F383476

General Info

Members Datasets Scaffolds Average Seq Length
280 162 560 116

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100367330|Ga0068868_1003673302
Length 117
Sequence MKFISIFTHEPTNRPPTQAEMEAMGKLVEDAMKEGWLIATEGVSFGGLGLKIHKPAGGGDIRVIDGPFAEAKEVLGGYALMKAGSRAEVVELTKRFLKVAGQGTCEIHQLYEMPAAR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.14
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 29.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100367330 3300005338 Bacteria 1236
2 rootH1_10234624 3300003323 Bacteria 2210
3 rootH1_10249120 3300003323 Bacteria 1259
4 Ga0065714_10345182 3300005288 Unclassified 641
5 Ga0065712_10171566 3300005290 Unclassified 1241
6 Ga0065712_10211140 3300005290 Bacteria 1072
7 Ga0065715_10163753 3300005293 Bacteria 1605
8 Ga0065707_10656639 3300005295 Bacteria 660
9 Ga0070676_11359230 3300005328 Unclassified 544
10 Ga0070690_101047831 3300005330 Unclassified 645
11 Ga0070670_100027763 3300005331 Unclassified 4869
12 Ga0070670_100713648 3300005331 Bacteria 902
13 Ga0070677_10221101 3300005333 Bacteria 925
14 Ga0068869_100172327 3300005334 Bacteria 1691
15 Ga0068869_101955210 3300005334 Bacteria 526
16 Ga0070666_10078704 3300005335 Bacteria 2251
17 Ga0070680_100079861 3300005336 Bacteria 2697
18 Ga0070682_100808025 3300005337 Bacteria 762
19 Ga0068868_100661012 3300005338 Unclassified 931
20 Ga0070689_100040566 3300005340 Unclassified 3570
21 Ga0070691_10932877 3300005341 Bacteria 537
22 Ga0070661_100588936 3300005344 Bacteria 898
23 Ga0070669_100122908 3300005353 Bacteria 1983
24 Ga0070675_100006062 3300005354 Bacteria 9261
25 Ga0070675_100006724 3300005354 Bacteria 8842
26 Ga0070675_100112148 3300005354 Unclassified 2309
27 Ga0070675_100145494 3300005354 Bacteria 2029
28 Ga0070671_100358628 3300005355 Bacteria 1245
29 Ga0070671_100512811 3300005355 Bacteria 1032
30 Ga0070671_100707656 3300005355 Bacteria 874
31 Ga0070671_101296612 3300005355 Unclassified 642
32 Ga0070674_101070657 3300005356 Bacteria 711
33 Ga0070673_100053884 3300005364 Bacteria 3162
34 Ga0070673_100298923 3300005364 Bacteria 1417
35 Ga0070673_100594771 3300005364 Bacteria 1009
36 Ga0070688_100022701 3300005365 Bacteria 3681
37 Ga0070688_100027200 3300005365 Unclassified 3406
38 Ga0070688_100102153 3300005365 Unclassified 1892
39 Ga0070659_100151152 3300005366 Bacteria 1894
40 Ga0070667_100089634 3300005367 Bacteria 2642
41 Ga0070701_10257887 3300005438 Unclassified 1055
42 Ga0070705_100090272 3300005440 Unclassified 1907
43 Ga0070705_100615719 3300005440 Bacteria 842
44 Ga0070694_101618031 3300005444 Bacteria 550
45 Ga0070678_100302278 3300005456 Bacteria 1360
46 Ga0070678_102407696 3300005456 Bacteria 500
47 Ga0070681_10014005 3300005458 Bacteria 7982
48 Ga0068867_101731837 3300005459 Unclassified 586
49 Ga0070685_10254150 3300005466 Bacteria 1165
50 Ga0070685_10538857 3300005466 Unclassified 831
51 Ga0070685_10803921 3300005466 Bacteria 693
52 Ga0070707_101003330 3300005468 Bacteria 800
53 Ga0070698_102182456 3300005471 Unclassified 507
54 Ga0070679_100315754 3300005530 Bacteria 1512
55 Ga0070684_102208535 3300005535 Unclassified 519
