | 3655 |
| 165 | Ga0207639_10007063 | 3300026041 | Bacteria | 7658 |
| 166 | Ga0207639_10015609 | 3300026041 | Bacteria | 5359 |
| 167 | Ga0207702_10000023 | 3300026078 | Bacteria | 189234 |
| 168 | Ga0207641_10125920 | 3300026088 | Bacteria | 2294 |
| 169 | Ga0207648_10001417 | 3300026089 | Bacteria | 26440 |
| 170 | Ga0207674_10084236 | 3300026116 | Bacteria | 3178 |
| 171 | Ga0207675_100507880 | 3300026118 | Bacteria | 1201 |
| 172 | Ga0207683_10008658 | 3300026121 | Bacteria | 8702 |
| 173 | Ga0207698_10012985 | 3300026142 | Bacteria | 5477 |
| 174 | Ga0207698_10456319 | 3300026142 | Bacteria | 1235 |
| 175 | Ga0207428_10037186 | 3300027907 | Bacteria | 3963 |
| 176 | Ga0207428_10255859 | 3300027907 | Bacteria | 1305 |
| 177 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 178 | Ga0268265_10009722 | 3300028380 | Bacteria | 6491 |
| 179 | Ga0307515_10016181 | 3300028794 | Bacteria | 13677 |
| 180 | Ga0316177_1127916 | 3300030731 | Bacteria | 11558 |
| 181 | Ga0316183_1100732 | 3300030742 | Bacteria | 40906 |
| 182 | Ga0316181_1246477 | 3300030744 | Bacteria | 962 |
| 183 | Ga0316181_1267984 | 3300030744 | Bacteria | 1441 |
| 184 | Ga0316182_1306507 | 3300030745 | Bacteria | 980 |
| 185 | Ga0307408_100000209 | 3300031548 | Bacteria | 62437 |
| 186 | Ga0307408_100000393 | 3300031548 | Bacteria | 39808 |
| 187 | Ga0307405_10000017 | 3300031731 | Bacteria | 195149 |
| 188 | Ga0307405_10012446 | 3300031731 | Bacteria | 4504 |
| 189 | Ga0307407_10000002 | 3300031903 | Bacteria | 323084 |
| 190 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 191 | Ga0307412_10000724 | 3300031911 | Bacteria | 19071 |
| 192 | Ga0307412_10008869 | 3300031911 | Bacteria | 5760 |
| 193 | Ga0307412_10078796 | 3300031911 | Bacteria | 2271 |
| 194 | Ga0307412_10095876 | 3300031911 | Bacteria | 2087 |
| 195 | Ga0307416_100000005 | 3300032002 | Bacteria | 477728 |
| 196 | Ga0307414_10012466 | 3300032004 | Bacteria | 5027 |
| 197 | Ga0307414_10013334 | 3300032004 | Bacteria | 4890 |
| 198 | Ga0307414_10038285 | 3300032004 | Bacteria | 3219 |
| 199 | Ga0307414_10080037 | 3300032004 | Bacteria | 2388 |
| 200 | Ga0307414_10195014 | 3300032004 | Bacteria | 1642 |
| 201 | Ga0307414_10197286 | 3300032004 | Bacteria | 1634 |
| 202 | Ga0307414_10269579 | 3300032004 | Bacteria | 1425 |
| 203 | Ga0307411_10050719 | 3300032005 | Unclassified | 2704 |
| 204 | Ga0307507_10004342 | 3300033179 | Bacteria | 25343 |
| 205 | Ga0307510_10000419 | 3300033180 | Bacteria | 40732 |
| 206 | Ga0373953_0174656 | 3300035117 | Bacteria | 926 |
| 207 | Ga0395899_0007040 | 3300037312 | Bacteria | 8703 |
| 208 | Ga0395900_0001352 | 3300037418 | Bacteria | 29621 |
| 209 | Ga0395900_0321112 | 3300037418 | Bacteria | 1528 |
| 210 | Ga0395905_0000246 | 3300037471 | Bacteria | 81356 |
| 211 | Ga0395901_0000184 | 3300038443 | Bacteria | 81257 |
| 212 | Ga0395901_0014385 | 3300038443 | Bacteria | 8054 |
| 213 | Ga0495650_0056453 | 3300046471 | Bacteria | 1593 |
| 214 | Ga0495607_0190729 | 3300046501 | Bacteria | 1021 |
| 215 | Ga0495606_0128677 | 3300046507 | Bacteria | 1507 |
| 216 | Ga0495610_0000054 | 3300046512 | Bacteria | 140031 |
| 217 | Ga0495610_0000292 | 3300046512 | Bacteria | 52555 |
| 218 | Ga0495616_0000433 | 3300046513 | Bacteria | 31968 |
| 219 | Ga0495631_0022308 | 3300046518 | Bacteria | 2943 |
