F383524

General Info

Members Datasets Scaffolds Average Seq Length
280 166 560 176

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100900150|Ga0070707_1009001502
Length 198
Sequence MGLLERFAAGDLEAFETLFRQRQNEVFAWIVRIVHDPGIAEDLTVETFWRIYRSRARFNPQGNFQGWARRIATNAALDYLRSARRETQLPEDLAGPAQPDPAVRGQTREQIKQAFHQLPTKYRLVATLALIEEEPYNTIAEAVGISAVLVKVRVFRAVRMLRKKLNSLGVEVGANEQRRKQQRDERAPQASDRSGEGH

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
110 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 6.07
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100900150 3300005468 Unclassified 849
2 Ga0065707_10107928 3300005295 Unclassified 2532
3 Ga0070683_100008923 3300005329 Bacteria 8543
4 Ga0070680_100348868 3300005336 Unclassified 1258
5 Ga0070680_100488039 3300005336 Bacteria 1053
6 Ga0068868_100023602 3300005338 Bacteria 4656
7 Ga0068868_100185235 3300005338 Bacteria 1729
8 Ga0070673_100199773 3300005364 Unclassified 1722
9 Ga0070659_100275802 3300005366 Unclassified 1398
10 Ga0070703_10003403 3300005406 Bacteria 4540
11 Ga0070709_10082853 3300005434 Bacteria 2097
12 Ga0070709_10173689 3300005434 Bacteria 1508
13 Ga0070709_10294809 3300005434 Unclassified 1183
14 Ga0070709_10324249 3300005434 Bacteria 1131
15 Ga0070714_100245734 3300005435 Bacteria 1653
16 Ga0070713_100224358 3300005436 Bacteria 1706
17 Ga0070713_100501613 3300005436 Unclassified 1145
18 Ga0070713_101063109 3300005436 Unclassified 782
19 Ga0070713_101137631 3300005436 Unclassified 755
20 Ga0070710_10384147 3300005437 Bacteria 937
21 Ga0070711_100015588 3300005439 Bacteria 4811
22 Ga0070705_100001976 3300005440 Bacteria 10472
23 Ga0070705_100013554 3300005440 Unclassified 4173
24 Ga0070694_100468047 3300005444 Bacteria 998
25 Ga0070708_100000994 3300005445 Bacteria 21636
26 Ga0070708_100036950 3300005445 Bacteria 4259
27 Ga0070708_100102107 3300005445 Bacteria 2627
28 Ga0070708_100381270 3300005445 Unclassified 1329
29 Ga0070708_100595590 3300005445 Unclassified 1042
30 Ga0070662_100433754 3300005457 Unclassified 1088
31 Ga0070681_10000147 3300005458 Bacteria 53398
32 Ga0070681_10011626 3300005458 Bacteria 8716
33 Ga0070681_10848033 3300005458 Unclassified 831
34 Ga0068867_100301578 3300005459 Unclassified 1321
35 Ga0070706_100020807 3300005467 Bacteria 6041
36 Ga0070706_100225136 3300005467 Bacteria 1751
37 Ga0070706_100576213 3300005467 Unclassified 1046
38 Ga0070707_100001608 3300005468 Bacteria 21875
39 Ga0070707_100179349 3300005468 Bacteria 2065
40 Ga0070698_100001738 3300005471 Bacteria 24305
41 Ga0070698_100376881 3300005471 Unclassified 1351
42 Ga0070699_100002662 3300005518 Bacteria 15953
43 Ga0070699_100428769 3300005518 Bacteria 1197
44 Ga0070699_100452195 3300005518 Unclassified 1165
45 Ga0070679_100003143 3300005530 Bacteria 15095
46 Ga0070679_100006558 3300005530 Bacteria 10845
47 Ga0070679_100308108 3300005530 Unclassified 1534
48 Ga0070684_100159894 3300005535 Bacteria 2043
49 Ga0070684_100733968 3300005535 Unclassified 921
50 Ga0070697_100003577 3300005536 Bacteria 11939
51 Ga0070697_100834785 3300005536 Unclassified 816
52 Ga0068853_100085820 3300005539 Bacteria 2760
53 Ga0068853_100701483 3300005539 Unclassified 965
54 Ga0070695_100143428 3300005545 Unclassified 1659