56 Ga0068853_100000315 3300005539 Bacteria 33875
57 Ga0070686_100050213 3300005544 Bacteria 2650
58 Ga0070686_100257490 3300005544 Unclassified 1277
59 Ga0070695_100355316 3300005545 Unclassified 1099
60 Ga0070695_100991928 3300005545 Bacteria 683
61 Ga0070695_101415103 3300005545 Bacteria 577
62 Ga0070665_100152075 3300005548 Bacteria 2317
63 Ga0068855_100066926 3300005563 Bacteria 4187
64 Ga0068855_100076935 3300005563 Bacteria 3872
65 Ga0068855_100109906 3300005563 Bacteria 3165
66 Ga0070664_100076315 3300005564 Bacteria 2879
67 Ga0070664_100394345 3300005564 Bacteria 1265
68 Ga0070664_100440480 3300005564 Bacteria 1195
69 Ga0068857_101677001 3300005577 Unclassified 621
70 Ga0068856_100126141 3300005614 Bacteria 2563
71 Ga0070702_100305585 3300005615 Bacteria 1102
72 Ga0068852_100608814 3300005616 Bacteria 1097
73 Ga0068859_100006067 3300005617 Bacteria 12266
74 Ga0068859_100025292 3300005617 Bacteria 5955
75 Ga0068859_100062617 3300005617 Unclassified 3750
76 Ga0068859_100451788 3300005617 Bacteria 1381
77 Ga0068859_100891846 3300005617 Unclassified 974
78 Ga0068864_100402551 3300005618 Unclassified 1301
79 Ga0068861_100338362 3300005719 Unclassified 1316
80 Ga0068861_100977359 3300005719 Unclassified 807
81 Ga0068870_10405548 3300005840 Bacteria 888
82 Ga0068870_10742084 3300005840 Unclassified 681
83 Ga0068870_11105903 3300005840 Unclassified 570
84 Ga0068863_100011236 3300005841 Bacteria 8677
85 Ga0068863_100141088 3300005841 Bacteria 2303
86 Ga0068858_100109620 3300005842 Bacteria 2577
87 Ga0068858_100199051 3300005842 Bacteria 1894
88 Ga0068858_101042294 3300005842 Unclassified 802
89 Ga0068860_100020968 3300005843 Bacteria 6332
90 Ga0068860_100311025 3300005843 Unclassified 1545
91 Ga0068860_100709546 3300005843 Bacteria 1016
92 Ga0068860_102580411 3300005843 Unclassified 527
93 Ga0068862_100377104 3300005844 Bacteria 1322
94 Ga0068862_100809157 3300005844 Unclassified 916
95 Ga0081539_10235084 3300005985 Bacteria 824
96 Ga0075432_10559514 3300006058 Bacteria 518
97 Ga0097621_100015631 3300006237 Bacteria 5718
98 Ga0097621_100034690 3300006237 Bacteria 4026
99 Ga0068871_100032454 3300006358 Bacteria 4126
100 Ga0068871_100090854 3300006358 Bacteria 2544
101 Ga0068871_100562238 3300006358 Bacteria 1034
102 Ga0068871_101226646 3300006358 Unclassified 704
103 Ga0075428_100556113 3300006844 Bacteria 1226
104 Ga0075428_102675790 3300006844 Unclassified 509
105 Ga0075430_100272783 3300006846 Bacteria 1400
106 Ga0075430_101198067 3300006846 Unclassified 625
107 Ga0075431_100834463 3300006847 Bacteria 893
108 Ga0075431_101276356 3300006847 Unclassified 696
109 Ga0075433_10134208 3300006852 Bacteria 2200
110 Ga0075434_100133497 3300006871 Bacteria 2502
111 Ga0075434_102453029 3300006871 Unclassified 523
112 Ga0075429_100152468 3300006880 Bacteria 2023
113 Ga0075429_101758747 3300006880 Bacteria 538
114 Ga0068865_100175855 3300006881 Bacteria 1645
115 Ga0097620_100006069 3300006931 Bacteria 12266
116 Ga0097620_100025290 3300006931 Bacteria 5955
117 Ga0097620_100062618 3300006931 Unclassified 3750
118 Ga0097620_100451761 3300006931 Bacteria 1381