| 220 | Ga0495631_0085723 | 3300046518 | Bacteria | 1357 |
| 221 | Ga0495648_0053592 | 3300046524 | Bacteria | 2443 |
| 222 | Ga0495609_0061908 | 3300046538 | Bacteria | 1653 |
| 223 | Ga0495625_0242112 | 3300046660 | Bacteria | 1174 |
| 224 | Ga0495671_0134556 | 3300046692 | Bacteria | 1205 |
| 225 | Ga0495649_0040703 | 3300046694 | Bacteria | 2543 |
| 226 | Ga0495687_007696 | 3300047443 | Bacteria | 6290 |
| 227 | Ga0495684_0261297 | 3300047471 | Bacteria | 1256 |
| 228 | Ga0495686_0000306 | 3300047472 | Bacteria | 83341 |
| 229 | Ga0495686_0001597 | 3300047472 | Bacteria | 23929 |
| 230 | Ga0495686_0046616 | 3300047472 | Bacteria | 2739 |
| 231 | Ga0496116_0001204 | 3300048919 | Bacteria | 30298 |
| 232 | Ga0496117_0002757 | 3300048920 | Bacteria | 21518 |
| 233 | Ga0496122_0000817 | 3300048925 | Bacteria | 59596 |
| 234 | Ga0496123_0008229 | 3300048926 | Bacteria | 9615 |
| 235 | Ga0496125_0029453 | 3300048928 | Bacteria | 4933 |
| 236 | Ga0495678_008245 | 3300049459 | Bacteria | 5281 |
| 237 | Ga0501048_0291814 | 3300049582 | Bacteria | 1160 |
| 238 | Ga0501198_001244 | 3300049649 | Bacteria | 3288 |
| 239 | Ga0501240_002373 | 3300049673 | Bacteria | 1991 |
| 240 | Ga0501249_002594 | 3300049679 | Bacteria | 3642 |
| 241 | nmdc:mga05p37_319310_c1 | 3300050507 | Bacteria | 1839 |
| 242 | nmdc:mga05p37_333234_c1 | 3300050507 | Bacteria | 1792 |
| 243 | nmdc:mga06r32_441389_c1 | 3300050510 | Bacteria | 1282 |
| 244 | nmdc:mga08y16_21591_c1 | 3300050511 | Bacteria | 6798 |
| 245 | nmdc:mga08y16_448055_c1 | 3300050511 | Bacteria | 1317 |
| 246 | nmdc:mga0n895_181953_c1 | 3300050512 | Unclassified | 2133 |
| 247 | nmdc:mga0n895_7906_c1 | 3300050512 | Bacteria | 9168 |
| 248 | nmdc:mga0rr50_72259_c1 | 3300050513 | Unclassified | 2634 |
| 249 | nmdc:mga0a205_6492_c1 | 3300050515 | Bacteria | 10574 |
| 250 | Ga0500651_0001978 | 3300053093 | Bacteria | 10625 |
| 251 | Ga0500608_000417 | 3300053122 | Bacteria | 16208 |
| 252 | Ga0500622_0002663 | 3300053156 | Bacteria | 12672 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049673 | Ga0501240_002373 | Ga0501240_002373_44_811 | 240 |
| 2 | 3300050512 | nmdc:mga0n895_181953_c1 | nmdc:mga0n895_181953_c1_879_1685 | 240 |
| 3 | 3300038443 | Ga0395901_0014385 | Ga0395901_0014385_6109_6882 | 253 |
| 4 | 3300006871 | Ga0075434_100193584 | Ga0075434_1001935843 | 255 |
| 5 | 3300046538 | Ga0495609_0061908 | Ga0495609_0061908_52_906 | 257 |
| 6 | 3300047471 | Ga0495684_0261297 | Ga0495684_0261297_197_988 | 257 |
| 7 | 3300050510 | nmdc:mga06r32_441389_c1 | nmdc:mga06r32_441389_c1_42_836 | 258 |
| 8 | 3300031548 | Ga0307408_100000209 | Ga0307408_10000020958 | 270 |
| 9 | 3300005466 | Ga0070685_10036112 | Ga0070685_100361124 | 271 |
| 10 | 3300005543 | Ga0070672_100272634 | Ga0070672_1002726342 | 271 |
| 11 | 3300005843 | Ga0068860_100519130 | Ga0068860_1005191302 | 271 |
| 12 | 3300035117 | Ga0373953_0174656 | Ga0373953_0174656_55_888 | 271 |
| 13 | iso_pu_bacteria | 2739367656 | 2739615135 | 271 |
| 14 | 3300005841 | Ga0068863_100189155 | Ga0068863_1001891552 | 272 |
| 15 | 3300005842 | Ga0068858_100009152 | Ga0068858_10000915210 | 272 |
| 16 | 3300009094 | Ga0111539_10005859 | Ga0111539_1000585910 | 272 |
| 17 | 3300009098 | Ga0105245_10538538 | Ga0105245_105385382 | 272 |
| 18 | 3300009177 | Ga0105248_10209314 | Ga0105248_102093142 | 272 |
