F383436

General Info

Members Datasets Scaffolds Average Seq Length
280 224 264 117

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1000146|Ga0055524_100014675
Length 142
Sequence MLRPGALGAYPQATAIRRQRLPTRDNPAMSLVYSTDAGRMCPTCRQPAAACTCKAAAAVSTFPDGTVRVSRETKGRAGKGVTLVKGLGLAEPALTAWAKAMKATCGTGGTVKDGVVELQGDHVVLVMDKLKQQGRTVKRTGG

Samples

Sample ID Description Type Environment
1 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2643221621 Achromobacter sp. Root83 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221660 Methylibium sp. Root1272 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543030 Massilia sp. GV097 Isolate Unclassified
11 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
12 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
13 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
14 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
15 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
16 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
130 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 1.43
Isolates 5.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.57
Nodule 1.07
Rhizoplane 5.36
Rhizosphere 77.5
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1010987 3300002774 Bacteria 1659
2 Ga0006778J45830_1022157 3300003162 Unclassified 946
3 JGI25151J46595_10140989 3300003187 Bacteria 588
4 Ga0006777J48905_1038410 3300003308 Bacteria 1201
5 Ga0007427J51700_109499 3300003559 Bacteria 1016
6 Ga0032354_1105036 3300003693 Bacteria 772
7 Ga0055524_1000146 3300003775 Bacteria 84190
8 Ga0055540_1000001 3300003792 Bacteria 466834
9 Ga0055531_10001273 3300003794 Bacteria 19046
10 Ga0065165_1083301 3300005262 Bacteria 826
11 Ga0070676_10302824 3300005328 Bacteria 1084
12 Ga0070690_100048582 3300005330 Bacteria 2703
13 Ga0070670_100032852 3300005331 Bacteria 4471
14 Ga0070677_10712993 3300005333 Bacteria 566
15 Ga0068869_100036310 3300005334 Bacteria 3499
16 Ga0068869_100063745 3300005334 Bacteria 2709
17 Ga0070666_10076105 3300005335 Bacteria 2289
18 Ga0068868_100005715 3300005338 Bacteria 8756
19 Ga0068868_100016043 3300005338 Bacteria 5555
20 Ga0068868_100817508 3300005338 Bacteria 842
21 Ga0070689_100050715 3300005340 Bacteria 3207
22 Ga0070661_100000915 3300005344 Bacteria 21165
23 Ga0070669_100944253 3300005353 Bacteria 738
24 Ga0070675_100016400 3300005354 Bacteria 5880
25 Ga0070675_100092117 3300005354 Bacteria 2540
26 Ga0070671_100001109 3300005355 Bacteria 19956
27 Ga0070674_100447003 3300005356 Bacteria 1066
28 Ga0070673_100001472 3300005364 Bacteria 13779
29 Ga0070688_100833719 3300005365 Bacteria 723
30 Ga0070659_100145597 3300005366 Bacteria 1930
31 Ga0070667_100027080 3300005367 Bacteria 4769
32 Ga0070663_100569627 3300005455 Bacteria 949
33 Ga0070678_100001839 3300005456 Bacteria 11456
34 Ga0070662_100039723 3300005457 Bacteria 3347
35 Ga0068867_100100949 3300005459 Bacteria 2204
36 Ga0070685_10004569 3300005466 Bacteria 7005
37 Ga0070672_100238242 3300005543 Bacteria 1530
38 Ga0070665_100512474 3300005548 Bacteria 1211
39 Ga0068855_100017410 3300005563 Bacteria 8645
40 Ga0070664_100000465 3300005564 Bacteria 30736
41 Ga0068857_100439226 3300005577 Bacteria 1219
42 Ga0068854_100633596 3300005578 Bacteria 916
43 Ga0070702_100216085 3300005615 Bacteria 1279
44 Ga0068852_100712861 3300005616 Bacteria 1014
45 Ga0068852_101231280 3300005616 Bacteria 770
46 Ga0068859_100059130 3300005617 Bacteria 3861
47 Ga0068864_100002145 3300005618 Bacteria 16304
48 Ga0068861_100067036 3300005719 Bacteria 2769
49 Ga0068870_10233156 3300005840 Bacteria 1133
50 Ga0068863_100017263 3300005841 Bacteria 6922
51 Ga0068858_100001027 3300005842 Bacteria 28804
52 Ga0068860_100093089 3300005843 Bacteria 2872
53 Ga0068862_100816983 3300005844 Bacteria 911
54 Ga0070715_10876011 3300006163 Bacteria 551
55 Ga0097621_100026156 3300006237 Bacteria 4575
56 Ga0068871_100077976 3300006358 Bacteria 2739
57 Ga0075428_101146657 3300006844 Unclassified 820
58 Ga0075430_100690378 3300006846 Unclassified 841
59 Ga0075429_100355726 3300006880 Bacteria 1282