119 Ga0097620_100891692 3300006931 Unclassified 974
120 Ga0075435_101662373 3300007076 Bacteria 560
121 Ga0111539_10026352 3300009094 Bacteria 7108
122 Ga0111539_10026659 3300009094 Bacteria 7064
123 Ga0111539_10058298 3300009094 Unclassified 4582
124 Ga0111539_10128844 3300009094 Bacteria 2964
125 Ga0111539_10919169 3300009094 Bacteria 1018
126 Ga0111539_11127630 3300009094 Bacteria 911
127 Ga0111539_11745184 3300009094 Bacteria 722
128 Ga0111539_12379611 3300009094 Unclassified 614
129 Ga0105245_10170655 3300009098 Bacteria 2071
130 Ga0105247_10944574 3300009101 Unclassified 669
131 Ga0114129_10112888 3300009147 Bacteria 3748
132 Ga0105243_11030342 3300009148 Bacteria 827
133 Ga0105243_12064849 3300009148 Bacteria 605
134 Ga0105242_10759792 3300009176 Bacteria 955
135 Ga0105248_10007902 3300009177 Bacteria 11689
136 Ga0105248_10111258 3300009177 Bacteria 3089
137 Ga0105237_10826460 3300009545 Bacteria 933
138 Ga0105238_10133355 3300009551 Bacteria 2462
139 Ga0105249_10059556 3300009553 Unclassified 3502
140 Ga0105249_10835132 3300009553 Bacteria 986
141 Ga0105239_10016445 3300010375 Bacteria 8180
142 Ga0105239_12643659 3300010375 Bacteria 585
143 Ga0105246_11069611 3300011119 Unclassified 735
144 Ga0157370_10197800 3300013104 Bacteria 1865
145 Ga0157374_10839073 3300013296 Unclassified 935
146 Ga0157374_11183853 3300013296 Unclassified 785
147 Ga0157378_10043468 3300013297 Bacteria 3989
148 Ga0163162_10859522 3300013306 Unclassified 1022
149 Ga0157375_10008942 3300013308 Bacteria 8763
150 Ga0157375_11396444 3300013308 Unclassified 825
151 Ga0163163_10047292 3300014325 Bacteria 4229
152 Ga0163163_10080802 3300014325 Bacteria 3251
153 Ga0163163_10215971 3300014325 Bacteria 1966
154 Ga0163163_12682898 3300014325 Bacteria 555
155 Ga0157380_10001603 3300014326 Bacteria 14895
156 Ga0157380_10126590 3300014326 Bacteria 2172
157 Ga0157380_11014554 3300014326 Bacteria 864
158 Ga0157380_11745461 3300014326 Unclassified 681
159 Ga0157377_10261466 3300014745 Bacteria 1126
160 Ga0157377_11177393 3300014745 Unclassified 592
161 Ga0157377_11538493 3300014745 Unclassified 530
162 Ga0157379_10060436 3300014968 Bacteria 3388
163 Ga0157379_10718586 3300014968 Bacteria 939
164 Ga0157379_11482900 3300014968 Unclassified 659
165 Ga0157376_10282202 3300014969 Bacteria 1564
166 Ga0157376_10830213 3300014969 Bacteria 938
167 Ga0163161_10302127 3300017792 Bacteria 1261
168 Ga0163161_11015563 3300017792 Bacteria 709
169 Ga0163161_11084589 3300017792 Bacteria 688
170 Ga0207680_10025090 3300025903 Bacteria 3284
171 Ga0207645_10497895 3300025907 Bacteria 825
172 Ga0207645_10606752 3300025907 Unclassified 743
173 Ga0207643_10226698 3300025908 Bacteria 1145
174 Ga0207707_10005983 3300025912 Bacteria 10646
175 Ga0207671_10685464 3300025914 Bacteria 815
176 Ga0207660_10292958 3300025917 Bacteria 1294
177 Ga0207652_10269734 3300025921 Bacteria 1535
178 Ga0207681_10141050 3300025923 Unclassified 1795
179 Ga0207681_10460400 3300025923 Unclassified 1036
180 Ga0207694_10016987 3300025924 Bacteria 5496
181 Ga0207694_10225675 3300025924 Bacteria 1529
182 Ga0207650_10014715 3300025925 Bacteria 5437
