F383527

General Info

Members Datasets Scaffolds Average Seq Length
280 184 560 451

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100213742|Ga0070699_1002137421
Length 473
Sequence MTDSHGGGRVPRPGMLSLAQLEEAVGAGEIDTVTLAFTDMQGRLAGKRLSAEYFLDEVAEHYAEGCNYLLAVDVDMNTVGGYEMSSWERGYGDFVLKPDLTTLRRLPWLPATALVLADLTWLDGAPVVASPRQILQAQIARLAERGWVALAGTELEFIVYRDSYEQAADKGYANLTPANQYNVDYSILGTSRIDPLLRRITTGMAGAGMYVESAKGECNFGQHEIAFRYSDAVTTCDNHSIYKTGAKEISAQDGMSLTFMAKPNQREGNSCHIHLSLREQSTRGLDGKPGQGGAPVLAGNGPHGLSALGQHFLAGQLAAMRELTLLYAPNINSYKRYVPGSFAPTAVRWGVDNRTCALRLVGHGQSLRVENRTPGGDVNPYLAIAGMIAAGLHGIDHELSLEDAFGGNAYIDQGPKVPHTLRDALELWENSALAKQAFGAEVVSHYANYARVELAAFDAAVTDWELRRGFERL

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
174 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
175 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
177 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
178 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
179 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
180 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
181 2891562705 Microbispora tritici MT50 Isolate Unclassified
182 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
183 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
184 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 0
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.36
Nodule 0
Rhizoplane 6.43
Rhizosphere 83.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100213742 3300005518 Bacteria 1717
2 Ga0070676_10039799 3300005328 Bacteria 2720
3 Ga0070683_100019101 3300005329 Bacteria 6081
4 Ga0068869_100089773 3300005334 Bacteria 2309
5 Ga0070682_100147833 3300005337 Bacteria 1609
6 Ga0068868_100015525 3300005338 Bacteria 5635
7 Ga0070661_100075941 3300005344 Bacteria 2476
8 Ga0070667_100084249 3300005367 Bacteria 2725
9 Ga0070709_10000279 3300005434 Bacteria 32487
10 Ga0070709_10000394 3300005434 Bacteria 26708
11 Ga0070709_10048506 3300005434 Bacteria 2650
12 Ga0070714_100000492 3300005435 Bacteria 28626
13 Ga0070714_100001261 3300005435 Bacteria 18278
14 Ga0070714_100023510 3300005435 Bacteria 5065
15 Ga0070713_100000324 3300005436 Bacteria 31216
16 Ga0070713_100142045 3300005436 Bacteria 2128
17 Ga0070710_10000131 3300005437 Bacteria 34934
18 Ga0070711_100007353 3300005439 Bacteria 6701
19 Ga0070711_100053956 3300005439 Bacteria 2772
20 Ga0070711_100068559 3300005439 Bacteria 2492
21 Ga0070708_100013233 3300005445 Bacteria 6750
22 Ga0070708_100107887 3300005445 Bacteria 2557
23 Ga0070663_100029692 3300005455 Bacteria 3738
24 Ga0070706_100006121 3300005467 Bacteria 11382
25 Ga0070706_100046117 3300005467 Bacteria 4023
26 Ga0070707_100000904 3300005468 Bacteria 29403
27 Ga0070707_100001524 3300005468 Bacteria 22539
28 Ga0070707_100032574 3300005468 Bacteria 4967
29 Ga0070698_100002392 3300005471 Bacteria 20673