55 Ga0070695_100387602 3300005545 Bacteria 1056
56 Ga0070695_100583406 3300005545 Unclassified 875
57 Ga0070696_100009569 3300005546 Bacteria 6483
58 Ga0070693_100000041 3300005547 Bacteria 49532
59 Ga0070693_100168319 3300005547 Bacteria 1401
60 Ga0070704_100003408 3300005549 Bacteria 9106
61 Ga0070704_100174927 3300005549 Bacteria 1711
62 Ga0068855_100001040 3300005563 Bacteria 34520
63 Ga0068855_100319135 3300005563 Unclassified 1717
64 Ga0070664_100035105 3300005564 Bacteria 4209
65 Ga0068857_100001274 3300005577 Bacteria 19766
66 Ga0068857_100251505 3300005577 Unclassified 1620
67 Ga0068854_100006373 3300005578 Bacteria 7505
68 Ga0068854_100270406 3300005578 Bacteria 1364
69 Ga0068856_100000609 3300005614 Bacteria 39156
70 Ga0068856_100062568 3300005614 Bacteria 3676
71 Ga0068852_100001161 3300005616 Bacteria 17422
72 Ga0068864_101718625 3300005618 Unclassified 632
73 Ga0068851_10114469 3300005834 Bacteria 1443
74 Ga0068863_100113829 3300005841 Unclassified 2577
75 Ga0068858_100023255 3300005842 Bacteria 5776
76 Ga0068858_100437053 3300005842 Bacteria 1260
77 Ga0068860_100040038 3300005843 Bacteria 4481
78 Ga0068860_100202214 3300005843 Bacteria 1925
79 Ga0070717_10246498 3300006028 Bacteria 1577
80 Ga0075364_10015434 3300006051 Bacteria 4737
81 Ga0070715_10644899 3300006163 Unclassified 626
82 Ga0070716_100002207 3300006173 Bacteria 8967
83 Ga0070716_100319775 3300006173 Bacteria 1087
84 Ga0075367_10001523 3300006178 Bacteria 10022
85 Ga0075366_10005948 3300006195 Bacteria 6638
86 Ga0097621_100001157 3300006237 Bacteria 18331
87 Ga0068871_100001635 3300006358 Bacteria 15094
88 Ga0068871_100413432 3300006358 Unclassified 1203
89 Ga0075434_100303464 3300006871 Unclassified 1617
90 Ga0075434_100594896 3300006871 Unclassified 1125
91 Ga0075436_100000487 3300006914 Bacteria 25638
92 Ga0075436_100022270 3300006914 Bacteria 4352
93 Ga0075436_100042262 3300006914 Bacteria 3144
94 Ga0075436_101026577 3300006914 Unclassified 619
95 Ga0099794_10071092 3300007265 Bacteria 1705
96 Ga0099794_10110712 3300007265 Bacteria 1376
97 Ga0105240_10002547 3300009093 Bacteria 29224
98 Ga0105245_10453783 3300009098 Bacteria 1291
99 Ga0105247_10018873 3300009101 Bacteria 4141
100 Ga0114129_10112062 3300009147 Bacteria 3763
101 Ga0114129_10139336 3300009147 Unclassified 3327
102 Ga0114129_11284660 3300009147 Unclassified 908
103 Ga0105243_10133687 3300009148 Bacteria 2108
104 Ga0105241_10006955 3300009174 Bacteria 8325
105 Ga0105241_10045300 3300009174 Bacteria 3337
106 Ga0105241_10312707 3300009174 Unclassified 1352
107 Ga0105242_10617925 3300009176 Unclassified 1049
108 Ga0105242_11013253 3300009176 Unclassified 839
109 Ga0105248_10066356 3300009177 Bacteria 4052
110 Ga0105248_10317261 3300009177 Bacteria 1755
111 Ga0105237_10058883 3300009545 Bacteria 3845
112 Ga0105237_10167242 3300009545 Unclassified 2198
113 Ga0105238_10003057 3300009551 Bacteria 16685
114 Ga0099796_10065724 3300010159 Unclassified 1297
115 Ga0105239_10053306 3300010375 Bacteria 4437
116 Ga0105239_10720649 3300010375 Unclassified 1141
117 Ga0157373_10155249 3300013100 Bacteria 1610
118 Ga0157371_10066237 3300013102 Bacteria 2557
119 Ga0157369_10003399 3300013105 Bacteria 18886