183 Ga0207650_11839416 3300025925 Unclassified 512
184 Ga0207659_10007223 3300025926 Bacteria 6825
185 Ga0207659_10040543 3300025926 Unclassified 3256
186 Ga0207659_10274377 3300025926 Bacteria 1376
187 Ga0207687_11309307 3300025927 Unclassified 623
188 Ga0207644_10667067 3300025931 Unclassified 866
189 Ga0207644_11180811 3300025931 Unclassified 643
190 Ga0207690_10451457 3300025932 Bacteria 1033
191 Ga0207706_10615339 3300025933 Bacteria 932
192 Ga0207670_10900668 3300025936 Unclassified 741
193 Ga0207691_11274119 3300025940 Bacteria 608
194 Ga0207711_10011772 3300025941 Bacteria 7266
195 Ga0207711_11395614 3300025941 Unclassified 643
196 Ga0207689_10479220 3300025942 Bacteria 1042
197 Ga0207679_10139241 3300025945 Bacteria 1959
198 Ga0207679_10418421 3300025945 Bacteria 1182
199 Ga0207667_10408598 3300025949 Bacteria 1382
200 Ga0207667_11094104 3300025949 Bacteria 780
201 Ga0207651_10016085 3300025960 Bacteria 4369
202 Ga0207651_10768638 3300025960 Unclassified 852
203 Ga0207651_11170759 3300025960 Bacteria 690
204 Ga0207651_11765416 3300025960 Unclassified 557
205 Ga0207712_11027746 3300025961 Unclassified 732
206 Ga0207712_11223253 3300025961 Bacteria 670
207 Ga0207658_10141148 3300025986 Bacteria 1949
208 Ga0207677_10707739 3300026023 Bacteria 894
209 Ga0207703_10165820 3300026035 Bacteria 1938
210 Ga0207703_10382916 3300026035 Bacteria 1301
211 Ga0207703_10531855 3300026035 Unclassified 1107
212 Ga0207703_12386533 3300026035 Unclassified 504
213 Ga0207639_10006977 3300026041 Bacteria 7697
214 Ga0207641_10009597 3300026088 Bacteria 7974
215 Ga0207641_10627425 3300026088 Bacteria 1054
216 Ga0207648_11766036 3300026089 Unclassified 580
217 Ga0207676_10180486 3300026095 Unclassified 1848
218 Ga0207676_10366390 3300026095 Unclassified 1337
219 Ga0207675_100031098 3300026118 Bacteria 4971
220 Ga0207675_100751269 3300026118 Unclassified 987
221 Ga0207683_10305755 3300026121 Bacteria 1455
222 Ga0207683_11031272 3300026121 Bacteria 763
223 Ga0207698_10621582 3300026142 Bacteria 1067
224 Ga0210002_1019454 3300027617 Bacteria 1090
225 Ga0209974_10097705 3300027876 Bacteria 1024
226 Ga0209974_10134648 3300027876 Bacteria 883
227 Ga0207428_10098780 3300027907 Bacteria 2258
228 Ga0207428_10198992 3300027907 Bacteria 1508
229 Ga0207428_10415407 3300027907 Unclassified 984
230 Ga0268266_10155974 3300028379 Bacteria 2062
231 Ga0268265_10304725 3300028380 Bacteria 1436
232 Ga0268264_10031531 3300028381 Bacteria 4344
233 Ga0268264_10280908 3300028381 Unclassified 1559
234 Ga0268264_10797603 3300028381 Unclassified 943
235 Ga0307413_10157555 3300031824 Bacteria 1591
236 Ga0307407_11672008 3300031903 Bacteria 506
237 Ga0307416_101474592 3300032002 Bacteria 786
238 Ga0307411_10177751 3300032005 Bacteria 1612
239 Ga0307415_101337811 3300032126 Bacteria 680
240 Ga0373926_0167807 3300035083 Bacteria 839
241 Ga0373941_0412421 3300035115 Bacteria 561
242 Ga0373937_0574178 3300036401 Bacteria 1071
243 Ga0451807_1234161 3300041486 Bacteria 668
244 Ga0451576_0193456 3300045051 Bacteria 2124
245 Ga0495592_0674992 3300046454 Bacteria 624
246 Ga0495628_0465409 3300046516 Bacteria 917