30 Ga0070698_100006621 3300005471 Bacteria 12563
31 Ga0070698_100011564 3300005471 Bacteria 9365
32 Ga0070698_100030064 3300005471 Bacteria 5636
33 Ga0070699_100160288 3300005518 Bacteria 1991
34 Ga0070679_100101408 3300005530 Bacteria 2865
35 Ga0070684_100043258 3300005535 Bacteria 3889
36 Ga0070695_100011337 3300005545 Bacteria 5333
37 Ga0068855_100146658 3300005563 Bacteria 2686
38 Ga0068857_100149880 3300005577 Bacteria 2112
39 Ga0068856_100048973 3300005614 Bacteria 4165
40 Ga0068864_100001969 3300005618 Bacteria 16894
41 Ga0068863_100018256 3300005841 Bacteria 6716
42 Ga0068858_100137082 3300005842 Bacteria 2297
43 Ga0068860_100013790 3300005843 Bacteria 7924
44 Ga0081455_10014325 3300005937 Bacteria 7780
45 Ga0081455_10037193 3300005937 Bacteria 4326
46 Ga0081540_1000622 3300005983 Bacteria 33708
47 Ga0070717_10000969 3300006028 Bacteria 19168
48 Ga0070717_10049444 3300006028 Bacteria 3452
49 Ga0070717_10092019 3300006028 Bacteria 2562
50 Ga0075365_10001285 3300006038 Bacteria 11170
51 Ga0075365_10010698 3300006038 Bacteria 5359
52 Ga0075368_10000942 3300006042 Bacteria 9046
53 Ga0075368_10005362 3300006042 Bacteria 4407
54 Ga0075363_100013941 3300006048 Bacteria 3913
55 Ga0070716_100000325 3300006173 Bacteria 19255
56 Ga0070716_100001902 3300006173 Bacteria 9473
57 Ga0070712_100011058 3300006175 Bacteria 5712
58 Ga0075362_10016163 3300006177 Bacteria 3051
59 Ga0075367_10008287 3300006178 Bacteria 5381
60 Ga0075370_10006258 3300006353 Bacteria 5976
61 Ga0068871_100034667 3300006358 Bacteria 4006
62 Ga0075428_100007673 3300006844 Bacteria 11961
63 Ga0075428_100008016 3300006844 Bacteria 11719
64 Ga0075430_100009474 3300006846 Bacteria 8230
65 Ga0075431_100012825 3300006847 Bacteria 8460
66 Ga0075431_100042324 3300006847 Bacteria 4697
67 Ga0075433_10013335 3300006852 Bacteria 6679
68 Ga0075429_100024876 3300006880 Bacteria 5196
69 Ga0075429_100107950 3300006880 Bacteria 2432
70 Ga0099795_10008974 3300007788 Bacteria 2882
71 Ga0111539_10059620 3300009094 Bacteria 4525
72 Ga0105245_10092639 3300009098 Bacteria 2783
73 Ga0114129_10000080 3300009147 Bacteria 88284
74 Ga0114129_10101626 3300009147 Bacteria 3978
75 Ga0105248_10023016 3300009177 Bacteria 6919
76 Ga0105238_10209788 3300009551 Bacteria 1924
77 Ga0157374_10014375 3300013296 Bacteria 6927
78 Ga0163162_10094289 3300013306 Bacteria 3079
79 Ga0157375_10289694 3300013308 Bacteria 1800
80 Ga0163163_10066294 3300014325 Bacteria 3585
81 Ga0157379_10005765 3300014968 Bacteria 10659
82 Ga0157376_10084077 3300014969 Bacteria 2739
83 Ga0213875_10066456 3300021388 Bacteria 1685
84 Ga0207692_10001389 3300025898 Bacteria 9057
85 Ga0207692_10010354 3300025898 Bacteria 3927
86 Ga0207685_10001035 3300025905 Bacteria 5440
87 Ga0207699_10000210 3300025906 Bacteria 34935
88 Ga0207699_10003739 3300025906 Bacteria 7267
89 Ga0207699_10006739 3300025906 Bacteria 5577