120 Ga0157369_10278090 3300013105 Unclassified 1743
121 Ga0157374_10000355 3300013296 Bacteria 42412
122 Ga0157374_10022104 3300013296 Bacteria 5671
123 Ga0157378_10000091 3300013297 Bacteria 86060
124 Ga0157378_10020955 3300013297 Bacteria 5751
125 Ga0157378_10029065 3300013297 Bacteria 4879
126 Ga0157378_10137263 3300013297 Bacteria 2268
127 Ga0163162_10111222 3300013306 Unclassified 2837
128 Ga0163162_10338787 3300013306 Bacteria 1636
129 Ga0157372_10000282 3300013307 Bacteria 56474
130 Ga0157372_10011516 3300013307 Bacteria 9408
131 Ga0157372_10013220 3300013307 Bacteria 8809
132 Ga0157379_10028027 3300014968 Bacteria 5014
133 Ga0157379_10110742 3300014968 Bacteria 2466
134 Ga0157376_10006031 3300014969 Bacteria 8521
135 Ga0224570_100317 3300022730 Bacteria 3717
136 Ga0224572_1000092 3300024225 Bacteria 6615
137 Ga0207656_10031772 3300025321 Bacteria 2189
138 Ga0207653_10003927 3300025885 Bacteria 4674
139 Ga0207692_10325467 3300025898 Bacteria 942
140 Ga0207642_10071604 3300025899 Unclassified 1652
141 Ga0207647_10107384 3300025904 Unclassified 1652
142 Ga0207699_10080079 3300025906 Unclassified 2023
143 Ga0207699_10094537 3300025906 Bacteria 1883
144 Ga0207699_10205308 3300025906 Bacteria 1337
145 Ga0207699_10421331 3300025906 Bacteria 954
146 Ga0207684_10116917 3300025910 Unclassified 2285
147 Ga0207684_10173240 3300025910 Bacteria 1860
148 Ga0207654_10161786 3300025911 Unclassified 1447
149 Ga0207654_10198777 3300025911 Bacteria 1319
150 Ga0207707_10001984 3300025912 Bacteria 18596
151 Ga0207707_10160253 3300025912 Unclassified 1967
152 Ga0207707_10692830 3300025912 Unclassified 856
153 Ga0207695_10077662 3300025913 Bacteria 3371
154 Ga0207671_10093063 3300025914 Bacteria 2273
155 Ga0207671_10251249 3300025914 Unclassified 1390
156 Ga0207663_10029546 3300025916 Bacteria 3221
157 Ga0207660_10298391 3300025917 Unclassified 1283
158 Ga0207660_10811030 3300025917 Bacteria 764
159 Ga0207652_10038354 3300025921 Bacteria 4061
160 Ga0207652_10581726 3300025921 Unclassified 1005
161 Ga0207646_10000080 3300025922 Bacteria 128981
162 Ga0207646_10370136 3300025922 Unclassified 1295
163 Ga0207646_10631143 3300025922 Unclassified 960
164 Ga0207646_10801639 3300025922 Unclassified 839
165 Ga0207694_10001976 3300025924 Bacteria 16968
166 Ga0207650_10309787 3300025925 Unclassified 1291
167 Ga0207700_10056302 3300025928 Bacteria 2959
168 Ga0207700_10435550 3300025928 Unclassified 1153
169 Ga0207700_10573089 3300025928 Bacteria 1003
170 Ga0207664_10315706 3300025929 Bacteria 1378
171 Ga0207690_10327110 3300025932 Unclassified 1206
172 Ga0207665_10001225 3300025939 Bacteria 17314
173 Ga0207665_10055671 3300025939 Bacteria 2669
174 Ga0207665_10111079 3300025939 Bacteria 1926
175 Ga0207665_10369879 3300025939 Bacteria 1086
176 Ga0207665_10665652 3300025939 Unclassified 817
177 Ga0207711_10663936 3300025941 Unclassified 972
178 Ga0207661_10012197 3300025944 Bacteria 6241
179 Ga0207667_10000377 3300025949 Bacteria 60367
180 Ga0207667_10902334 3300025949 Unclassified 875
181 Ga0207640_10008571 3300025981 Bacteria 5679
182 Ga0207640_10021523 3300025981 Bacteria 3845
183 Ga0207677_10005840 3300026023 Bacteria 6698