| 19 | 3300014969 | Ga0157376_10033232 | Ga0157376_100332326 | 272 |
| 20 | 3300025925 | Ga0207650_10186489 | Ga0207650_101864892 | 272 |
| 21 | 3300026088 | Ga0207641_10125920 | Ga0207641_101259202 | 272 |
| 22 | 3300027907 | Ga0207428_10037186 | Ga0207428_100371866 | 272 |
| 23 | 3300050511 | nmdc:mga08y16_21591_c1 | nmdc:mga08y16_21591_c1_5755_6591 | 272 |
| 24 | iso_pu_bacteria | 2945997725 | 2945997878 | 272 |
| 25 | 3300003203 | JGI25406J46586_10028247 | JGI25406J46586_100282472 | 273 |
| 26 | 3300003316 | rootH1_10171538 | rootH1_101715382 | 273 |
| 27 | 3300005365 | Ga0070688_100048215 | Ga0070688_1000482152 | 273 |
| 28 | 3300005518 | Ga0070699_100000172 | Ga0070699_10000017248 | 273 |
| 29 | 3300005719 | Ga0068861_100418828 | Ga0068861_1004188282 | 273 |
| 30 | 3300005844 | Ga0068862_100001533 | Ga0068862_10000153318 | 273 |
| 31 | 3300006358 | Ga0068871_100139594 | Ga0068871_1001395942 | 273 |
| 32 | 3300006847 | Ga0075431_100322484 | Ga0075431_1003224842 | 273 |
| 33 | 3300006852 | Ga0075433_10026165 | Ga0075433_100261652 | 273 |
| 34 | 3300006871 | Ga0075434_100000213 | Ga0075434_10000021317 | 273 |
| 35 | 3300006880 | Ga0075429_100394119 | Ga0075429_1003941192 | 273 |
| 36 | 3300006914 | Ga0075436_100367954 | Ga0075436_1003679542 | 273 |
| 37 | 3300007076 | Ga0075435_100206251 | Ga0075435_1002062512 | 273 |
| 38 | 3300009094 | Ga0111539_10013986 | Ga0111539_1001398610 | 273 |
| 39 | 3300009094 | Ga0111539_10046784 | Ga0111539_100467845 | 273 |
| 40 | 3300009147 | Ga0114129_10027105 | Ga0114129_100271057 | 273 |
| 41 | 3300009147 | Ga0114129_10057047 | Ga0114129_100570474 | 273 |
| 42 | 3300009148 | Ga0105243_10404872 | Ga0105243_104048722 | 273 |
| 43 | 3300011119 | Ga0105246_10446865 | Ga0105246_104468651 | 273 |
| 44 | 3300025909 | Ga0207705_10206569 | Ga0207705_102065692 | 273 |
| 45 | 3300025923 | Ga0207681_10060642 | Ga0207681_100606425 | 273 |
| 46 | 3300025935 | Ga0207709_10252343 | Ga0207709_102523432 | 273 |
| 47 | 3300026118 | Ga0207675_100507880 | Ga0207675_1005078801 | 273 |
| 48 | 3300027907 | Ga0207428_10255859 | Ga0207428_102558592 | 273 |
| 49 | 3300028380 | Ga0268265_10009722 | Ga0268265_100097228 | 273 |
| 50 | 3300030744 | Ga0316181_1246477 | Ga0316181_12464772 | 273 |
| 51 | 3300031731 | Ga0307405_10012446 | Ga0307405_100124465 | 273 |
| 52 | 3300031911 | Ga0307412_10008869 | Ga0307412_100088691 | 273 |
| 53 | 3300032004 | Ga0307414_10197286 | Ga0307414_101972862 | 273 |
| 54 | 3300049582 | Ga0501048_0291814 | Ga0501048_0291814_306_1148 | 273 |
| 55 | 3300049649 | Ga0501198_001244 | Ga0501198_001244_2093_2956 | 273 |
| 56 | 3300050507 | nmdc:mga05p37_319310_c1 | nmdc:mga05p37_319310_c1_384_1223 | 273 |
| 57 | 3300050507 | nmdc:mga05p37_333234_c1 | nmdc:mga05p37_333234_c1_382_1221 | 273 |
| 58 | 3300050511 | nmdc:mga08y16_448055_c1 | nmdc:mga08y16_448055_c1_299_1141 | 273 |
| 59 | 3300050512 | nmdc:mga0n895_7906_c1 | nmdc:mga0n895_7906_c1_1496_2350 | 273 |
| 60 | 3300050513 | nmdc:mga0rr50_72259_c1 | nmdc:mga0rr50_72259_c1_1151_2005 | 273 |
| 61 | 3300050515 | nmdc:mga0a205_6492_c1 | nmdc:mga0a205_6492_c1_9687_10541 | 273 |
| 62 | iso_pu_bacteria | 2895498888 | 2895500276 | 273 |
| 63 | 3300005339 | Ga0070660_100020336 | Ga0070660_1000203362 | 275 |
| 64 | 3300005366 | Ga0070659_100000412 | Ga0070659_1000004126 | 275 |
| 65 | 3300013308 | Ga0157375_10543000 | Ga0157375_105430002 | 275 |