60 Ga0068865_100330986 3300006881 Bacteria 1228
61 Ga0097620_100059133 3300006931 Bacteria 3861
62 Ga0111539_10466282 3300009094 Bacteria 1471
63 Ga0105245_11410816 3300009098 Unclassified 747
64 Ga0114129_10269319 3300009147 Bacteria 2279
65 Ga0105241_10124431 3300009174 Bacteria 2080
66 Ga0105248_10009206 3300009177 Bacteria 10865
67 Ga0105248_10118806 3300009177 Bacteria 2982
68 Ga0105239_12982181 3300010375 Bacteria 552
69 Ga0157374_10109919 3300013296 Bacteria 2651
70 Ga0157378_10393227 3300013297 Bacteria 1364
71 Ga0163162_10010546 3300013306 Bacteria 8987
72 Ga0157375_10155311 3300013308 Bacteria 2427
73 Ga0157375_10410819 3300013308 Bacteria 1520
74 Ga0163163_10000600 3300014325 Bacteria 31449
75 Ga0157380_11140460 3300014326 Bacteria 820
76 Ga0182008_10525318 3300014497 Bacteria 654
77 Ga0157377_10805334 3300014745 Unclassified 693
78 Ga0157379_10002920 3300014968 Bacteria 14440
79 Ga0157376_10020867 3300014969 Bacteria 5078
80 Ga0157376_10213900 3300014969 Bacteria 1781
81 Ga0157376_10946929 3300014969 Unclassified 881
82 Ga0163161_11066538 3300017792 Bacteria 693
83 Ga0209675_1005902 3300025291 Bacteria 5024
84 Ga0209050_1011293 3300025298 Bacteria 4260
85 Ga0209256_1000015 3300025299 Bacteria 622953
86 Ga0209051_1043301 3300025303 Bacteria 1581
87 Ga0207682_10051121 3300025893 Bacteria 1711
88 Ga0207680_10066789 3300025903 Bacteria 2213
89 Ga0207645_10018350 3300025907 Bacteria 4604
90 Ga0207643_10930802 3300025908 Bacteria 563
91 Ga0207705_10270681 3300025909 Bacteria 1299
92 Ga0207684_10390877 3300025910 Bacteria 1196
93 Ga0207654_10235748 3300025911 Bacteria 1220
94 Ga0207650_10202913 3300025925 Bacteria 1589
95 Ga0207659_10001153 3300025926 Bacteria 15743
96 Ga0207644_10002964 3300025931 Bacteria 10935
97 Ga0207706_10056942 3300025933 Bacteria 3445
98 Ga0207670_10036365 3300025936 Bacteria 3201
99 Ga0207669_10073289 3300025937 Bacteria 2160
100 Ga0207704_10205579 3300025938 Bacteria 1445
101 Ga0207691_10664135 3300025940 Bacteria 880
102 Ga0207711_10185729 3300025941 Bacteria 1892
103 Ga0207711_10209244 3300025941 Bacteria 1781
104 Ga0207689_10004088 3300025942 Bacteria 13269
105 Ga0207661_11821333 3300025944 Bacteria 554
106 Ga0207667_10020682 3300025949 Bacteria 7314
107 Ga0207651_10000597 3300025960 Bacteria 15239
108 Ga0207651_10756803 3300025960 Bacteria 859
109 Ga0207677_10102363 3300026023 Bacteria 2111
110 Ga0207677_10469417 3300026023 Bacteria 1082
111 Ga0207677_10885031 3300026023 Bacteria 804
112 Ga0207703_10002610 3300026035 Bacteria 15552
113 Ga0207641_10002468 3300026088 Bacteria 17079
114 Ga0207648_10070694 3300026089 Bacteria 3042
115 Ga0207676_10000580 3300026095 Bacteria 30116
116 Ga0207674_11619729 3300026116 Bacteria 616
117 Ga0207675_100089001 3300026118 Bacteria 2900
118 Ga0207683_10001023 3300026121 Bacteria 25517
119 Ga0207683_10731185 3300026121 Bacteria 918
120 Ga0207698_10510403 3300026142 Bacteria 1171
121 Ga0209371_1009960 3300027312 Bacteria 2971
122 Ga0207428_11277443 3300027907 Unclassified 509
123 Ga0268266_10697963 3300028379 Bacteria 978
124 Ga0268265_10642830 3300028380 Bacteria 1019
125 Ga0268264_10077501 3300028381 Bacteria 2831
126 Ga0307515_10000109 3300028794 Bacteria 195895
127 Ga0268256_1010615 3300030500 Bacteria 2971
128 Ga0307512_10018241 3300030522 Bacteria 6413
129 Ga0307512_10362576 3300030522 Bacteria 631
130 Ga0307513_10093553 3300031456 Bacteria 3055
131 Ga0307509_10073030 3300031507 Bacteria 3573
132 Ga0307509_10164061 3300031507 Bacteria 2114
133 Ga0307408_100022483 3300031548 Bacteria 4285
134 Ga0307508_10000101 3300031616 Bacteria 100858
135 Ga0307514_10003870 3300031649 Bacteria 14053
136 Ga0307516_10000747 3300031730 Bacteria 44219
137 Ga0307516_10849677 3300031730 Bacteria 576
138 Ga0307405_10004556 3300031731 Bacteria 6568
139 Ga0307405_10039794 3300031731 Bacteria 2844
140 Ga0307410_11489837 3300031852 Bacteria 596
141 Ga0307406_10007631 3300031901 Bacteria 6006
142 Ga0307407_10022893 3300031903 Bacteria 3250
143 Ga0307412_10020074 3300031911 Bacteria 4060
144 Ga0307409_100220426 3300031995 Bacteria 1712
145 Ga0307416_100740913 3300032002 Bacteria 1075