184 Ga0207677_10296361 3300026023 Unclassified 1334
185 Ga0207703_10023196 3300026035 Bacteria 4874
186 Ga0207703_10502036 3300026035 Bacteria 1139
187 Ga0207639_10069467 3300026041 Bacteria 2748
188 Ga0207639_10648171 3300026041 Unclassified 977
189 Ga0207702_10000561 3300026078 Bacteria 41319
190 Ga0207702_10060798 3300026078 Bacteria 3221
191 Ga0207641_10079245 3300026088 Unclassified 2847
192 Ga0207648_10350845 3300026089 Unclassified 1330
193 Ga0207674_10009405 3300026116 Bacteria 11172
194 Ga0207674_10262910 3300026116 Unclassified 1673
195 Ga0209588_1054586 3300027671 Bacteria 1292
196 Ga0265354_1000189 3300028016 Bacteria 11333
197 Ga0265356_1000081 3300028017 Bacteria 15966
198 Ga0268264_10011134 3300028381 Bacteria 7430
199 Ga0265336_10005001 3300028666 Bacteria 4937
200 Ga0265336_10132824 3300028666 Unclassified 741
201 Ga0265338_10015238 3300028800 Bacteria 8468
202 Ga0265338_10048630 3300028800 Bacteria 3856
203 Ga0265338_10342636 3300028800 Unclassified 1077
204 Ga0265338_10748646 3300028800 Unclassified 672
205 Ga0265762_1046190 3300030760 Unclassified 863
206 Ga0265760_10000107 3300031090 Bacteria 21014
207 Ga0265330_10001839 3300031235 Bacteria 11847
208 Ga0265330_10053234 3300031235 Bacteria 1772
209 Ga0265330_10074295 3300031235 Bacteria 1469
210 Ga0265340_10338202 3300031247 Bacteria 665
211 Ga0265339_10092796 3300031249 Unclassified 1580
212 Ga0265316_10008449 3300031344 Bacteria 9555
213 Ga0265316_10020355 3300031344 Bacteria 5649
214 Ga0265314_10012658 3300031711 Bacteria 6864
215 Ga0265314_10039287 3300031711 Bacteria 3411
216 Ga0265342_10031377 3300031712 Bacteria 3285
217 Ga0316212_1005660 3300033547 Unclassified 1815
218 Ga0373926_0001998 3300035083 Bacteria 6402
219 Ga0373945_0199471 3300035116 Unclassified 830
220 Ga0373954_0198579 3300035118 Unclassified 985
221 Ga0373943_0007766 3300035170 Bacteria 4817
222 Ga0373946_0003718 3300035171 Bacteria 5407
223 Ga0373927_0004183 3300035695 Bacteria 10138
224 Ga0373927_0105887 3300035695 Bacteria 1831
225 Ga0373947_0000501 3300035725 Bacteria 22707
226 Ga0373937_0071565 3300036401 Bacteria 3198
227 Ga0373925_0000573 3300037068 Bacteria 35919
228 Ga0373925_0202685 3300037068 Bacteria 1578
229 Ga0373925_0266947 3300037068 Unclassified 1376
230 Ga0395898_0848044 3300037466 Unclassified 853
231 Ga0436365_1872717 3300039437 Bacteria 5992
232 Ga0451577_0058235 3300042876 Bacteria 3445
233 Ga0451577_0326204 3300042876 Bacteria 1392
234 Ga0451577_0965657 3300042876 Unclassified 766
235 Ga0453683_0061294 3300044673 Bacteria 2352
236 Ga0453683_0070407 3300044673 Bacteria 2187
237 Ga0453683_0206210 3300044673 Unclassified 1248
238 Ga0453684_0031871 3300044712 Bacteria 7392
239 Ga0453684_0424878 3300044712 Bacteria 1484
240 Ga0451576_0013364 3300045051 Bacteria 9187
241 Ga0495651_0069154 3300046462 Bacteria 2690
242 Ga0495580_0004040 3300046472 Bacteria 12383
243 Ga0495630_0005438 3300046517 Bacteria 8992
244 Ga0495642_0318660 3300046528 Unclassified 682
245 Ga0495587_0103227 3300046536 Unclassified 1641
246 Ga0495599_0473750 3300046678 Unclassified 739
247 Ga0495604_0185828 3300047317 Unclassified 1451
248 Ga0495636_0014896 3300047318 Unclassified 3096
249 Ga0495674_0050598 3300047319 Bacteria 3666