90 Ga0207684_10007318 3300025910 Bacteria 9959
91 Ga0207684_10007918 3300025910 Bacteria 9497
92 Ga0207693_10009266 3300025915 Bacteria 8036
93 Ga0207693_10011327 3300025915 Bacteria 7221
94 Ga0207693_10039908 3300025915 Bacteria 3697
95 Ga0207663_10070354 3300025916 Bacteria 2254
96 Ga0207646_10000592 3300025922 Bacteria 47161
97 Ga0207646_10001418 3300025922 Bacteria 29768
98 Ga0207646_10006072 3300025922 Bacteria 12582
99 Ga0207646_10202883 3300025922 Bacteria 1791
100 Ga0207687_10024307 3300025927 Bacteria 4047
101 Ga0207700_10000054 3300025928 Bacteria 72974
102 Ga0207700_10004308 3300025928 Bacteria 8364
103 Ga0207700_10010803 3300025928 Bacteria 5789
104 Ga0207700_10011231 3300025928 Bacteria 5701
105 Ga0207700_10039384 3300025928 Bacteria 3440
106 Ga0207700_10147013 3300025928 Bacteria 1944
107 Ga0207664_10000441 3300025929 Bacteria 29614
108 Ga0207664_10000448 3300025929 Bacteria 29275
109 Ga0207664_10003505 3300025929 Bacteria 10477
110 Ga0207664_10005169 3300025929 Bacteria 8893
111 Ga0207664_10071395 3300025929 Bacteria 2797
112 Ga0207664_10105908 3300025929 Bacteria 2331
113 Ga0207706_10057913 3300025933 Bacteria 3413
114 Ga0207665_10000434 3300025939 Bacteria 28821
115 Ga0207665_10000798 3300025939 Bacteria 21297
116 Ga0207665_10002494 3300025939 Bacteria 12393
117 Ga0207665_10004961 3300025939 Bacteria 8879
118 Ga0207711_10028143 3300025941 Bacteria 4727
119 Ga0207689_10005116 3300025942 Bacteria 11790
120 Ga0207677_10016418 3300026023 Bacteria 4385
121 Ga0207678_10012278 3300026067 Bacteria 7521
122 Ga0207702_10053558 3300026078 Bacteria 3416
123 Ga0207648_10223997 3300026089 Bacteria 1672
124 Ga0207676_10022370 3300026095 Bacteria 4649
125 Ga0207674_10049540 3300026116 Bacteria 4295
126 Ga0207683_10001364 3300026121 Bacteria 22091
127 Ga0209813_10002225 3300027866 Bacteria 4429
128 Ga0207428_10029684 3300027907 Bacteria 4528
129 Ga0268264_10001927 3300028381 Bacteria 18714
130 Ga0265319_1000283 3300028563 Bacteria 37874
131 Ga0307405_10005461 3300031731 Bacteria 6132
132 Ga0307410_10070090 3300031852 Bacteria 2427
133 Ga0307406_10006374 3300031901 Bacteria 6510
134 Ga0307407_10004512 3300031903 Bacteria 5923
135 Ga0307409_100007531 3300031995 Bacteria 6522
136 Ga0307416_100002021 3300032002 Bacteria 11402
137 Ga0307415_100024769 3300032126 Bacteria 3754
138 Ga0373926_0003525 3300035083 Bacteria 5064
139 Ga0373934_0000576 3300035086 Bacteria 12911
140 Ga0373936_0001061 3300035113 Bacteria 9843
141 Ga0373953_0002077 3300035117 Bacteria 5972
142 Ga0373956_0035996 3300035119 Bacteria 2184
143 Ga0373957_0012277 3300035120 Bacteria 2880
144 Ga0373955_0022434 3300035172 Bacteria 3202
145 Ga0373955_0032073 3300035172 Bacteria 2755
146 Ga0373955_0069214 3300035172 Bacteria 1968
147 Ga0373924_0001391 3300035410 Bacteria 7826
148 Ga0373935_0008947 3300035692 Bacteria 5994