146 Ga0307416_103616394 3300032002 Bacteria 517
147 Ga0307414_10059210 3300032004 Bacteria 2703
148 Ga0307411_10012061 3300032005 Bacteria 4695
149 Ga0307411_10368480 3300032005 Bacteria 1177
150 Ga0307415_100207762 3300032126 Bacteria 1559
151 Ga0307415_101000696 3300032126 Bacteria 777
152 Ga0307507_10024258 3300033179 Bacteria 6618
153 Ga0373946_0154928 3300035171 Bacteria 1072
154 Ga0373946_0649656 3300035171 Unclassified 549
155 Ga0373955_0647133 3300035172 Bacteria 648
156 Ga0395900_0470874 3300037418 Bacteria 1210
157 Ga0451791_0114895 3300041451 Bacteria 587
158 Ga0439449_0110173 3300042007 Bacteria 1020
159 Ga0466965_0166686 3300044683 Bacteria 1157
160 Ga0466968_0022808 3300044735 Bacteria 2547
161 Ga0495603_0852226 3300046455 Bacteria 519
162 Ga0495590_0073383 3300046457 Bacteria 1202
163 Ga0495638_0339490 3300046460 Bacteria 797
164 Ga0495653_0025347 3300046463 Bacteria 4768
165 Ga0495580_0233746 3300046472 Bacteria 1261
166 Ga0495582_0033486 3300046473 Bacteria 2824
167 Ga0495664_0775754 3300046477 Bacteria 564
168 Ga0495585_0219926 3300046492 Bacteria 958
169 Ga0495594_0065023 3300046499 Bacteria 2023
170 Ga0495607_0055521 3300046501 Bacteria 2278
171 Ga0495606_0310940 3300046507 Bacteria 850
172 Ga0495606_0385891 3300046507 Bacteria 733
173 Ga0495606_0473090 3300046507 Bacteria 638
174 Ga0495610_0278733 3300046512 Bacteria 652
175 Ga0495630_0247993 3300046517 Bacteria 1360
176 Ga0495643_0009556 3300046522 Bacteria 6018
177 Ga0495648_0023034 3300046524 Bacteria 4273
178 Ga0495666_0017538 3300046526 Bacteria 3565
179 Ga0495666_0072271 3300046526 Bacteria 1638
180 Ga0495652_0003652 3300046529 Bacteria 15074
181 Ga0495665_0024781 3300046531 Bacteria 3223
182 Ga0495586_0005557 3300046535 Bacteria 6743
183 Ga0495587_0074802 3300046536 Bacteria 1967
184 Ga0495587_0243134 3300046536 Bacteria 1012
185 Ga0495597_0000009 3300046542 Bacteria 227319
186 Ga0495597_0024909 3300046542 Bacteria 2758
187 Ga0495597_0077997 3300046542 Bacteria 1419
188 Ga0495622_0000017 3300046557 Bacteria 176313
189 Ga0495622_0165150 3300046557 Bacteria 997
190 Ga0495633_0252589 3300046558 Bacteria 804
191 Ga0495633_0368377 3300046558 Bacteria 650
192 Ga0495656_0038125 3300046615 Bacteria 1989
193 Ga0495668_0284045 3300046616 Bacteria 907
194 Ga0495634_0062524 3300046642 Bacteria 2472
195 Ga0495634_0767450 3300046642 Bacteria 551
196 Ga0495625_0154517 3300046660 Bacteria 1540
197 Ga0495635_0007996 3300046663 Bacteria 7389
198 Ga0495659_0000052 3300046664 Bacteria 52258
199 Ga0495661_0001287 3300046665 Bacteria 21453
200 Ga0495623_0035727 3300046679 Bacteria 3184
201 Ga0495658_0070268 3300046683 Bacteria 2031
202 Ga0495613_0021383 3300046689 Bacteria 4824
203 Ga0495671_0000128 3300046692 Bacteria 68354
204 Ga0495649_0007323 3300046694 Bacteria 6744
205 Ga0495649_0471407 3300046694 Bacteria 626
206 Ga0495649_0625459 3300046694 Bacteria 530
207 Ga0495589_0000465 3300046794 Bacteria 29573
208 Ga0495589_0408606 3300046794 Bacteria 623
209 Ga0495600_0071391 3300046809 Bacteria 2268
210 Ga0495660_0000053 3300046810 Bacteria 137479
211 Ga0495660_0004784 3300046810 Bacteria 8173
212 Ga0495660_0044773 3300046810 Bacteria 2432
213 Ga0495604_0037354 3300047317 Bacteria 3825
214 Ga0495604_0113459 3300047317 Bacteria 1972
215 Ga0495604_0135689 3300047317 Bacteria 1763
216 Ga0495672_0000066 3300047320 Bacteria 193318
217 Ga0495680_0012771 3300047322 Bacteria 7365
218 Ga0495680_0481871 3300047322 Bacteria 845
219 Ga0495683_0025741 3300047323 Bacteria 3013
220 Ga0495687_000048 3300047443 Bacteria 205967
221 Ga0495687_000824 3300047443 Bacteria 33173
222 Ga0495687_002023 3300047443 Bacteria 17159
223 Ga0495675_0001600 3300047444 Bacteria 13611
224 Ga0495675_0002572 3300047444 Bacteria 10870
225 Ga0495675_0161576 3300047444 Bacteria 1379
226 Ga0495679_068931 3300047446 Bacteria 1022
227 Ga0495593_0006882 3300047673 Bacteria 6659
228 Ga0495614_0009156 3300048089 Bacteria 4389
229 Ga0495626_0018058 3300048091 Bacteria 3550
230 Ga0496100_0100403 3300048903 Bacteria 1993
231 Ga0496104_0117941 3300048907 Bacteria 2547