247 Ga0495659_0262179 3300046664 Bacteria 722
248 Ga0495658_0430510 3300046683 Unclassified 842
249 Ga0495658_0483218 3300046683 Bacteria 792
250 Ga0495613_0988955 3300046689 Bacteria 541
251 Ga0496102_0866842 3300048905 Bacteria 825
252 Ga0496108_0993217 3300048911 Bacteria 717
253 Ga0496109_0644854 3300048912 Bacteria 996
254 Ga0496110_0877264 3300048913 Bacteria 803
255 Ga0496110_0992221 3300048913 Unclassified 747
256 Ga0501042_0791554 3300049578 Bacteria 690
257 Ga0501071_0495640 3300049587 Unclassified 937
258 Ga0501071_0596813 3300049587 Bacteria 849
259 Ga0501072_0989107 3300049588 Bacteria 656
260 Ga0501072_1408100 3300049588 Bacteria 539
261 Ga0501080_0536419 3300049742 Bacteria 1043
262 Ga0501080_1487474 3300049742 Unclassified 576
263 Ga0501081_1106161 3300049743 Bacteria 600
264 nmdc:mga05p37_213269_c1 3300050507 Bacteria 2333
265 nmdc:mga09592_115476_c1 3300050508 Bacteria 2304
266 nmdc:mga0qj67_656121_c1 3300050509 Bacteria 837
267 nmdc:mga08y16_1146728_c1 3300050511 Unclassified 750
268 nmdc:mga08y16_1491058_c1 3300050511 Unclassified 637
269 nmdc:mga08y16_182404_c1 3300050511 Bacteria 2179
270 nmdc:mga08y16_1882501_c1 3300050511 Unclassified 549
271 nmdc:mga08y16_20283_c1 3300050511 Bacteria 7016
272 nmdc:mga08y16_7879_c1 3300050511 Bacteria 11145
273 nmdc:mga08y16_94959_c1 3300050511 Unclassified 3106
274 nmdc:mga08y16_95257_c1 3300050511 Bacteria 3101
275 nmdc:mga0n895_760907_c1 3300050512 Unclassified 961
276 nmdc:mga0rr50_357015_c1 3300050513 Bacteria 1230
277 nmdc:mga0a205_1125064_c1 3300050515 Unclassified 633
278 nmdc:mga0a205_187815_c1 3300050515 Bacteria 1959
279 Ga0495595_0264758 3300053084 Bacteria 862
280 2687240502 2684623219 Bacteria 8442773
281 Ga0068868_100367330
282 rootH1_10234624
283 rootH1_10249120
284 Ga0065714_10345182
285 Ga0065712_10171566
286 Ga0065712_10211140
287 Ga0065715_10163753
288 Ga0065707_10656639
289 Ga0070676_11359230
290 Ga0070690_101047831
291 Ga0070670_100027763
292 Ga0070670_100713648
293 Ga0070677_10221101
294 Ga0068869_100172327
295 Ga0068869_101955210
296 Ga0070666_10078704
297 Ga0070680_100079861
298 Ga0070682_100808025
299 Ga0068868_100661012
300 Ga0070689_100040566
301 Ga0070691_10932877
302 Ga0070661_100588936
303 Ga0070669_100122908
304 Ga0070675_100006062
305 Ga0070675_100006724
306 Ga0070675_100112148
307 Ga0070675_100145494
308 Ga0070671_100358628
309 Ga0070671_100512811
310 Ga0070671_100707656
311 Ga0070671_101296612
312 Ga0070674_101070657
313 Ga0070673_100053884
314 Ga0070673_100298923
315 Ga0070673_100594771
316 Ga0070688_100022701
317 Ga0070688_100027200
318 Ga0070688_100102153
319 Ga0070659_100151152
320 Ga0070667_100089634
321 Ga0070701_10257887
322 Ga0070705_100090272
323 Ga0070705_100615719
324 Ga0070694_101618031
325 Ga0070678_100302278
326 Ga0070678_102407696
327 Ga0070681_10014005
328 Ga0068867_101731837
329 Ga0070685_10254150
330 Ga0070685_10538857
331 Ga0070685_10803921
332 Ga0070707_101003330
333 Ga0070698_102182456
334 Ga0070679_100315754
335 Ga0070684_102208535
336 Ga0068853_100000315
337 Ga0070686_100050213
338 Ga0070686_100257490
339 Ga0070695_100355316
340 Ga0070695_100991928