| 66 | 3300025919 | Ga0207657_10089742 | Ga0207657_100897422 | 275 |
| 67 | 3300025932 | Ga0207690_10000049 | Ga0207690_1000004961 | 275 |
| 68 | iso_pu_bacteria | 2585427687 | 2586206416 | 275 |
| 69 | iso_pu_bacteria | 2738541283 | 2738755958 | 275 |
| 70 | iso_pu_bacteria | 2738541302 | 2738852874 | 275 |
| 71 | iso_pu_bacteria | 2739367651 | 2739586818 | 275 |
| 72 | iso_pu_bacteria | 2739367663 | 2739645728 | 275 |
| 73 | iso_pu_bacteria | 2818991437 | 2819547240 | 275 |
| 74 | iso_pu_bacteria | 2842722452 | 2842726991 | 275 |
| 75 | iso_pu_bacteria | 2842903701 | 2842905065 | 275 |
| 76 | iso_pu_bacteria | 2842909656 | 2842911007 | 275 |
| 77 | iso_pu_bacteria | 2849281842 | 2849283867 | 275 |
| 78 | iso_pu_bacteria | 2857627736 | 2857627930 | 275 |
| 79 | iso_pu_bacteria | 2904445276 | 2904447721 | 275 |
| 80 | iso_pu_bacteria | 2904780799 | 2904782354 | 275 |
| 81 | iso_pu_bacteria | 2919177583 | 2919178448 | 275 |
| 82 | iso_pu_bacteria | 2954016120 | 2954020361 | 275 |
| 83 | 3300017792 | Ga0163161_10002836 | Ga0163161_100028368 | 276 |
| 84 | 3300046512 | Ga0495610_0000054 | Ga0495610_0000054_101069_101908 | 276 |
| 85 | iso_pu_bacteria | 2898713307 | 2898714583 | 276 |
| 86 | 3300003320 | rootH2_10001273 | rootH2_10001273158 | 277 |
| 87 | 3300033180 | Ga0307510_10000419 | Ga0307510_1000041922 | 277 |
| 88 | 3300046518 | Ga0495631_0022308 | Ga0495631_0022308_1642_2478 | 277 |
| 89 | 3300046660 | Ga0495625_0242112 | Ga0495625_0242112_289_1125 | 277 |
| 90 | 3300046694 | Ga0495649_0040703 | Ga0495649_0040703_634_1470 | 277 |
| 91 | 3300053122 | Ga0500608_000417 | Ga0500608_000417_6326_7162 | 277 |
| 92 | iso_pu_bacteria | 2738541284 | 2738761380 | 277 |
| 93 | iso_pu_bacteria | 2775506987 | 2776616008 | 277 |
| 94 | iso_pu_bacteria | 2852627209 | 2852628199 | 277 |
| 95 | iso_pu_bacteria | 2887375801 | 2887379614 | 277 |
| 96 | iso_pu_bacteria | 2890737413 | 2890739238 | 277 |
| 97 | iso_pu_bacteria | 2896317667 | 2896320344 | 277 |
| 98 | iso_pu_bacteria | 2896344016 | 2896344870 | 277 |
| 99 | iso_pu_bacteria | 2902048731 | 2902049614 | 277 |
| 100 | 3300003320 | rootH2_10141477 | rootH2_101414776 | 278 |
| 101 | 3300003320 | rootH2_10187552 | rootH2_101875522 | 278 |
| 102 | 3300003781 | Ga0055536_1000002 | Ga0055536_100000247 | 278 |
| 103 | 3300003791 | Ga0055530_10000739 | Ga0055530_1000073914 | 278 |
| 104 | 3300005548 | Ga0070665_100000118 | Ga0070665_100000118143 | 278 |
| 105 | 3300005563 | Ga0068855_100019618 | Ga0068855_1000196186 | 278 |
| 106 | 3300005840 | Ga0068870_10098532 | Ga0068870_100985322 | 278 |
| 107 | 3300009093 | Ga0105240_10048169 | Ga0105240_100481692 | 278 |
| 108 | 3300009093 | Ga0105240_10091089 | Ga0105240_100910894 | 278 |
| 109 | 3300013307 | Ga0157372_10007865 | Ga0157372_100078654 | 278 |
| 110 | 3300025292 | Ga0209676_1000022 | Ga0209676_1000022493 | 278 |
| 111 | 3300025298 | Ga0209050_1000020 | Ga0209050_100002046 | 278 |
| 112 | 3300025908 | Ga0207643_10086182 | Ga0207643_100861823 | 278 |
| 113 | 3300025913 | Ga0207695_10007414 | Ga0207695_100074149 | 278 |
| 114 | 3300025913 | Ga0207695_10015443 | Ga0207695_100154436 | 278 |
| 115 | 3300025949 | Ga0207667_10010697 | Ga0207667_100106977 | 278 |
| 116 | 3300028379 | Ga0268266_10000121 | Ga0268266_1000012114 | 278 |
| 117 | 3300032004 | Ga0307414_10080037 | Ga0307414_100800372 | 278 |