232 Ga0496104_1521645 3300048907 Bacteria 572
233 Ga0496108_0130418 3300048911 Bacteria 2161
234 Ga0496109_0008144 3300048912 Bacteria 8890
235 Ga0496109_0853511 3300048912 Bacteria 848
236 Ga0496110_0489044 3300048913 Bacteria 1121
237 Ga0496112_0148118 3300048915 Bacteria 2315
238 Ga0496113_0008953 3300048916 Bacteria 6554
239 Ga0496114_0004146 3300048917 Bacteria 11214
240 Ga0496114_0302526 3300048917 Bacteria 1412
241 Ga0496114_1704535 3300048917 Unclassified 518
242 Ga0496115_1352733 3300048918 Unclassified 528
243 Ga0496116_0021133 3300048919 Bacteria 4916
244 Ga0496122_0000029 3300048925 Bacteria 336396
245 Ga0496122_0003200 3300048925 Bacteria 21813
246 Ga0496122_0490976 3300048925 Bacteria 599
247 Ga0496123_0000216 3300048926 Bacteria 117098
248 Ga0496123_0002597 3300048926 Bacteria 21963
249 Ga0496123_0261240 3300048926 Bacteria 848
250 Ga0496124_0029090 3300048927 Bacteria 4929
251 Ga0496125_0004696 3300048928 Bacteria 15568
252 Ga0496125_0207368 3300048928 Bacteria 1276
253 Ga0496125_0280758 3300048928 Bacteria 1032
254 Ga0496125_0320395 3300048928 Bacteria 940
255 Ga0496126_0006470 3300048929 Bacteria 13052
256 Ga0496126_0055506 3300048929 Bacteria 3584
257 Ga0496126_0070410 3300048929 Bacteria 3116
258 Ga0501034_0002174 3300049571 Bacteria 24290
259 Ga0501249_188367 3300049679 Bacteria 536
260 Ga0501080_0666028 3300049742 Bacteria 920
261 nmdc:mga05p37_414199_c1 3300050507 Bacteria 1570
262 nmdc:mga09592_345738_c1 3300050508 Bacteria 1287
263 nmdc:mga0qj67_44366_c1 3300050509 Bacteria 3503
264 nmdc:mga08y16_381313_c1 3300050511 Bacteria 1445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100740913 Ga0307416_1007409132 97
2 3300032126 Ga0307415_101000696 Ga0307415_1010006961 97
3 3300009147 Ga0114129_10269319 Ga0114129_102693192 98
4 3300050507 nmdc:mga05p37_414199_c1 nmdc:mga05p37_414199_c1_829_1218 98
5 3300014497 Ga0182008_10525318 Ga0182008_105253182 99
6 3300005578 Ga0068854_100633596 Ga0068854_1006335962 100
7 3300005616 Ga0068852_101231280 Ga0068852_1012312802 101
8 3300048912 Ga0496109_0008144 Ga0496109_0008144_43_348 101
9 3300049742 Ga0501080_0666028 Ga0501080_0666028_500_805 101
10 3300048918 Ga0496115_1352733 Ga0496115_1352733_12_326 103
11 3300005328 Ga0070676_10302824 Ga0070676_103028242 104
12 3300005330 Ga0070690_100048582 Ga0070690_1000485822 104
13 3300005331 Ga0070670_100032852 Ga0070670_1000328522 104
14 3300005334 Ga0068869_100036310 Ga0068869_1000363102 104
15 3300005335 Ga0070666_10076105 Ga0070666_100761053 104
16 3300005338 Ga0068868_100005715 Ga0068868_1000057158 104
17 3300005340 Ga0070689_100050715 Ga0070689_1000507153 104
18 3300005353 Ga0070669_100944253 Ga0070669_1009442532 104
19 3300005354 Ga0070675_100016400 Ga0070675_1000164007 104
20 3300005355 Ga0070671_100001109 Ga0070671_1000011094 104
21 3300005356 Ga0070674_100447003 Ga0070674_1004470032 104
22 3300005364 Ga0070673_100001472 Ga0070673_1000014729 104
23 3300005365 Ga0070688_100833719 Ga0070688_1008337192 104
24 3300005367 Ga0070667_100027080 Ga0070667_1000270804 104
25 3300005456 Ga0070678_100001839 Ga0070678_1000018394 104
26 3300005457 Ga0070662_100039723 Ga0070662_1000397233 104
27 3300005459 Ga0068867_100100949 Ga0068867_1001009492 104
28 3300005466 Ga0070685_10004569 Ga0070685_100045692 104
29 3300005543 Ga0070672_100238242 Ga0070672_1002382422 104
30 3300005548 Ga0070665_100512474 Ga0070665_1005124742 104
31 3300005615 Ga0070702_100216085 Ga0070702_1002160852 104
32 3300005616 Ga0068852_100712861 Ga0068852_1007128612 104
33 3300005617 Ga0068859_100059130 Ga0068859_1000591303 104
34 3300005618 Ga0068864_100002145 Ga0068864_1000021459 104
35 3300005719 Ga0068861_100067036 Ga0068861_1000670361 104
36 3300005840 Ga0068870_10233156 Ga0068870_102331561 104
37 3300005841 Ga0068863_100017263 Ga0068863_1000172636 104
38 3300005842 Ga0068858_100001027 Ga0068858_10000102714 104
39 3300005843 Ga0068860_100093089 Ga0068860_1000930892 104
40 3300005844 Ga0068862_100816983 Ga0068862_1008169832 104
41 3300006237 Ga0097621_100026156 Ga0097621_1000261566 104
42 3300006358 Ga0068871_100077976 Ga0068871_1000779762 104