149 Ga0373935_0029282 3300035692 Bacteria 3407
150 Ga0373927_0058851 3300035695 Bacteria 2485
151 Ga0373933_0007177 3300035724 Bacteria 6072
152 Ga0373947_0000001 3300035725 Bacteria 510932
153 Ga0373947_0029304 3300035725 Bacteria 3229
154 Ga0373937_0024700 3300036401 Bacteria 5423
155 Ga0373937_0026522 3300036401 Bacteria 5235
156 Ga0373937_0244084 3300036401 Bacteria 1692
157 Ga0373925_0001965 3300037068 Bacteria 17016
158 Ga0373925_0041650 3300037068 Bacteria 3405
159 Ga0373925_0069707 3300037068 Bacteria 2656
160 Ga0436364_0215728 3300037853 Bacteria 3416
161 Ga0436364_0485333 3300037853 Bacteria 18545
162 Ga0436365_0926417 3300039437 Bacteria 2084
163 Ga0466961_0052217 3300044693 Bacteria 2609
164 Ga0466961_0121146 3300044693 Bacteria 1642
165 Ga0466963_0063463 3300044694 Bacteria 2472
166 Ga0466964_0129511 3300044706 Bacteria 1147
167 Ga0466970_0003542 3300044765 Bacteria 7605
168 Ga0466957_0122927 3300044842 Bacteria 1656
169 Ga0466960_0115779 3300044901 Bacteria 1398
170 Ga0466959_0009004 3300045049 Bacteria 7081
171 Ga0466967_0204231 3300045976 Bacteria 1872
172 Ga0466967_0243037 3300045976 Bacteria 1718
173 Ga0495592_0009622 3300046454 Bacteria 7274
174 Ga0495629_0004672 3300046459 Bacteria 10258
175 Ga0495641_0024498 3300046461 Bacteria 2978
176 Ga0495651_0001170 3300046462 Bacteria 20281
177 Ga0495651_0004215 3300046462 Bacteria 11018
178 Ga0495651_0009369 3300046462 Bacteria 7516
179 Ga0495653_0023776 3300046463 Bacteria 4946
180 Ga0495653_0117864 3300046463 Bacteria 1896
181 Ga0495582_0032249 3300046473 Bacteria 2882
182 Ga0495639_0011976 3300046475 Bacteria 3740
183 Ga0495662_0016636 3300046476 Bacteria 3563
184 Ga0495662_0020330 3300046476 Bacteria 3211
185 Ga0495664_0046551 3300046477 Bacteria 2573
186 Ga0495594_0047346 3300046499 Bacteria 2361
187 Ga0495618_0068088 3300046514 Bacteria 2264
188 Ga0495628_0006856 3300046516 Bacteria 9902
189 Ga0495628_0038930 3300046516 Bacteria 3804
190 Ga0495630_0071617 3300046517 Bacteria 2609
191 Ga0495652_0012701 3300046529 Bacteria 7588
192 Ga0495652_0037123 3300046529 Bacteria 4229
193 Ga0495652_0126430 3300046529 Bacteria 2030
194 Ga0495665_0002772 3300046531 Bacteria 9463
195 Ga0495640_0010911 3300046533 Bacteria 7003
196 Ga0495640_0042410 3300046533 Bacteria 3175
197 Ga0495640_0149206 3300046533 Bacteria 1503
198 Ga0495586_0028451 3300046535 Bacteria 2990
199 Ga0495587_0007923 3300046536 Bacteria 6862
200 Ga0495587_0015693 3300046536 Bacteria 4725
201 Ga0495587_0046785 3300046536 Bacteria 2566
202 Ga0495667_0000412 3300046559 Bacteria 27441
203 Ga0495667_0010290 3300046559 Bacteria 6328
204 Ga0495667_0022527 3300046559 Bacteria 4243
205 Ga0495634_0046580 3300046642 Bacteria 2925
206 Ga0495635_0023579 3300046663 Bacteria 4286
207 Ga0495635_0058310 3300046663 Bacteria 2656
208 Ga0495657_0058218 3300046675 Bacteria 2566