250 Ga0495676_0268716 3300047321 Unclassified 1158
251 Ga0495680_0308234 3300047322 Unclassified 1110
252 Ga0495602_0153573 3300048088 Unclassified 1806
253 Ga0496100_0143753 3300048903 Unclassified 1694
254 Ga0496101_0050092 3300048904 Bacteria 3005
255 Ga0496101_0156837 3300048904 Bacteria 1744
256 Ga0496101_1096114 3300048904 Unclassified 625
257 Ga0496102_0001997 3300048905 Bacteria 17620
258 Ga0496102_0006519 3300048905 Bacteria 9958
259 Ga0496102_0149206 3300048905 Bacteria 2196
260 Ga0496102_0982981 3300048905 Unclassified 765
261 Ga0496103_0001993 3300048906 Bacteria 13163
262 Ga0496103_0739176 3300048906 Unclassified 622
263 Ga0496104_0052115 3300048907 Unclassified 3864
264 Ga0496104_0526389 3300048907 Unclassified 1093
265 Ga0496104_0534237 3300048907 Bacteria 1084
266 Ga0496106_0297702 3300048909 Bacteria 1293
267 Ga0496107_0090296 3300048910 Unclassified 2238
268 Ga0496112_0002677 3300048915 Bacteria 14405
269 Ga0496112_0742266 3300048915 Unclassified 908
270 Ga0496126_0495706 3300048929 Unclassified 977
271 nmdc:mga00v17_22445_c1 3300050491 Bacteria 3641
272 nmdc:mga0k408_992_c1 3300050493 Bacteria 15617
273 nmdc:mga06z11_46389_c1 3300050494 Unclassified 2202
274 nmdc:mga05p37_584292_c1 3300050507 Unclassified 1264
275 nmdc:mga0n895_227970_c1 3300050512 Bacteria 1891
276 nmdc:mga08x19_19273_c1 3300050514 Bacteria 4184
277 nmdc:mga08x19_24514_c1 3300050514 Bacteria 3751
278 nmdc:mga08x19_50995_c1 3300050514 Bacteria 2657
279 Ga0495601_0014870 3300053077 Bacteria 4698
280 Ga0500616_0001958 3300053153 Bacteria 18353
281 Ga0070707_100900150
282 Ga0065707_10107928
283 Ga0070683_100008923
284 Ga0070680_100348868
285 Ga0070680_100488039
286 Ga0068868_100023602
287 Ga0068868_100185235
288 Ga0070673_100199773
289 Ga0070659_100275802
290 Ga0070703_10003403
291 Ga0070709_10082853
292 Ga0070709_10173689
293 Ga0070709_10294809
294 Ga0070709_10324249
295 Ga0070714_100245734
296 Ga0070713_100224358
297 Ga0070713_100501613
298 Ga0070713_101063109
299 Ga0070713_101137631
300 Ga0070710_10384147
301 Ga0070711_100015588
302 Ga0070705_100001976
303 Ga0070705_100013554
304 Ga0070694_100468047
305 Ga0070708_100000994
306 Ga0070708_100036950
307 Ga0070708_100102107
308 Ga0070708_100381270
309 Ga0070708_100595590
310 Ga0070662_100433754
311 Ga0070681_10000147
312 Ga0070681_10011626
313 Ga0070681_10848033
314 Ga0068867_100301578
315 Ga0070706_100020807
316 Ga0070706_100225136
317 Ga0070706_100576213
318 Ga0070707_100001608
319 Ga0070707_100179349
320 Ga0070698_100001738
321 Ga0070698_100376881
322 Ga0070699_100002662
323 Ga0070699_100428769
324 Ga0070699_100452195
325 Ga0070679_100003143
326 Ga0070679_100006558
327 Ga0070679_100308108
328 Ga0070684_100159894
329 Ga0070684_100733968
330 Ga0070697_100003577
331 Ga0070697_100834785
332 Ga0068853_100085820
333 Ga0068853_100701483
334 Ga0070695_100143428
335 Ga0070695_100387602
336 Ga0070695_100583406
337 Ga0070696_100009569
338 Ga0070693_100000041
339 Ga0070693_100168319
340 Ga0070704_100003408
341 Ga0070704_100174927
342 Ga0068855_100001040
343 Ga0068855_100319135
344 Ga0070664_100035105
345 Ga0068857_100001274
346 Ga0068857_100251505
347 Ga0068854_100006373
348 Ga0068854_100270406