43 3300006881 Ga0068865_100330986 Ga0068865_1003309862 104
44 3300006931 Ga0097620_100059133 Ga0097620_1000591333 104
45 3300009098 Ga0105245_11410816 Ga0105245_114108162 104
46 3300009177 Ga0105248_10009206 Ga0105248_100092069 104
47 3300013296 Ga0157374_10109919 Ga0157374_101099192 104
48 3300013297 Ga0157378_10393227 Ga0157378_103932272 104
49 3300013306 Ga0163162_10010546 Ga0163162_100105464 104
50 3300013308 Ga0157375_10155311 Ga0157375_101553112 104
51 3300014325 Ga0163163_10000600 Ga0163163_100006006 104
52 3300014326 Ga0157380_11140460 Ga0157380_111404602 104
53 3300014745 Ga0157377_10805334 Ga0157377_108053342 104
54 3300014968 Ga0157379_10002920 Ga0157379_100029205 104
55 3300014969 Ga0157376_10213900 Ga0157376_102139002 104
56 3300025893 Ga0207682_10051121 Ga0207682_100511212 104
57 3300025903 Ga0207680_10066789 Ga0207680_100667892 104
58 3300025907 Ga0207645_10018350 Ga0207645_100183504 104
59 3300025908 Ga0207643_10930802 Ga0207643_109308022 104
60 3300025925 Ga0207650_10202913 Ga0207650_102029132 104
61 3300025926 Ga0207659_10001153 Ga0207659_100011537 104
62 3300025931 Ga0207644_10002964 Ga0207644_100029648 104
63 3300025933 Ga0207706_10056942 Ga0207706_100569422 104
64 3300025936 Ga0207670_10036365 Ga0207670_100363654 104
65 3300025937 Ga0207669_10073289 Ga0207669_100732892 104
66 3300025938 Ga0207704_10205579 Ga0207704_102055792 104
67 3300025940 Ga0207691_10664135 Ga0207691_106641352 104
68 3300025941 Ga0207711_10185729 Ga0207711_101857292 104
69 3300025942 Ga0207689_10004088 Ga0207689_100040887 104
70 3300025960 Ga0207651_10000597 Ga0207651_100005973 104
71 3300026023 Ga0207677_10885031 Ga0207677_108850312 104
72 3300026035 Ga0207703_10002610 Ga0207703_1000261014 104
73 3300026088 Ga0207641_10002468 Ga0207641_1000246814 104
74 3300026089 Ga0207648_10070694 Ga0207648_100706943 104
75 3300026095 Ga0207676_10000580 Ga0207676_1000058014 104
76 3300026118 Ga0207675_100089001 Ga0207675_1000890013 104
77 3300026121 Ga0207683_10001023 Ga0207683_1000102316 104
78 3300026142 Ga0207698_10510403 Ga0207698_105104032 104
79 3300028379 Ga0268266_10697963 Ga0268266_106979631 104
80 3300028380 Ga0268265_10642830 Ga0268265_106428302 104
81 3300028381 Ga0268264_10077501 Ga0268264_100775012 104
82 3300046455 Ga0495603_0852226 Ga0495603_0852226_116_484 104
83 3300048911 Ga0496108_0130418 Ga0496108_0130418_1115_1483 104
84 3300048913 Ga0496110_0489044 Ga0496110_0489044_703_1071 104
85 3300048917 Ga0496114_1704535 Ga0496114_1704535_117_485 104
86 3300009094 Ga0111539_10466282 Ga0111539_104662821 106
87 3300027907 Ga0207428_11277443 Ga0207428_112774431 106
88 3300050511 nmdc:mga08y16_381313_c1 nmdc:mga08y16_381313_c1_1059_1433 106
89 3300006844 Ga0075428_101146657 Ga0075428_1011466571 108
90 3300006846 Ga0075430_100690378 Ga0075430_1006903782 108
91 3300006880 Ga0075429_100355726 Ga0075429_1003557262 108
92 3300050508 nmdc:mga09592_345738_c1 nmdc:mga09592_345738_c1_504_884 108
93 3300050509 nmdc:mga0qj67_44366_c1 nmdc:mga0qj67_44366_c1_1195_1575 108
94 3300035172 Ga0373955_0647133 Ga0373955_0647133_282_614 110
95 3300048927 Ga0496124_0029090 Ga0496124_0029090_361_723 110
96 3300048907 Ga0496104_0117941 Ga0496104_0117941_2198_2536 111
97 3300003162 Ga0006778J45830_1022157 Ga0006778J45830_10221572 112
98 3300003308 Ga0006777J48905_1038410 Ga0006777J48905_10384102 112
99 3300003559 Ga0007427J51700_109499 Ga0007427J51700_1094992 112
100 3300003693 Ga0032354_1105036 Ga0032354_11050361 112
101 3300003792 Ga0055540_1000001 Ga0055540_1000001387 112
102 3300003794 Ga0055531_10001273 Ga0055531_1000127315 112
103 3300005344 Ga0070661_100000915 Ga0070661_1000009154 112
104 3300005366 Ga0070659_100145597 Ga0070659_1001455971 112
105 3300005455 Ga0070663_100569627 Ga0070663_1005696272 112
106 3300005564 Ga0070664_100000465 Ga0070664_10000046528 112
107 3300031456 Ga0307513_10093553 Ga0307513_100935534 112
108 3300041451 Ga0451791_0114895 Ga0451791_0114895_105_461 112
109 3300044683 Ga0466965_0166686 Ga0466965_0166686_289_648 112
110 3300044735 Ga0466968_0022808 Ga0466968_0022808_1909_2268 112