209 Ga0495599_0001174 3300046678 Bacteria 14843
210 Ga0495599_0004112 3300046678 Bacteria 8587
211 Ga0495599_0091981 3300046678 Bacteria 1893
212 Ga0495623_0011524 3300046679 Bacteria 5722
213 Ga0495623_0023895 3300046679 Bacteria 3943
214 Ga0495623_0025639 3300046679 Bacteria 3797
215 Ga0495623_0043352 3300046679 Bacteria 2863
216 Ga0495646_0017824 3300046680 Bacteria 4500
217 Ga0495646_0102684 3300046680 Bacteria 1637
218 Ga0495613_0043434 3300046689 Bacteria 3325
219 Ga0495613_0076406 3300046689 Bacteria 2437
220 Ga0495600_0005223 3300046809 Bacteria 7810
221 Ga0495600_0059691 3300046809 Bacteria 2491
222 Ga0495581_0001684 3300047315 Bacteria 12312
223 Ga0495604_0006097 3300047317 Bacteria 9565
224 Ga0495674_0002271 3300047319 Bacteria 18876
225 Ga0495674_0022647 3300047319 Bacteria 5792
226 Ga0495680_0002440 3300047322 Bacteria 19024
227 Ga0495680_0029688 3300047322 Bacteria 4475
228 Ga0495675_0037469 3300047444 Bacteria 3088
229 Ga0495675_0122183 3300047444 Bacteria 1621
230 Ga0495684_0001492 3300047471 Bacteria 18707
231 Ga0495684_0006681 3300047471 Bacteria 8949
232 Ga0495602_0032394 3300048088 Bacteria 4921
233 Ga0495602_0072299 3300048088 Bacteria 2941
234 Ga0495614_0047958 3300048089 Bacteria 1832
235 Ga0496104_0011940 3300048907 Bacteria 7791
236 Ga0496104_0013229 3300048907 Bacteria 7437
237 Ga0496104_0016545 3300048907 Bacteria 6702
238 Ga0496105_0000634 3300048908 Bacteria 23551
239 Ga0496105_0033677 3300048908 Bacteria 4209
240 Ga0496105_0037917 3300048908 Bacteria 3970
241 Ga0496108_0009007 3300048911 Bacteria 8086
242 Ga0496108_0009236 3300048911 Bacteria 7979
243 Ga0496109_0025458 3300048912 Bacteria 5274
244 Ga0496109_0032276 3300048912 Bacteria 4707
245 Ga0496110_0008190 3300048913 Bacteria 8401
246 Ga0496110_0059753 3300048913 Bacteria 3361
247 Ga0496110_0129923 3300048913 Bacteria 2274
248 Ga0496111_0002172 3300048914 Bacteria 11749
249 Ga0496112_0040127 3300048915 Bacteria 4576
250 Ga0496113_0087376 3300048916 Bacteria 2397
251 Ga0496114_0122773 3300048917 Bacteria 2235
252 Ga0496115_0036955 3300048918 Bacteria 3868
253 Ga0496119_0002007 3300048922 Bacteria 23030
254 Ga0496120_0000296 3300048923 Bacteria 83628
255 Ga0496126_0011755 3300048929 Bacteria 9015
256 nmdc:mga03683_25463_c1 3300050489 Bacteria 2325
257 nmdc:mga00v17_41372_c1 3300050491 Bacteria 2767
258 nmdc:mga0yw44_683_c1 3300050492 Bacteria 12392
259 nmdc:mga05p37_10117_c1 3300050507 Bacteria 11197
260 nmdc:mga05p37_182600_c1 3300050507 Bacteria 2552
261 nmdc:mga05p37_70191_c1 3300050507 Bacteria 4309
262 nmdc:mga09592_3283_c1 3300050508 Bacteria 13095
263 nmdc:mga0qj67_29831_c1 3300050509 Bacteria 4239
264 nmdc:mga06r32_2637_c1 3300050510 Bacteria 16018
265 nmdc:mga08y16_33617_c1 3300050511 Bacteria 5385
266 Ga0495619_0036846 3300053085 Bacteria 3187
267 Ga0495619_0122875 3300053085 Bacteria 1780