| 118 | 3300032005 | Ga0307411_10050719 | Ga0307411_100507193 | 278 |
| 119 | 3300046507 | Ga0495606_0128677 | Ga0495606_0128677_387_1265 | 278 |
| 120 | 2162886007 | SwRhRL2b_contig_661255 | SwRhRL2b_0499.00005490 | 279 |
| 121 | 3300001904 | JGI24736J21556_1001942 | JGI24736J21556_10019422 | 279 |
| 122 | 3300002737 | JGI25162J39368_1000964 | JGI25162J39368_10009648 | 279 |
| 123 | 3300002773 | JGI25152J39213_1000043 | JGI25152J39213_100004324 | 279 |
| 124 | 3300002774 | JGI25150J39212_1000023 | JGI25150J39212_1000023102 | 279 |
| 125 | 3300003187 | JGI25151J46595_10000082 | JGI25151J46595_10000082102 | 279 |
| 126 | 3300003214 | JGI25165J46597_1002842 | JGI25165J46597_10028422 | 279 |
| 127 | 3300003215 | JGI25153J46596_10000060 | JGI25153J46596_10000060103 | 279 |
| 128 | 3300003320 | rootH2_10014937 | rootH2_100149372 | 279 |
| 129 | 3300005288 | Ga0065714_10006668 | Ga0065714_100066684 | 279 |
| 130 | 3300005288 | Ga0065714_10064525 | Ga0065714_1006452529 | 279 |
| 131 | 3300005289 | Ga0065704_10145614 | Ga0065704_101456142 | 279 |
| 132 | 3300005328 | Ga0070676_10014740 | Ga0070676_100147406 | 279 |
| 133 | 3300005338 | Ga0068868_100007394 | Ga0068868_1000073947 | 279 |
| 134 | 3300005354 | Ga0070675_100307788 | Ga0070675_1003077882 | 279 |
| 135 | 3300005366 | Ga0070659_100028966 | Ga0070659_1000289663 | 279 |
| 136 | 3300005459 | Ga0068867_100021781 | Ga0068867_1000217812 | 279 |
| 137 | 3300005563 | Ga0068855_100111943 | Ga0068855_1001119433 | 279 |
| 138 | 3300005563 | Ga0068855_100296006 | Ga0068855_1002960062 | 279 |
| 139 | 3300005577 | Ga0068857_100046904 | Ga0068857_1000469044 | 279 |
| 140 | 3300006237 | Ga0097621_100000285 | Ga0097621_10000028518 | 279 |
| 141 | 3300006358 | Ga0068871_100000080 | Ga0068871_10000008039 | 279 |
| 142 | 3300009011 | Ga0105251_10062823 | Ga0105251_100628232 | 279 |
| 143 | 3300009036 | Ga0105244_10088478 | Ga0105244_100884782 | 279 |
| 144 | 3300009148 | Ga0105243_10000046 | Ga0105243_10000046106 | 279 |
| 145 | 3300009174 | Ga0105241_10058615 | Ga0105241_100586154 | 279 |
| 146 | 3300009545 | Ga0105237_10000088 | Ga0105237_1000008856 | 279 |
| 147 | 3300009545 | Ga0105237_10003145 | Ga0105237_1000314513 | 279 |
| 148 | 3300009545 | Ga0105237_10580519 | Ga0105237_105805191 | 279 |
| 149 | 3300009551 | Ga0105238_10003441 | Ga0105238_100034415 | 279 |
| 150 | 3300013100 | Ga0157373_10025311 | Ga0157373_100253113 | 279 |
| 151 | 3300013102 | Ga0157371_10000151 | Ga0157371_1000015137 | 279 |
| 152 | 3300013102 | Ga0157371_10179124 | Ga0157371_101791242 | 279 |
| 153 | 3300013104 | Ga0157370_10000597 | Ga0157370_1000059711 | 279 |
| 154 | 3300013104 | Ga0157370_10012044 | Ga0157370_100120442 | 279 |
| 155 | 3300013104 | Ga0157370_10057676 | Ga0157370_100576763 | 279 |
| 156 | 3300013104 | Ga0157370_10072526 | Ga0157370_100725264 | 279 |
| 157 | 3300013104 | Ga0157370_10084198 | Ga0157370_100841983 | 279 |
| 158 | 3300013104 | Ga0157370_10187446 | Ga0157370_101874462 | 279 |
| 159 | 3300013104 | Ga0157370_10251321 | Ga0157370_102513212 | 279 |
| 160 | 3300013105 | Ga0157369_10000050 | Ga0157369_1000005060 | 279 |
| 161 | 3300013296 | Ga0157374_10001208 | Ga0157374_1000120814 | 279 |
| 162 | 3300013297 | Ga0157378_10017834 | Ga0157378_100178346 | 279 |
| 163 | 3300013306 | Ga0163162_10000011 | Ga0163162_10000011233 | 279 |