111 3300046457 Ga0495590_0073383 Ga0495590_0073383_286_642 112
112 3300046492 Ga0495585_0219926 Ga0495585_0219926_548_904 112
113 3300046507 Ga0495606_0385891 Ga0495606_0385891_349_705 112
114 3300046522 Ga0495643_0009556 Ga0495643_0009556_808_1164 112
115 3300046542 Ga0495597_0000009 Ga0495597_0000009_31900_32256 112
116 3300046542 Ga0495597_0077997 Ga0495597_0077997_630_986 112
117 3300046665 Ga0495661_0001287 Ga0495661_0001287_16709_17065 112
118 3300046694 Ga0495649_0007323 Ga0495649_0007323_3609_3965 112
119 3300046694 Ga0495649_0625459 Ga0495649_0625459_140_496 112
120 3300046794 Ga0495589_0000465 Ga0495589_0000465_8340_8696 112
121 3300046794 Ga0495589_0408606 Ga0495589_0408606_10_366 112
122 3300047443 Ga0495687_000048 Ga0495687_000048_9707_10063 112
123 3300048091 Ga0495626_0018058 Ga0495626_0018058_1610_1966 112
124 3300048903 Ga0496100_0100403 Ga0496100_0100403_259_615 112
125 3300048915 Ga0496112_0148118 Ga0496112_0148118_1744_2100 112
126 3300048916 Ga0496113_0008953 Ga0496113_0008953_4178_4534 112
127 3300048925 Ga0496122_0003200 Ga0496122_0003200_4177_4533 112
128 3300048926 Ga0496123_0002597 Ga0496123_0002597_4863_5219 112
129 3300048928 Ga0496125_0004696 Ga0496125_0004696_337_693 112
130 3300049571 Ga0501034_0002174 Ga0501034_0002174_873_1232 112
131 iso_pu_bacteria 2643221660 2644340921 112
132 3300003775 Ga0055524_1000146 Ga0055524_100014675 113
133 3300005262 Ga0065165_1083301 Ga0065165_10833011 113
134 3300005334 Ga0068869_100063745 Ga0068869_1000637451 113
135 3300005338 Ga0068868_100016043 Ga0068868_1000160433 113
136 3300005338 Ga0068868_100817508 Ga0068868_1008175082 113
137 3300005563 Ga0068855_100017410 Ga0068855_1000174109 113
138 3300005577 Ga0068857_100439226 Ga0068857_1004392263 113
139 3300009174 Ga0105241_10124431 Ga0105241_101244313 113
140 3300010375 Ga0105239_12982181 Ga0105239_129821812 113
141 3300014969 Ga0157376_10020867 Ga0157376_100208672 113
142 3300025291 Ga0209675_1005902 Ga0209675_10059022 113
143 3300025298 Ga0209050_1011293 Ga0209050_10112933 113
144 3300025299 Ga0209256_1000015 Ga0209256_1000015463 113
145 3300025911 Ga0207654_10235748 Ga0207654_102357482 113
146 3300025944 Ga0207661_11821333 Ga0207661_118213331 113
147 3300025949 Ga0207667_10020682 Ga0207667_100206828 113
148 3300026023 Ga0207677_10102363 Ga0207677_101023633 113
149 3300026023 Ga0207677_10469417 Ga0207677_104694172 113
150 3300026116 Ga0207674_11619729 Ga0207674_116197292 113
151 3300031730 Ga0307516_10000747 Ga0307516_100007478 113
152 3300031730 Ga0307516_10849677 Ga0307516_108496772 113
153 3300032002 Ga0307416_103616394 Ga0307416_1036163942 113
154 3300042007 Ga0439449_0110173 Ga0439449_0110173_468_830 113
155 3300046460 Ga0495638_0339490 Ga0495638_0339490_298_684 113
156 3300046499 Ga0495594_0065023 Ga0495594_0065023_537_899 113
157 3300046526 Ga0495666_0017538 Ga0495666_0017538_1945_2307 113
158 3300046810 Ga0495660_0044773 Ga0495660_0044773_2028_2378 113
159 3300047317 Ga0495604_0113459 Ga0495604_0113459_705_1067 113
160 3300047443 Ga0495687_000824 Ga0495687_000824_10082_10432 113
161 3300047443 Ga0495687_002023 Ga0495687_002023_10082_10432 113
162 3300048912 Ga0496109_0853511 Ga0496109_0853511_123_485 113
163 3300048917 Ga0496114_0004146 Ga0496114_0004146_7768_8196 113
164 3300048925 Ga0496122_0490976 Ga0496122_0490976_116_481 113
165 3300048926 Ga0496123_0261240 Ga0496123_0261240_19_384 113
166 3300048928 Ga0496125_0280758 Ga0496125_0280758_304_669 113
167 3300049679 Ga0501249_188367 Ga0501249_188367_87_449 113
168 iso_pu_bacteria 2510917013 2511093672 113
169 iso_pu_bacteria 2599185292 2599904799 113
170 iso_pu_bacteria 2643221621 2644119702 113
171 iso_pu_bacteria 2643221645 2644251331 113
172 iso_pu_bacteria 2643221664 2644357468 113
173 iso_pu_bacteria 2738541280 2738740063 113
174 iso_pu_bacteria 2738541300 2738844177 113
175 iso_pu_bacteria 2738543018 2739274263 113
176 iso_pu_bacteria 2738543030 2739343307 113
177 iso_pu_bacteria 2842324504 2842325407 113
178 iso_pu_bacteria 2842348783 2842349686 113
179 iso_pu_bacteria 2842454564 2842455078 113