268 Ga0500644_0000047 3300053088 Bacteria 73844
269 Ga0500646_0003830 3300053090 Bacteria 3842
270 Ga0500583_0117860 3300053092 Bacteria 1312
271 Ga0590075_005825 3300059424 Bacteria 2913
272 2819744107 2818991472 Bacteria 10089953
273 2856746789 2856741275 Bacteria 8096094
274 2873321580 2873314349 Bacteria 8512634
275 2891404600 2891395885 Bacteria 9251614
276 2891561731 2891554331 Bacteria 8812224
277 2891569096 2891562705 Bacteria 8039471
278 8055071136 8055066027 Bacteria 9479577
279 8055173634 8055172936 Bacteria 9305943
280 8057569687 8057568493 Bacteria 7221719
281 Ga0070699_100213742
282 Ga0070676_10039799
283 Ga0070683_100019101
284 Ga0068869_100089773
285 Ga0070682_100147833
286 Ga0068868_100015525
287 Ga0070661_100075941
288 Ga0070667_100084249
289 Ga0070709_10000279
290 Ga0070709_10000394
291 Ga0070709_10048506
292 Ga0070714_100000492
293 Ga0070714_100001261
294 Ga0070714_100023510
295 Ga0070713_100000324
296 Ga0070713_100142045
297 Ga0070710_10000131
298 Ga0070711_100007353
299 Ga0070711_100053956
300 Ga0070711_100068559
301 Ga0070708_100013233
302 Ga0070708_100107887
303 Ga0070663_100029692
304 Ga0070706_100006121
305 Ga0070706_100046117
306 Ga0070707_100000904
307 Ga0070707_100001524
308 Ga0070707_100032574
309 Ga0070698_100002392
310 Ga0070698_100006621
311 Ga0070698_100011564
312 Ga0070698_100030064
313 Ga0070699_100160288
314 Ga0070679_100101408
315 Ga0070684_100043258
316 Ga0070695_100011337
317 Ga0068855_100146658
318 Ga0068857_100149880
319 Ga0068856_100048973
320 Ga0068864_100001969
321 Ga0068863_100018256
322 Ga0068858_100137082
323 Ga0068860_100013790
324 Ga0081455_10014325
325 Ga0081455_10037193
326 Ga0081540_1000622
327 Ga0070717_10000969
328 Ga0070717_10049444
329 Ga0070717_10092019
330 Ga0075365_10001285
331 Ga0075365_10010698
332 Ga0075368_10000942
333 Ga0075368_10005362
334 Ga0075363_100013941
335 Ga0070716_100000325
336 Ga0070716_100001902
337 Ga0070712_100011058
338 Ga0075362_10016163
339 Ga0075367_10008287
340 Ga0075370_10006258
341 Ga0068871_100034667
342 Ga0075428_100007673
343 Ga0075428_100008016
344 Ga0075430_100009474
345 Ga0075431_100012825
346 Ga0075431_100042324
347 Ga0075433_10013335
348 Ga0075429_100024876
349 Ga0075429_100107950
350 Ga0099795_10008974
351 Ga0111539_10059620
352 Ga0105245_10092639
353 Ga0114129_10000080
354 Ga0114129_10101626
355 Ga0105248_10023016
356 Ga0105238_10209788
357 Ga0157374_10014375
358 Ga0163162_10094289
359 Ga0157375_10289694
360 Ga0163163_10066294
361 Ga0157379_10005765
362 Ga0157376_10084077
363 Ga0213875_10066456
364 Ga0207692_10001389
365 Ga0207692_10010354
366 Ga0207685_10001035
367 Ga0207699_10000210
368 Ga0207699_10003739
369 Ga0207699_10006739
370 Ga0207684_10007318
371 Ga0207684_10007918
372 Ga0207693_10009266
373 Ga0207693_10011327
374 Ga0207693_10039908
375 Ga0207663_10070354
376 Ga0207646_10000592