| 164 | 3300013307 | Ga0157372_10235544 | Ga0157372_102355443 | 279 |
| 165 | 3300013307 | Ga0157372_10801778 | Ga0157372_108017781 | 279 |
| 166 | 3300013308 | Ga0157375_10015704 | Ga0157375_100157042 | 279 |
| 167 | 3300014497 | Ga0182008_10000296 | Ga0182008_1000029611 | 279 |
| 168 | 3300014497 | Ga0182008_10000342 | Ga0182008_1000034214 | 279 |
| 169 | 3300015261 | Ga0182006_1000242 | Ga0182006_100024232 | 279 |
| 170 | 3300015261 | Ga0182006_1000310 | Ga0182006_100031034 | 279 |
| 171 | 3300015262 | Ga0182007_10000008 | Ga0182007_10000008231 | 279 |
| 172 | 3300015262 | Ga0182007_10014401 | Ga0182007_100144012 | 279 |
| 173 | 3300015682 | Ga0183373_1002 | Ga0183373_1002504 | 279 |
| 174 | 3300017792 | Ga0163161_10000565 | Ga0163161_1000056512 | 279 |
| 175 | 3300017792 | Ga0163161_10004569 | Ga0163161_100045698 | 279 |
| 176 | 3300017792 | Ga0163161_10031172 | Ga0163161_100311723 | 279 |
| 177 | 3300025231 | Ga0207427_100072 | Ga0207427_10007255 | 279 |
| 178 | 3300025233 | Ga0209437_100026 | Ga0209437_100026287 | 279 |
| 179 | 3300025245 | Ga0207425_1000051 | Ga0207425_1000051135 | 279 |
| 180 | 3300025258 | Ga0209129_1000121 | Ga0209129_1000121102 | 279 |
| 181 | 3300025261 | Ga0209233_1000111 | Ga0209233_1000111181 | 279 |
| 182 | 3300025261 | Ga0209233_1002603 | Ga0209233_10026031 | 279 |
| 183 | 3300025261 | Ga0209233_1013211 | Ga0209233_10132112 | 279 |
| 184 | 3300025294 | Ga0209025_1000160 | Ga0209025_100016025 | 279 |
| 185 | 3300025297 | Ga0209758_1000147 | Ga0209758_100014725 | 279 |
| 186 | 3300025904 | Ga0207647_10000103 | Ga0207647_1000010349 | 279 |
| 187 | 3300025914 | Ga0207671_10000744 | Ga0207671_1000074426 | 279 |
| 188 | 3300025932 | Ga0207690_10004182 | Ga0207690_100041823 | 279 |
| 189 | 3300025935 | Ga0207709_10000020 | Ga0207709_10000020236 | 279 |
| 190 | 3300025938 | Ga0207704_10000065 | Ga0207704_1000006523 | 279 |
| 191 | 3300025949 | Ga0207667_10089426 | Ga0207667_100894262 | 279 |
| 192 | 3300026023 | Ga0207677_10026155 | Ga0207677_100261552 | 279 |
| 193 | 3300026041 | Ga0207639_10007063 | Ga0207639_100070636 | 279 |
| 194 | 3300026089 | Ga0207648_10001417 | Ga0207648_1000141720 | 279 |
| 195 | 3300026116 | Ga0207674_10084236 | Ga0207674_100842361 | 279 |
| 196 | 3300026121 | Ga0207683_10008658 | Ga0207683_100086586 | 279 |
| 197 | 3300026142 | Ga0207698_10012985 | Ga0207698_100129856 | 279 |
| 198 | 3300028794 | Ga0307515_10016181 | Ga0307515_100161817 | 279 |
| 199 | 3300030731 | Ga0316177_1127916 | Ga0316177_112791612 | 279 |
| 200 | 3300030742 | Ga0316183_1100732 | Ga0316183_110073217 | 279 |
| 201 | 3300030745 | Ga0316182_1306507 | Ga0316182_13065071 | 279 |
| 202 | 3300031731 | Ga0307405_10000017 | Ga0307405_1000001778 | 279 |
| 203 | 3300031903 | Ga0307407_10000002 | Ga0307407_1000000231 | 279 |
| 204 | 3300031911 | Ga0307412_10078796 | Ga0307412_100787963 | 279 |
| 205 | 3300031911 | Ga0307412_10095876 | Ga0307412_100958763 | 279 |
| 206 | 3300032002 | Ga0307416_100000005 | Ga0307416_10000000531 | 279 |
| 207 | 3300032004 | Ga0307414_10038285 | Ga0307414_100382853 | 279 |
| 208 | 3300032004 | Ga0307414_10269579 | Ga0307414_102695791 | 279 |
| 209 | 3300037418 | Ga0395900_0321112 | Ga0395900_0321112_222_1070 | 279 |
| 210 | 3300046512 | Ga0495610_0000292 | Ga0495610_0000292_19653_20501 | 279 |