180 iso_pu_bacteria 2857542790 2857545721 113
181 iso_pu_bacteria 2881101125 2881103609 113
182 iso_pu_bacteria 2904479285 2904483550 113
183 3300002774 JGI25150J39212_1010987 JGI25150J39212_10109871 114
184 3300003187 JGI25151J46595_10140989 JGI25151J46595_101409892 114
185 3300005333 Ga0070677_10712993 Ga0070677_107129931 114
186 3300005354 Ga0070675_100092117 Ga0070675_1000921172 114
187 3300006163 Ga0070715_10876011 Ga0070715_108760111 114
188 3300009177 Ga0105248_10118806 Ga0105248_101188062 114
189 3300013308 Ga0157375_10410819 Ga0157375_104108192 114
190 3300014969 Ga0157376_10946929 Ga0157376_109469292 114
191 3300017792 Ga0163161_11066538 Ga0163161_110665382 114
192 3300025303 Ga0209051_1043301 Ga0209051_10433013 114
193 3300025909 Ga0207705_10270681 Ga0207705_102706813 114
194 3300025910 Ga0207684_10390877 Ga0207684_103908772 114
195 3300025941 Ga0207711_10209244 Ga0207711_102092442 114
196 3300025960 Ga0207651_10756803 Ga0207651_107568031 114
197 3300026121 Ga0207683_10731185 Ga0207683_107311852 114
198 3300027312 Ga0209371_1009960 Ga0209371_10099603 114
199 3300028794 Ga0307515_10000109 Ga0307515_1000010956 114
200 3300030500 Ga0268256_1010615 Ga0268256_10106154 114
201 3300030522 Ga0307512_10018241 Ga0307512_100182414 114
202 3300030522 Ga0307512_10362576 Ga0307512_103625762 114
203 3300031507 Ga0307509_10073030 Ga0307509_100730303 114
204 3300031507 Ga0307509_10164061 Ga0307509_101640612 114
205 3300031548 Ga0307408_100022483 Ga0307408_1000224834 114
206 3300031616 Ga0307508_10000101 Ga0307508_1000010169 114
207 3300031649 Ga0307514_10003870 Ga0307514_1000387011 114
208 3300031731 Ga0307405_10004556 Ga0307405_100045565 114
209 3300031731 Ga0307405_10039794 Ga0307405_100397941 114
210 3300031852 Ga0307410_11489837 Ga0307410_114898371 114
211 3300031901 Ga0307406_10007631 Ga0307406_100076314 114
212 3300031903 Ga0307407_10022893 Ga0307407_100228934 114
213 3300031911 Ga0307412_10020074 Ga0307412_100200743 114
214 3300031995 Ga0307409_100220426 Ga0307409_1002204263 114
215 3300032004 Ga0307414_10059210 Ga0307414_100592103 114
216 3300032005 Ga0307411_10012061 Ga0307411_100120612 114
217 3300032005 Ga0307411_10368480 Ga0307411_103684802 114
218 3300032126 Ga0307415_100207762 Ga0307415_1002077622 114
219 3300033179 Ga0307507_10024258 Ga0307507_100242584 114
220 3300035171 Ga0373946_0154928 Ga0373946_0154928_147_515 114
221 3300035171 Ga0373946_0649656 Ga0373946_0649656_53_421 114
222 3300037418 Ga0395900_0470874 Ga0395900_0470874_402_767 114
223 3300046463 Ga0495653_0025347 Ga0495653_0025347_2667_3029 114
224 3300046472 Ga0495580_0233746 Ga0495580_0233746_612_974 114
225 3300046473 Ga0495582_0033486 Ga0495582_0033486_1429_1791 114
226 3300046477 Ga0495664_0775754 Ga0495664_0775754_105_467 114
227 3300046501 Ga0495607_0055521 Ga0495607_0055521_1468_1824 114
228 3300046507 Ga0495606_0310940 Ga0495606_0310940_470_835 114
229 3300046507 Ga0495606_0473090 Ga0495606_0473090_51_416 114
230 3300046512 Ga0495610_0278733 Ga0495610_0278733_230_595 114
231 3300046517 Ga0495630_0247993 Ga0495630_0247993_88_450 114
232 3300046524 Ga0495648_0023034 Ga0495648_0023034_2661_3023 114
233 3300046526 Ga0495666_0072271 Ga0495666_0072271_89_451 114
234 3300046529 Ga0495652_0003652 Ga0495652_0003652_7448_7810 114
235 3300046531 Ga0495665_0024781 Ga0495665_0024781_626_988 114
236 3300046535 Ga0495586_0005557 Ga0495586_0005557_4418_4780 114
237 3300046536 Ga0495587_0074802 Ga0495587_0074802_817_1179 114
238 3300046536 Ga0495587_0243134 Ga0495587_0243134_562_924 114
239 3300046542 Ga0495597_0024909 Ga0495597_0024909_275_640 114
240 3300046557 Ga0495622_0000017 Ga0495622_0000017_173999_174361 114
241 3300046557 Ga0495622_0165150 Ga0495622_0165150_182_544 114
242 3300046558 Ga0495633_0252589 Ga0495633_0252589_366_731 114
243 3300046558 Ga0495633_0368377 Ga0495633_0368377_152_502 114
244 3300046615 Ga0495656_0038125 Ga0495656_0038125_86_448 114
245 3300046616 Ga0495668_0284045 Ga0495668_0284045_96_461 114
246 3300046642 Ga0495634_0062524 Ga0495634_0062524_509_871 114
247 3300046642 Ga0495634_0767450 Ga0495634_0767450_66_428 114