341 Ga0070695_101415103
342 Ga0070665_100152075
343 Ga0068855_100066926
344 Ga0068855_100076935
345 Ga0068855_100109906
346 Ga0070664_100076315
347 Ga0070664_100394345
348 Ga0070664_100440480
349 Ga0068857_101677001
350 Ga0068856_100126141
351 Ga0070702_100305585
352 Ga0068852_100608814
353 Ga0068859_100006067
354 Ga0068859_100025292
355 Ga0068859_100062617
356 Ga0068859_100451788
357 Ga0068859_100891846
358 Ga0068864_100402551
359 Ga0068861_100338362
360 Ga0068861_100977359
361 Ga0068870_10405548
362 Ga0068870_10742084
363 Ga0068870_11105903
364 Ga0068863_100011236
365 Ga0068863_100141088
366 Ga0068858_100109620
367 Ga0068858_100199051
368 Ga0068858_101042294
369 Ga0068860_100020968
370 Ga0068860_100311025
371 Ga0068860_100709546
372 Ga0068860_102580411
373 Ga0068862_100377104
374 Ga0068862_100809157
375 Ga0081539_10235084
376 Ga0075432_10559514
377 Ga0097621_100015631
378 Ga0097621_100034690
379 Ga0068871_100032454
380 Ga0068871_100090854
381 Ga0068871_100562238
382 Ga0068871_101226646
383 Ga0075428_100556113
384 Ga0075428_102675790
385 Ga0075430_100272783
386 Ga0075430_101198067
387 Ga0075431_100834463
388 Ga0075431_101276356
389 Ga0075433_10134208
390 Ga0075434_100133497
391 Ga0075434_102453029
392 Ga0075429_100152468
393 Ga0075429_101758747
394 Ga0068865_100175855
395 Ga0097620_100006069
396 Ga0097620_100025290
397 Ga0097620_100062618
398 Ga0097620_100451761
399 Ga0097620_100891692
400 Ga0075435_101662373
401 Ga0111539_10026352
402 Ga0111539_10026659
403 Ga0111539_10058298
404 Ga0111539_10128844
405 Ga0111539_10919169
406 Ga0111539_11127630
407 Ga0111539_11745184
408 Ga0111539_12379611
409 Ga0105245_10170655
410 Ga0105247_10944574
411 Ga0114129_10112888
412 Ga0105243_11030342
413 Ga0105243_12064849
414 Ga0105242_10759792
415 Ga0105248_10007902
416 Ga0105248_10111258
417 Ga0105237_10826460
418 Ga0105238_10133355
419 Ga0105249_10059556
420 Ga0105249_10835132
421 Ga0105239_10016445
422 Ga0105239_12643659
423 Ga0105246_11069611
424 Ga0157370_10197800
425 Ga0157374_10839073
426 Ga0157374_11183853
427 Ga0157378_10043468
428 Ga0163162_10859522
429 Ga0157375_10008942
430 Ga0157375_11396444
431 Ga0163163_10047292
432 Ga0163163_10080802
433 Ga0163163_10215971
434 Ga0163163_12682898
435 Ga0157380_10001603
436 Ga0157380_10126590
437 Ga0157380_11014554
438 Ga0157380_11745461
439 Ga0157377_10261466
440 Ga0157377_11177393
441 Ga0157377_11538493
442 Ga0157379_10060436
443 Ga0157379_10718586
444 Ga0157379_11482900
445 Ga0157376_10282202
446 Ga0157376_10830213
447 Ga0163161_10302127
448 Ga0163161_11015563
449 Ga0163161_11084589
450 Ga0207680_10025090
451 Ga0207645_10497895
452 Ga0207645_10606752
453 Ga0207643_10226698
454 Ga0207707_10005983
455 Ga0207671_10685464
456 Ga0207660_10292958
457 Ga0207652_10269734
458 Ga0207681_10141050
459 Ga0207681_10460400
460 Ga0207694_10016987
461 Ga0207694_10225675
462 Ga0207650_10014715
463 Ga0207650_11839416
464 Ga0207659_10007223
465 Ga0207659_10040543
466 Ga0207659_10274377
467 Ga0207687_11309307
468 Ga0207644_10667067
469 Ga0207644_11180811
470 Ga0207690_10451457
471 Ga0207706_10615339
472 Ga0207670_10900668
473 Ga0207691_11274119