377 Ga0207646_10001418
378 Ga0207646_10006072
379 Ga0207646_10202883
380 Ga0207687_10024307
381 Ga0207700_10000054
382 Ga0207700_10004308
383 Ga0207700_10010803
384 Ga0207700_10011231
385 Ga0207700_10039384
386 Ga0207700_10147013
387 Ga0207664_10000441
388 Ga0207664_10000448
389 Ga0207664_10003505
390 Ga0207664_10005169
391 Ga0207664_10071395
392 Ga0207664_10105908
393 Ga0207706_10057913
394 Ga0207665_10000434
395 Ga0207665_10000798
396 Ga0207665_10002494
397 Ga0207665_10004961
398 Ga0207711_10028143
399 Ga0207689_10005116
400 Ga0207677_10016418
401 Ga0207678_10012278
402 Ga0207702_10053558
403 Ga0207648_10223997
404 Ga0207676_10022370
405 Ga0207674_10049540
406 Ga0207683_10001364
407 Ga0209813_10002225
408 Ga0207428_10029684
409 Ga0268264_10001927
410 Ga0265319_1000283
411 Ga0307405_10005461
412 Ga0307410_10070090
413 Ga0307406_10006374
414 Ga0307407_10004512
415 Ga0307409_100007531
416 Ga0307416_100002021
417 Ga0307415_100024769
418 Ga0373926_0003525
419 Ga0373934_0000576
420 Ga0373936_0001061
421 Ga0373953_0002077
422 Ga0373956_0035996
423 Ga0373957_0012277
424 Ga0373955_0022434
425 Ga0373955_0032073
426 Ga0373955_0069214
427 Ga0373924_0001391
428 Ga0373935_0008947
429 Ga0373935_0029282
430 Ga0373927_0058851
431 Ga0373933_0007177
432 Ga0373947_0000001
433 Ga0373947_0029304
434 Ga0373937_0024700
435 Ga0373937_0026522
436 Ga0373937_0244084
437 Ga0373925_0001965
438 Ga0373925_0041650
439 Ga0373925_0069707
440 Ga0436364_0215728
441 Ga0436364_0485333
442 Ga0436365_0926417
443 Ga0466961_0052217
444 Ga0466961_0121146
445 Ga0466963_0063463
446 Ga0466964_0129511
447 Ga0466970_0003542
448 Ga0466957_0122927
449 Ga0466960_0115779
450 Ga0466959_0009004
451 Ga0466967_0204231
452 Ga0466967_0243037
453 Ga0495592_0009622
454 Ga0495629_0004672
455 Ga0495641_0024498
456 Ga0495651_0001170
457 Ga0495651_0004215
458 Ga0495651_0009369
459 Ga0495653_0023776
460 Ga0495653_0117864
461 Ga0495582_0032249
462 Ga0495639_0011976
463 Ga0495662_0016636
464 Ga0495662_0020330
465 Ga0495664_0046551
466 Ga0495594_0047346
467 Ga0495618_0068088
468 Ga0495628_0006856
469 Ga0495628_0038930
470 Ga0495630_0071617
471 Ga0495652_0012701
472 Ga0495652_0037123
473 Ga0495652_0126430
474 Ga0495665_0002772
475 Ga0495640_0010911
476 Ga0495640_0042410
477 Ga0495640_0149206
478 Ga0495586_0028451
479 Ga0495587_0007923
480 Ga0495587_0015693
481 Ga0495587_0046785
482 Ga0495667_0000412
483 Ga0495667_0010290
484 Ga0495667_0022527
485 Ga0495634_0046580
486 Ga0495635_0023579
487 Ga0495635_0058310
488 Ga0495657_0058218
489 Ga0495599_0001174
490 Ga0495599_0004112
491 Ga0495599_0091981
492 Ga0495623_0011524
493 Ga0495623_0023895
494 Ga0495623_0025639
495 Ga0495623_0043352
496 Ga0495646_0017824
497 Ga0495646_0102684
498 Ga0495613_0043434
499 Ga0495613_0076406
500 Ga0495600_0005223
501 Ga0495600_0059691
502 Ga0495581_0001684
503 Ga0495604_0006097
504 Ga0495674_0002271
505 Ga0495674_0022647
506 Ga0495680_0002440
507 Ga0495680_0029688
508 Ga0495675_0037469
509 Ga0495675_0122183
510 Ga0495684_0001492
511 Ga0495684_0006681
512 Ga0495602_0032394
513 Ga0495602_0072299
514 Ga0495614_0047958
515 Ga0496104_0011940
516 Ga0496104_0013229
517 Ga0496104_0016545
518 Ga0496105_0000634
519 Ga0496105_0033677
520 Ga0496105_0037917
521 Ga0496108_0009007
522 Ga0496108_0009236
523 Ga0496109_0025458
524 Ga0496109_0032276
525 Ga0496110_0008190
526 Ga0496110_0059753
527 Ga0496110_0129923
528 Ga0496111_0002172
529 Ga0496112_0040127
530 Ga0496113_0087376
531 Ga0496114_0122773
532 Ga0496115_0036955
533 Ga0496119_0002007
534 Ga0496120_0000296
535 Ga0496126_0011755
536 nmdc:mga03683_25463_c1
537 nmdc:mga00v17_41372_c1
538 nmdc:mga0yw44_683_c1
539 nmdc:mga05p37_10117_c1
540 nmdc:mga05p37_182600_c1
541 nmdc:mga05p37_70191_c1
542 nmdc:mga09592_3283_c1
543 nmdc:mga0qj67_29831_c1
544 nmdc:mga06r32_2637_c1
545 nmdc:mga08y16_33617_c1
546 Ga0495619_0036846
547 Ga0495619_0122875
548 Ga0500644_0000047
549 Ga0500646_0003830
550 Ga0500583_0117860
551 Ga0590075_005825
552 2819744107
553 2856746789
554 2873321580
555 2891404600
556 2891561731
557 2891569096
558 8055071136
559 8055173634
560 8057569687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00120

Gln-synt_C

Glutamine synthetase, catalytic domain

128

469

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dm3-assembly10.cif.gz_F-2 crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9333 12 459
5dm3-assembly10.cif.gz_F-2 crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9309 12 459
5dm3-assembly5.cif.gz_E crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9244 12 460
5dm3-assembly11.cif.gz_D crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9237 12 460
5dm3-assembly10.cif.gz_C crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9233 13 460
ID Description Score Start End Superfamily
af_I6X5K1_121_455_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9271 125 460 3.30.590.10
af_I6X5K1_11_120_3.10.20.70 Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain 0.9233 15 123 3.10.20.70
af_I6X5K1_121_455_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9217 125 460 3.30.590.10
af_P0C7B6_183_520_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.9164 127 455 3.30.590.10
af_I6X5K1_11_120_3.10.20.70 Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain 0.9075 15 123 3.10.20.70
ID Description Score Start End GO Terms
AF-A0A2S8MBC7-F1-model_v4 deleted 0.9599 8 248
AF-A0A7W9L0F9-F1-model_v4 deleted 0.9508 5 421
AF-A0A1B9S9C3-F1-model_v4 Glutamine synthetase 0.9501 9 454 GO:0004356
GO:0006542
AF-A0A535JZL7-F1-model_v4 Glutamine synthetase 0.9501 11 410 GO:0004356
GO:0006542
AF-A0A382D7V9-F1-model_v4 GS catalytic domain-containing protein 0.9493 9 230 GO:0004356
GO:0006542

Map