248 3300046660 Ga0495625_0154517 Ga0495625_0154517_703_1068 114
249 3300046663 Ga0495635_0007996 Ga0495635_0007996_1915_2277 114
250 3300046664 Ga0495659_0000052 Ga0495659_0000052_39202_39567 114
251 3300046679 Ga0495623_0035727 Ga0495623_0035727_1109_1471 114
252 3300046683 Ga0495658_0070268 Ga0495658_0070268_1013_1375 114
253 3300046689 Ga0495613_0021383 Ga0495613_0021383_3771_4133 114
254 3300046692 Ga0495671_0000128 Ga0495671_0000128_12738_13103 114
255 3300046694 Ga0495649_0471407 Ga0495649_0471407_184_549 114
256 3300046809 Ga0495600_0071391 Ga0495600_0071391_1395_1757 114
257 3300046810 Ga0495660_0000053 Ga0495660_0000053_124327_124692 114
258 3300046810 Ga0495660_0004784 Ga0495660_0004784_3155_3520 114
259 3300047317 Ga0495604_0037354 Ga0495604_0037354_780_1142 114
260 3300047317 Ga0495604_0135689 Ga0495604_0135689_907_1269 114
261 3300047320 Ga0495672_0000066 Ga0495672_0000066_154335_154700 114
262 3300047322 Ga0495680_0012771 Ga0495680_0012771_4178_4540 114
263 3300047322 Ga0495680_0481871 Ga0495680_0481871_77_439 114
264 3300047323 Ga0495683_0025741 Ga0495683_0025741_1161_1523 114
265 3300047444 Ga0495675_0001600 Ga0495675_0001600_7244_7606 114
266 3300047444 Ga0495675_0002572 Ga0495675_0002572_2445_2807 114
267 3300047444 Ga0495675_0161576 Ga0495675_0161576_205_567 114
268 3300047446 Ga0495679_068931 Ga0495679_068931_122_493 114
269 3300047673 Ga0495593_0006882 Ga0495593_0006882_919_1281 114
270 3300048089 Ga0495614_0009156 Ga0495614_0009156_1049_1411 114
271 3300048907 Ga0496104_1521645 Ga0496104_1521645_195_557 114
272 3300048917 Ga0496114_0302526 Ga0496114_0302526_609_974 114
273 3300048919 Ga0496116_0021133 Ga0496116_0021133_2919_3281 114
274 3300048925 Ga0496122_0000029 Ga0496122_0000029_322180_322545 114
275 3300048926 Ga0496123_0000216 Ga0496123_0000216_13852_14217 114
276 3300048928 Ga0496125_0207368 Ga0496125_0207368_458_823 114
277 3300048928 Ga0496125_0320395 Ga0496125_0320395_436_798 114
278 3300048929 Ga0496126_0006470 Ga0496126_0006470_6683_7045 114
279 3300048929 Ga0496126_0055506 Ga0496126_0055506_135_497 114
280 3300048929 Ga0496126_0070410 Ga0496126_0070410_823_1188 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01253

SUI1

Translation initiation factor SUI1

63

136

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mo0-assembly1.cif.gz_A crystal structure of aif1 from methanocaldococcus jannaschii 0.8945 36 110
5jb3-assembly1.cif.gz_1 cryo-em structure of a full archaeal ribosomal translation initiation complex in the p-remote conformation 0.8506 36 110
4mo0-assembly1.cif.gz_A crystal structure of aif1 from methanocaldococcus jannaschii 0.8417 36 110
5zcy-assembly1.cif.gz_A crystal structure of archaeal translation initiation factor 1 at 1.5 angstroms resolution 0.8245 35 110
6ywe-assembly1.cif.gz_7 the structure of the mitoribosome from neurospora crassa in the p/e trna bound state 0.8212 37 104
ID Description Score Start End Superfamily
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.937 32 112 3.30.780.10
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.9259 32 112 3.30.780.10
4mo0A00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8945 36 110 3.30.780.10
af_A0A143ZZH9_11_123_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8515 36 104 3.30.780.10
af_A0A5K1K9F4_35_107_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8455 39 100 3.30.780.10
ID Description Score Start End GO Terms
AF-A0A226X0C2-F1-model_v4 Translation initiation factor SUI1-related protein 0.9824 53 112 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A7C7CX06-F1-model_v4 Translation initiation factor 0.9806 37 108 GO:0003743
AF-A0A2T1GDQ5-F1-model_v4 Stress response translation initiation inhibitor YciH 0.9768 36 112 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A3C1ZCB3-F1-model_v4 SUI1 domain-containing protein 0.9764 37 110 GO:0003743
AF-W1F1T4-F1-model_v4 Translation initiation factor SUI1-related protein 0.9747 49 112 GO:0003743

Feature Viewer

pLDDT pTM Quality
74.26 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map