349 Ga0068856_100000609
350 Ga0068856_100062568
351 Ga0068852_100001161
352 Ga0068864_101718625
353 Ga0068851_10114469
354 Ga0068863_100113829
355 Ga0068858_100023255
356 Ga0068858_100437053
357 Ga0068860_100040038
358 Ga0068860_100202214
359 Ga0070717_10246498
360 Ga0075364_10015434
361 Ga0070715_10644899
362 Ga0070716_100002207
363 Ga0070716_100319775
364 Ga0075367_10001523
365 Ga0075366_10005948
366 Ga0097621_100001157
367 Ga0068871_100001635
368 Ga0068871_100413432
369 Ga0075434_100303464
370 Ga0075434_100594896
371 Ga0075436_100000487
372 Ga0075436_100022270
373 Ga0075436_100042262
374 Ga0075436_101026577
375 Ga0099794_10071092
376 Ga0099794_10110712
377 Ga0105240_10002547
378 Ga0105245_10453783
379 Ga0105247_10018873
380 Ga0114129_10112062
381 Ga0114129_10139336
382 Ga0114129_11284660
383 Ga0105243_10133687
384 Ga0105241_10006955
385 Ga0105241_10045300
386 Ga0105241_10312707
387 Ga0105242_10617925
388 Ga0105242_11013253
389 Ga0105248_10066356
390 Ga0105248_10317261
391 Ga0105237_10058883
392 Ga0105237_10167242
393 Ga0105238_10003057
394 Ga0099796_10065724
395 Ga0105239_10053306
396 Ga0105239_10720649
397 Ga0157373_10155249
398 Ga0157371_10066237
399 Ga0157369_10003399
400 Ga0157369_10278090
401 Ga0157374_10000355
402 Ga0157374_10022104
403 Ga0157378_10000091
404 Ga0157378_10020955
405 Ga0157378_10029065
406 Ga0157378_10137263
407 Ga0163162_10111222
408 Ga0163162_10338787
409 Ga0157372_10000282
410 Ga0157372_10011516
411 Ga0157372_10013220
412 Ga0157379_10028027
413 Ga0157379_10110742
414 Ga0157376_10006031
415 Ga0224570_100317
416 Ga0224572_1000092
417 Ga0207656_10031772
418 Ga0207653_10003927
419 Ga0207692_10325467
420 Ga0207642_10071604
421 Ga0207647_10107384
422 Ga0207699_10080079
423 Ga0207699_10094537
424 Ga0207699_10205308
425 Ga0207699_10421331
426 Ga0207684_10116917
427 Ga0207684_10173240
428 Ga0207654_10161786
429 Ga0207654_10198777
430 Ga0207707_10001984
431 Ga0207707_10160253
432 Ga0207707_10692830
433 Ga0207695_10077662
434 Ga0207671_10093063
435 Ga0207671_10251249
436 Ga0207663_10029546
437 Ga0207660_10298391
438 Ga0207660_10811030
439 Ga0207652_10038354
440 Ga0207652_10581726
441 Ga0207646_10000080
442 Ga0207646_10370136
443 Ga0207646_10631143
444 Ga0207646_10801639
445 Ga0207694_10001976
446 Ga0207650_10309787
447 Ga0207700_10056302
448 Ga0207700_10435550
449 Ga0207700_10573089
450 Ga0207664_10315706
451 Ga0207690_10327110
452 Ga0207665_10001225
453 Ga0207665_10055671
454 Ga0207665_10111079
455 Ga0207665_10369879
456 Ga0207665_10665652
457 Ga0207711_10663936
458 Ga0207661_10012197
459 Ga0207667_10000377
460 Ga0207667_10902334
461 Ga0207640_10008571
462 Ga0207640_10021523
463 Ga0207677_10005840
464 Ga0207677_10296361
465 Ga0207703_10023196
466 Ga0207703_10502036
467 Ga0207639_10069467
468 Ga0207639_10648171
469 Ga0207702_10000561
470 Ga0207702_10060798
471 Ga0207641_10079245
472 Ga0207648_10350845
473 Ga0207674_10009405
474 Ga0207674_10262910
475 Ga0209588_1054586
476 Ga0265354_1000189
477 Ga0265356_1000081
478 Ga0268264_10011134
479 Ga0265336_10005001
480 Ga0265336_10132824
481 Ga0265338_10015238
482 Ga0265338_10048630
483 Ga0265338_10342636
484 Ga0265338_10748646
485 Ga0265762_1046190
486 Ga0265760_10000107