| 211 | 3300047443 | Ga0495687_007696 | Ga0495687_007696_4276_5124 | 279 |
| 212 | 3300047472 | Ga0495686_0001597 | Ga0495686_0001597_13146_13994 | 279 |
| 213 | 3300048919 | Ga0496116_0001204 | Ga0496116_0001204_24519_25388 | 279 |
| 214 | 3300048920 | Ga0496117_0002757 | Ga0496117_0002757_13967_14857 | 279 |
| 215 | 3300048925 | Ga0496122_0000817 | Ga0496122_0000817_29112_29957 | 279 |
| 216 | 3300048926 | Ga0496123_0008229 | Ga0496123_0008229_4931_5776 | 279 |
| 217 | 3300048928 | Ga0496125_0029453 | Ga0496125_0029453_2595_3440 | 279 |
| 218 | 3300049679 | Ga0501249_002594 | Ga0501249_002594_1862_2710 | 279 |
| 219 | iso_pu_bacteria | 2721755487 | 2722725642 | 279 |
| 220 | 3300002737 | JGI25162J39368_1000747 | JGI25162J39368_10007472 | 280 |
| 221 | 3300005288 | Ga0065714_10006998 | Ga0065714_100069984 | 280 |
| 222 | 3300005616 | Ga0068852_100271379 | Ga0068852_1002713792 | 280 |
| 223 | 3300009093 | Ga0105240_10618990 | Ga0105240_106189902 | 280 |
| 224 | 3300009545 | Ga0105237_10018569 | Ga0105237_100185698 | 280 |
| 225 | 3300009545 | Ga0105237_10020764 | Ga0105237_100207648 | 280 |
| 226 | 3300010375 | Ga0105239_10002395 | Ga0105239_1000239511 | 280 |
| 227 | 3300010375 | Ga0105239_10014398 | Ga0105239_100143986 | 280 |
| 228 | 3300013100 | Ga0157373_10000546 | Ga0157373_1000054619 | 280 |
| 229 | 3300013306 | Ga0163162_10000012 | Ga0163162_10000012154 | 280 |
| 230 | 3300013306 | Ga0163162_10006625 | Ga0163162_100066252 | 280 |
| 231 | 3300013308 | Ga0157375_10061932 | Ga0157375_100619325 | 280 |
| 232 | 3300017792 | Ga0163161_10000330 | Ga0163161_1000033023 | 280 |
| 233 | 3300017792 | Ga0163161_10233620 | Ga0163161_102336201 | 280 |
| 234 | 3300017792 | Ga0163161_10319382 | Ga0163161_103193822 | 280 |
| 235 | 3300025233 | Ga0209437_100144 | Ga0209437_100144140 | 280 |
| 236 | 3300025258 | Ga0209129_1014702 | Ga0209129_10147021 | 280 |
| 237 | 3300025914 | Ga0207671_10010967 | Ga0207671_100109673 | 280 |
| 238 | 3300025914 | Ga0207671_10012803 | Ga0207671_100128032 | 280 |
| 239 | 3300025981 | Ga0207640_10035481 | Ga0207640_100354814 | 280 |
| 240 | 3300026142 | Ga0207698_10456319 | Ga0207698_104563192 | 280 |
| 241 | 3300031548 | Ga0307408_100000393 | Ga0307408_10000039336 | 280 |
| 242 | 3300031911 | Ga0307412_10000724 | Ga0307412_1000072412 | 280 |
| 243 | 3300032004 | Ga0307414_10012466 | Ga0307414_100124662 | 280 |
| 244 | 3300033179 | Ga0307507_10004342 | Ga0307507_100043429 | 280 |
| 245 | 3300046471 | Ga0495650_0056453 | Ga0495650_0056453_171_1043 | 280 |
| 246 | 3300046501 | Ga0495607_0190729 | Ga0495607_0190729_151_1002 | 280 |
| 247 | 3300046513 | Ga0495616_0000433 | Ga0495616_0000433_13087_13947 | 280 |
| 248 | 3300046518 | Ga0495631_0085723 | Ga0495631_0085723_469_1329 | 280 |
| 249 | 3300046524 | Ga0495648_0053592 | Ga0495648_0053592_359_1219 | 280 |
| 250 | 3300046692 | Ga0495671_0134556 | Ga0495671_0134556_132_992 | 280 |
| 251 | 3300047472 | Ga0495686_0046616 | Ga0495686_0046616_534_1406 | 280 |
| 252 | 3300049459 | Ga0495678_008245 | Ga0495678_008245_1007_1867 | 280 |
| 253 | 2162886007 | SwRhRL2b_contig_2961947 | SwRhRL2b_0276.00008640 | 281 |
| 254 | 3300005288 | Ga0065714_10003630 | Ga0065714_1000363014 | 281 |
| 255 | 3300005288 | Ga0065714_10066979 | Ga0065714_100669792 | 281 |
| 256 | 3300005289 | Ga0065704_10000206 | Ga0065704_1000020672 | 281 |