474 Ga0207711_10011772
475 Ga0207711_11395614
476 Ga0207689_10479220
477 Ga0207679_10139241
478 Ga0207679_10418421
479 Ga0207667_10408598
480 Ga0207667_11094104
481 Ga0207651_10016085
482 Ga0207651_10768638
483 Ga0207651_11170759
484 Ga0207651_11765416
485 Ga0207712_11027746
486 Ga0207712_11223253
487 Ga0207658_10141148
488 Ga0207677_10707739
489 Ga0207703_10165820
490 Ga0207703_10382916
491 Ga0207703_10531855
492 Ga0207703_12386533
493 Ga0207639_10006977
494 Ga0207641_10009597
495 Ga0207641_10627425
496 Ga0207648_11766036
497 Ga0207676_10180486
498 Ga0207676_10366390
499 Ga0207675_100031098
500 Ga0207675_100751269
501 Ga0207683_10305755
502 Ga0207683_11031272
503 Ga0207698_10621582
504 Ga0210002_1019454
505 Ga0209974_10097705
506 Ga0209974_10134648
507 Ga0207428_10098780
508 Ga0207428_10198992
509 Ga0207428_10415407
510 Ga0268266_10155974
511 Ga0268265_10304725
512 Ga0268264_10031531
513 Ga0268264_10280908
514 Ga0268264_10797603
515 Ga0307413_10157555
516 Ga0307407_11672008
517 Ga0307416_101474592
518 Ga0307411_10177751
519 Ga0307415_101337811
520 Ga0373926_0167807
521 Ga0373941_0412421
522 Ga0373937_0574178
523 Ga0451807_1234161
524 Ga0451576_0193456
525 Ga0495592_0674992
526 Ga0495628_0465409
527 Ga0495659_0262179
528 Ga0495658_0430510
529 Ga0495658_0483218
530 Ga0495613_0988955
531 Ga0496102_0866842
532 Ga0496108_0993217
533 Ga0496109_0644854
534 Ga0496110_0877264
535 Ga0496110_0992221
536 Ga0501042_0791554
537 Ga0501071_0495640
538 Ga0501071_0596813
539 Ga0501072_0989107
540 Ga0501072_1408100
541 Ga0501080_0536419
542 Ga0501080_1487474
543 Ga0501081_1106161
544 nmdc:mga05p37_213269_c1
545 nmdc:mga09592_115476_c1
546 nmdc:mga0qj67_656121_c1
547 nmdc:mga08y16_1146728_c1
548 nmdc:mga08y16_1491058_c1
549 nmdc:mga08y16_182404_c1
550 nmdc:mga08y16_1882501_c1
551 nmdc:mga08y16_20283_c1
552 nmdc:mga08y16_7879_c1
553 nmdc:mga08y16_94959_c1
554 nmdc:mga08y16_95257_c1
555 nmdc:mga0n895_760907_c1
556 nmdc:mga0rr50_357015_c1
557 nmdc:mga0a205_1125064_c1
558 nmdc:mga0a205_187815_c1
559 Ga0495595_0264758
560 2687240502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

114

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7775 1 116
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7666 1 116
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.764 1 116
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.762 1 116
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.7512 1 116
ID Description Score Start End Superfamily
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7956 3 116 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7584 3 116 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7543 1 116 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7242 1 116 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7189 1 116 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A177PVT1-F1-model_v4 deleted 0.9163 1 115
AF-A0A1L6LS33-F1-model_v4 deleted 0.9086 1 114
AF-A0A1L6LS33-F1-model_v4 deleted 0.8937 1 114
AF-A0A7Y6Q093-F1-model_v4 YCII-related domain-containing protein 0.8782 1 116
AF-A0A2N9N0U2-F1-model_v4 YCII-related protein 0.8751 1 113

Map