487 Ga0265330_10001839
488 Ga0265330_10053234
489 Ga0265330_10074295
490 Ga0265340_10338202
491 Ga0265339_10092796
492 Ga0265316_10008449
493 Ga0265316_10020355
494 Ga0265314_10012658
495 Ga0265314_10039287
496 Ga0265342_10031377
497 Ga0316212_1005660
498 Ga0373926_0001998
499 Ga0373945_0199471
500 Ga0373954_0198579
501 Ga0373943_0007766
502 Ga0373946_0003718
503 Ga0373927_0004183
504 Ga0373927_0105887
505 Ga0373947_0000501
506 Ga0373937_0071565
507 Ga0373925_0000573
508 Ga0373925_0202685
509 Ga0373925_0266947
510 Ga0395898_0848044
511 Ga0436365_1872717
512 Ga0451577_0058235
513 Ga0451577_0326204
514 Ga0451577_0965657
515 Ga0453683_0061294
516 Ga0453683_0070407
517 Ga0453683_0206210
518 Ga0453684_0031871
519 Ga0453684_0424878
520 Ga0451576_0013364
521 Ga0495651_0069154
522 Ga0495580_0004040
523 Ga0495630_0005438
524 Ga0495642_0318660
525 Ga0495587_0103227
526 Ga0495599_0473750
527 Ga0495604_0185828
528 Ga0495636_0014896
529 Ga0495674_0050598
530 Ga0495676_0268716
531 Ga0495680_0308234
532 Ga0495602_0153573
533 Ga0496100_0143753
534 Ga0496101_0050092
535 Ga0496101_0156837
536 Ga0496101_1096114
537 Ga0496102_0001997
538 Ga0496102_0006519
539 Ga0496102_0149206
540 Ga0496102_0982981
541 Ga0496103_0001993
542 Ga0496103_0739176
543 Ga0496104_0052115
544 Ga0496104_0526389
545 Ga0496104_0534237
546 Ga0496106_0297702
547 Ga0496107_0090296
548 Ga0496112_0002677
549 Ga0496112_0742266
550 Ga0496126_0495706
551 nmdc:mga00v17_22445_c1
552 nmdc:mga0k408_992_c1
553 nmdc:mga06z11_46389_c1
554 nmdc:mga05p37_584292_c1
555 nmdc:mga0n895_227970_c1
556 nmdc:mga08x19_19273_c1
557 nmdc:mga08x19_24514_c1
558 nmdc:mga08x19_50995_c1
559 Ga0495601_0014870
560 Ga0500616_0001958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

108

161

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

18

86

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9441 104 161
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9426 100 172
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9305 100 172
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9279 3 81
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9275 117 166
ID Description Score Start End Superfamily
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9441 104 161 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.943 104 161 1.10.10.10
af_P9WGH1_1_91_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9395 2 81 1.10.1740.10
3hugK00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.933 105 172 1.10.10.10
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.928 3 81 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A2V9XSR9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8908 1 172 GO:0003677
GO:0006352
GO:0016987
AF-A0A2V9XSR9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8857 1 172 GO:0003677
GO:0006352
GO:0016987
AF-A0A1I6S248-F1-model_v4 DNA-directed RNA polymerase specialized sigma subunit, sigma24 family 0.8055 2 161 GO:0000428
GO:0006352
GO:0016020
GO:0016987
AF-H6L4U9-F1-model_v4 ECF subfamily RNA polymerase sigma-24 factor 0.7878 3 165 GO:0003677
GO:0006352
GO:0016987
AF-A0A2V7W9E5-F1-model_v4 RNA polymerase sigma factor 0.7771 3 172 GO:0003677
GO:0006352
GO:0016987

Map