| 257 | 3300005289 | Ga0065704_10089388 | Ga0065704_100893883 | 281 |
| 258 | 3300005539 | Ga0068853_100021233 | Ga0068853_1000212334 | 281 |
| 259 | 3300005563 | Ga0068855_100000611 | Ga0068855_10000061123 | 281 |
| 260 | 3300005614 | Ga0068856_100000006 | Ga0068856_10000000641 | 281 |
| 261 | 3300013100 | Ga0157373_10000376 | Ga0157373_1000037623 | 281 |
| 262 | 3300013102 | Ga0157371_10000888 | Ga0157371_1000088822 | 281 |
| 263 | 3300013102 | Ga0157371_10001845 | Ga0157371_100018459 | 281 |
| 264 | 3300013104 | Ga0157370_10069775 | Ga0157370_100697752 | 281 |
| 265 | 3300014497 | Ga0182008_10000020 | Ga0182008_1000002042 | 281 |
| 266 | 3300017792 | Ga0163161_10146436 | Ga0163161_101464363 | 281 |
| 267 | 3300025949 | Ga0207667_10000477 | Ga0207667_1000047728 | 281 |
| 268 | 3300026041 | Ga0207639_10015609 | Ga0207639_100156093 | 281 |
| 269 | 3300026078 | Ga0207702_10000023 | Ga0207702_1000002325 | 281 |
| 270 | 3300030744 | Ga0316181_1267984 | Ga0316181_12679841 | 281 |
| 271 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001358 | 281 |
| 272 | 3300032004 | Ga0307414_10013334 | Ga0307414_100133346 | 281 |
| 273 | 3300032004 | Ga0307414_10195014 | Ga0307414_101950142 | 281 |
| 274 | 3300037312 | Ga0395899_0007040 | Ga0395899_0007040_6062_6922 | 281 |
| 275 | 3300037418 | Ga0395900_0001352 | Ga0395900_0001352_6139_6999 | 281 |
| 276 | 3300037471 | Ga0395905_0000246 | Ga0395905_0000246_74318_75178 | 281 |
| 277 | 3300038443 | Ga0395901_0000184 | Ga0395901_0000184_74259_75119 | 281 |
| 278 | 3300047472 | Ga0495686_0000306 | Ga0495686_0000306_67802_68692 | 281 |
| 279 | 3300053093 | Ga0500651_0001978 | Ga0500651_0001978_3161_4006 | 281 |
| 280 | 3300053156 | Ga0500622_0002663 | Ga0500622_0002663_181_1065 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zbm-assembly1.cif.gz_A | x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. | 0.96 | 2 | 270 |
| 2czl-assembly1.cif.gz_A | crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) | 0.9599 | 3 | 278 |
| 2czl-assembly1.cif.gz_A | crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) | 0.9495 | 3 | 278 |
| 1zbm-assembly1.cif.gz_A | x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. | 0.9424 | 2 | 270 |
| 3ix1-assembly1.cif.gz_A | periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans | 0.8082 | 2 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dbpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9343 | 3 | 278 | 3.40.190.10 |
| 2dbpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9189 | 3 | 278 | 3.40.190.10 |
| 1zbmA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9181 | 2 | 270 | 3.40.190.10 |
| 1zbmA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8915 | 2 | 270 | 3.40.190.10 |
| 1zbmA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8758 | 80 | 177 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519ZF11-F1-model_v4 | 1,4-dihydroxy-6-naphthoate synthase | 0.9917 | 59 | 278 |
GO:0009234
GO:0016829 |
| AF-A0A3M0YUJ9-F1-model_v4 | 1,4-dihydroxy-6-naphthoate synthase | 0.9908 | 1 | 258 |
GO:0009234
GO:0016829 |
| AF-A0A4Q3F9A6-F1-model_v4 | deleted | 0.9879 | 51 | 279 |
|
| AF-A0A7Y5R4Q2-F1-model_v4 | 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) | 0.9876 | 1 | 262 |
GO:0009234
GO:0016830 |
| AF-A0A7T9I7Z1-F1-model_v4 | deleted | 0.9872 | 2 | 275 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar