F383292

General Info

Members Datasets Scaffolds Average Seq Length
279 146 558 342

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0383219|Ga0496104_0383219_190_1140
Length 316
Sequence MWMMRQAGRYLPEYRALRSAKGGFLDLVYDPDAAAEITLQPLKRFPSLDAAILFSDILIVPFAIGQNLSFVAGEGPRLTPPLIDASLDDLTAYSARLDPIYETVRKVKSALGPSKTLIGFAGGPWTVATYMVAGQGSRDQSETRRLVYADPGAFAAIIDRIEEVTIAAGAEALQLFDSWAGNLSPSQFEQWVIAPTARIVTTLKERHPQVPLIGFPKGAGGKLAAYARETGVSAIGLDETVDPIWAAAELPSGLPVQGNLDPLALIAGGRELERAAKRVLDAFSDRPHIFNLGHGILQDTPIEHVEQLIALVKGAK

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
144 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
145 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
146 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 9.68
Rhizosphere 88.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0383219 3300048907 Bacteria 1319
2 JGI24737J22298_10046648 3300001990 Bacteria 1322
3 Ga0070658_10016842 3300005327 Bacteria 5850
4 Ga0070658_10124056 3300005327 Bacteria 2148
5 Ga0070676_10216497 3300005328 Bacteria 1263
6 Ga0070683_100062807 3300005329 Bacteria 3453
7 Ga0070670_100000657 3300005331 Bacteria 26873
8 Ga0070677_10016231 3300005333 Bacteria 2648
9 Ga0070666_10006893 3300005335 Bacteria 6999
10 Ga0068868_100038196 3300005338 Bacteria 3726
11 Ga0068868_100099555 3300005338 Bacteria 2352
12 Ga0070660_100317808 3300005339 Bacteria 1279
13 Ga0070661_100083097 3300005344 Bacteria 2365
14 Ga0070661_100186128 3300005344 Bacteria 1582
15 Ga0070692_10022154 3300005345 Bacteria 3101
16 Ga0070669_100020318 3300005353 Bacteria 4743
17 Ga0070675_100000529 3300005354 Bacteria 26091
18 Ga0070671_100000620 3300005355 Bacteria 25349
19 Ga0070671_100012836 3300005355 Bacteria 6755
20 Ga0070671_100115081 3300005355 Bacteria 2261
21 Ga0070674_100007778 3300005356 Bacteria 6336
22 Ga0070673_100000890 3300005364 Bacteria 16848
23 Ga0070673_100110587 3300005364 Bacteria 2278
24 Ga0070659_100008919 3300005366 Bacteria 7350
25 Ga0070659_100099350 3300005366 Bacteria 2341
26 Ga0070667_100021799 3300005367 Bacteria 5316
27 Ga0070714_100015466 3300005435 Bacteria 6139
28 Ga0070714_100496003 3300005435 Bacteria 1164
29 Ga0070663_100130644 3300005455 Bacteria 1907
30 Ga0070663_100149644 3300005455 Bacteria 1789
31 Ga0070662_100053766 3300005457 Bacteria 2916
32 Ga0070684_100020259 3300005535 Bacteria 5517
33 Ga0070684_100224337 3300005535 Bacteria 1715
34 Ga0070672_100005114 3300005543 Bacteria 8654
35 Ga0070665_100001860 3300005548 Bacteria 23948
36 Ga0070665_100021323 3300005548 Bacteria 6517
37 Ga0070665_100205723 3300005548 Bacteria 1969
38 Ga0070665_100530520 3300005548 Bacteria 1189
39 Ga0068855_100012862 3300005563 Bacteria 10097
40 Ga0070664_100006233 3300005564 Bacteria 9632
41 Ga0070664_100037806 3300005564 Bacteria 4060
42 Ga0070664_100157184 3300005564 Bacteria 2009
43 Ga0068857_100121405 3300005577 Bacteria 2353
44 Ga0068854_100057778 3300005578 Bacteria 2799
45 Ga0068852_100000305 3300005616 Bacteria 33064
46 Ga0068852_100214159 3300005616 Bacteria 1829
47 Ga0068852_100219378 3300005616 Bacteria 1808
48 Ga0068859_100001231 3300005617 Bacteria 26157
49 Ga0068859_100008097 3300005617 Bacteria 10659
50 Ga0068859_100046110 3300005617 Bacteria 4378
51 Ga0068864_100000953 3300005618 Bacteria 24235
52 Ga0068864_100018995 3300005618 Bacteria 5747
53 Ga0068861_100000072 3300005719 Bacteria 48956
54 Ga0068863_100003718 3300005841 Bacteria 15092
55 Ga0068858_100000695 3300005842 Bacteria 35157
56 Ga0068858_100052637 3300005842 Bacteria 3766
57 Ga0068860_100005142 3300005843 Bacteria 13302
58 Ga0068860_100221855 3300005843 Bacteria 1836
59 Ga0081539_10009264 3300005985 Bacteria 8281
60 Ga0097620_100001231 3300006931 Bacteria 26157
61 Ga0097620_100008097 3300006931 Bacteria 10659
62 Ga0097620_100046110 3300006931 Bacteria 4378
63 Ga0105240_10012132 3300009093 Bacteria 11930
64 Ga0105245_10000170 3300009098 Bacteria 61721
65 Ga0105247_10070819 3300009101 Bacteria 2179
66 Ga0105243_10048674 3300009148 Bacteria 3342
67 Ga0105243_10185897 3300009148 Bacteria 1811
68 Ga0105242_10006985 3300009176 Bacteria 8715
69 Ga0105248_10000184 3300009177 Bacteria 72728
70 Ga0105248_10002231 3300009177 Bacteria 21411
71 Ga0105248_10002857 3300009177 Bacteria 19171
72 Ga0105248_10006865 3300009177 Bacteria 12482
73 Ga0105248_10011637 3300009177 Bacteria 9694
74 Ga0105248_10019427 3300009177 Bacteria 7519
75 Ga0105248_10070023 3300009177 Bacteria 3939
76 Ga0105248_10091461 3300009177 Bacteria 3427
77 Ga0105248_10092384 3300009177 Bacteria 3408
78 Ga0105249_10014496 3300009553 Bacteria 6968
79 Ga0105246_10039446 3300011119 Bacteria 3181
80 Ga0157373_10005169 3300013100 Bacteria 9805
81 Ga0157373_10025319 3300013100 Bacteria 4293
82 Ga0157371_10118921 3300013102 Bacteria 1878
83 Ga0157369_10011088 3300013105 Bacteria 10254
84 Ga0157369_10087950 3300013105 Bacteria 3317
85 Ga0157374_10210814 3300013296 Bacteria 1905
86 Ga0163162_10075978 3300013306 Bacteria 3421
87 Ga0157372_10214483 3300013307 Bacteria 2231
88 Ga0157375_10350749 3300013308 Bacteria 1641
89 Ga0163163_10000131 3300014325 Bacteria 76809
90 Ga0163161_10195877 3300017792 Bacteria 1555
91 Ga0207682_10014102 3300025893 Bacteria 3115
92 Ga0207688_10021022 3300025901 Bacteria 3564
93 Ga0207680_10011125 3300025903 Bacteria 4533
94 Ga0207647_10021124 3300025904 Bacteria 4350
95 Ga0207645_10213230 3300025907 Bacteria 1272
96 Ga0207643_10063294 3300025908 Bacteria 2115
97 Ga0207705_10008145 3300025909 Bacteria 7674
98 Ga0207705_10015837 3300025909 Bacteria 5416
99 Ga0207705_10032140 3300025909 Bacteria 3749
100 Ga0207705_10073569 3300025909 Bacteria 2479
101 Ga0207705_10336050 3300025909 Bacteria 1162
102 Ga0207660_10000099 3300025917 Bacteria 48138
103 Ga0207657_10257508 3300025919 Bacteria 1389
104 Ga0207649_10104870 3300025920 Bacteria 1878
105 Ga0207681_10034324 3300025923 Bacteria 3335
106 Ga0207650_10003840 3300025925 Bacteria 10270
107 Ga0207650_10044277 3300025925 Bacteria 3270
108 Ga0207659_10000784 3300025926 Bacteria 18775
109 Ga0207659_10054050 3300025926 Bacteria 2867
110 Ga0207664_10176713 3300025929 Bacteria 1831
111 Ga0207644_10011383 3300025931 Bacteria 5884
112 Ga0207644_10054088 3300025931 Bacteria 2890
113 Ga0207644_10146222 3300025931 Bacteria 1825
114 Ga0207690_10030774 3300025932 Bacteria 3427
115 Ga0207690_10132610 3300025932 Bacteria 1825
116 Ga0207690_10176963 3300025932 Bacteria 1603
117 Ga0207691_10006424 3300025940 Bacteria 11356
118 Ga0207711_10000105 3300025941 Bacteria 90036
119 Ga0207711_10000413 3300025941 Bacteria 45274
120 Ga0207711_10001816 3300025941 Bacteria 19499
121 Ga0207711_10007955 3300025941 Bacteria 8868
122 Ga0207711_10041023 3300025941 Bacteria 3940
123 Ga0207661_10146065 3300025944 Bacteria 2040
124 Ga0207679_10003801 3300025945 Bacteria 9357
125 Ga0207679_10012211 3300025945 Bacteria 5595
126 Ga0207679_10211651 3300025945 Bacteria 1626
127 Ga0207679_10335633 3300025945 Bacteria 1313
128 Ga0207651_10000602 3300025960 Bacteria 15164
129 Ga0207651_10021024 3300025960 Bacteria 3955
130 Ga0207658_10002159 3300025986 Bacteria 14623
131 Ga0207658_10007613 3300025986 Bacteria 7376
132 Ga0207677_10135807 3300026023 Bacteria 1875
133 Ga0207703_10005297 3300026035 Bacteria 10395
134 Ga0207703_10039416 3300026035 Bacteria 3776
135 Ga0207678_10018288 3300026067 Bacteria 6154
136 Ga0207678_10132854 3300026067 Bacteria 2123
137 Ga0207678_10275329 3300026067 Bacteria 1444
138 Ga0207641_10000172 3300026088 Bacteria 90549
139 Ga0207641_10025760 3300026088 Bacteria 4850
140 Ga0207676_10002758 3300026095 Bacteria 12490
141 Ga0207674_10008177 3300026116 Bacteria 12127
142 Ga0207675_100000277 3300026118 Bacteria 48971
143 Ga0207698_10002051 3300026142 Bacteria 11883
144 Ga0268266_10000200 3300028379 Bacteria 104456
145 Ga0268266_10101239 3300028379 Bacteria 2539
146 Ga0268264_10001019 3300028381 Bacteria 28201
147 Ga0316176_1148994 3300030732 Bacteria 2137
148 Ga0316181_1095602 3300030744 Bacteria 1853
149 Ga0307408_100034318 3300031548 Bacteria 3553
150 Ga0307408_100035253 3300031548 Bacteria 3510
151 Ga0307408_100121314 3300031548 Bacteria 2025
152 Ga0307405_10030756 3300031731 Bacteria 3151
153 Ga0307413_10062673 3300031824 Bacteria 2301
154 Ga0307410_10037665 3300031852 Bacteria 3161
155 Ga0307406_10089881 3300031901 Bacteria 2065
156 Ga0307406_10139924 3300031901 Bacteria 1712
157 Ga0307407_10039218 3300031903 Bacteria 2632
158 Ga0307407_10202165 3300031903 Bacteria 1332
159 Ga0307412_10002333 3300031911 Bacteria 10511
160 Ga0307412_10075457 3300031911 Bacteria 2313
161 Ga0307412_10240359 3300031911 Bacteria 1400
162 Ga0307409_100015316 3300031995 Bacteria 5028
163 Ga0307409_100076974 3300031995 Bacteria 2678
164 Ga0307409_100081510 3300031995 Bacteria 2616
165 Ga0307416_100001757 3300032002 Bacteria 12005
166 Ga0307416_100006944 3300032002 Bacteria 7137
167 Ga0307416_100096578 3300032002 Bacteria 2556
168 Ga0307416_100249771 3300032002 Bacteria 1725
169 Ga0307414_10018003 3300032004 Bacteria 4336
170 Ga0307414_10053598 3300032004 Bacteria 2814
171 Ga0307411_10008012 3300032005 Bacteria 5440
172 Ga0307411_10057106 3300032005 Bacteria 2576
173 Ga0307411_10141616 3300032005 Bacteria 1774
174 Ga0307411_10210276 3300032005 Bacteria 1501
175 Ga0307411_10214701 3300032005 Bacteria 1488
176 Ga0307415_100009474 3300032126 Bacteria 5463
177 Ga0307415_100033808 3300032126 Bacteria 3321
178 Ga0307415_100061077 3300032126 Bacteria 2608
179 Ga0395899_0026181 3300037312 Bacteria 4402
180 Ga0395899_0082354 3300037312 Bacteria 2340
181 Ga0395899_0105562 3300037312 Bacteria 2029
182 Ga0395899_0152201 3300037312 Bacteria 1638
183 Ga0395900_0008602 3300037418 Bacteria 10487
184 Ga0395900_0034863 3300037418 Bacteria 5184
185 Ga0395900_0065484 3300037418 Bacteria 3733
186 Ga0395900_0089841 3300037418 Bacteria 3157
187 Ga0395900_0095700 3300037418 Bacteria 3051
188 Ga0395900_0106690 3300037418 Bacteria 2877
189 Ga0395900_0111599 3300037418 Bacteria 2808
190 Ga0395900_0173764 3300037418 Bacteria 2192
191 Ga0395898_0030537 3300037466 Bacteria 5392
192 Ga0395898_0061180 3300037466 Bacteria 3658
193 Ga0395898_0111323 3300037466 Bacteria 2624
194 Ga0395898_0118981 3300037466 Bacteria 2530
195 Ga0395905_0000232 3300037471 Bacteria 84233
196 Ga0395905_0002796 3300037471 Bacteria 19111
197 Ga0395905_0018897 3300037471 Bacteria 6536
198 Ga0395905_0036497 3300037471 Bacteria 4616
199 Ga0395905_0068211 3300037471 Bacteria 3331
200 Ga0395905_0169838 3300037471 Bacteria 2048
201 Ga0395905_0170363 3300037471 Bacteria 2045
202 Ga0395905_0183705 3300037471 Bacteria 1963
203 Ga0395905_0187076 3300037471 Bacteria 1943
204 Ga0395905_0231836 3300037471 Bacteria 1726
205 Ga0395905_0318277 3300037471 Bacteria 1445
206 Ga0395905_0355193 3300037471 Bacteria 1358
207 Ga0395905_0485194 3300037471 Bacteria 1135
208 Ga0395901_0010520 3300038443 Bacteria 9370
209 Ga0395901_0013378 3300038443 Bacteria 8338
210 Ga0395901_0064779 3300038443 Bacteria 3804
211 Ga0395901_0089890 3300038443 Bacteria 3213
212 Ga0395901_0136362 3300038443 Bacteria 2579
213 Ga0395901_0259432 3300038443 Bacteria 1809
214 Ga0395901_0479028 3300038443 Bacteria 1270
215 Ga0436365_0027266 3300039437 Bacteria 6257
216 Ga0439461_0004380 3300041410 Bacteria 2357
217 Ga0439465_0001355 3300041413 Bacteria 7882
218 Ga0439431_0036115 3300041997 Bacteria 1243
219 Ga0439445_0006037 3300042004 Bacteria 2776
220 Ga0439455_0017898 3300042012 Bacteria 1656
221 Ga0439458_0000023 3300042157 Bacteria 23385
222 Ga0439458_0001457 3300042157 Bacteria 5964
223 Ga0466963_0063891 3300044694 Bacteria 2465
224 Ga0466963_0202464 3300044694 Bacteria 1389
225 Ga0466957_0203516 3300044842 Bacteria 1301
226 Ga0466960_0094012 3300044901 Bacteria 1533
227 Ga0466960_0163162 3300044901 Bacteria 1198
228 Ga0466959_0126315 3300045049 Bacteria 1815
229 Ga0466958_0091901 3300045836 Bacteria 1879
230 Ga0466967_0051510 3300045976 Bacteria 3608
231 Ga0466967_0179794 3300045976 Bacteria 1995
232 Ga0466967_0244658 3300045976 Bacteria 1712
233 Ga0466967_0363493 3300045976 Bacteria 1403
234 Ga0466967_0498679 3300045976 Bacteria 1195
235 Ga0466967_0565523 3300045976 Bacteria 1120
236 Ga0495585_0040745 3300046492 Bacteria 2607
237 Ga0495644_0079547 3300046523 Bacteria 1235
238 Ga0495663_0012398 3300046525 Bacteria 2375
239 Ga0495663_0050027 3300046525 Bacteria 1292
240 Ga0495668_0002012 3300046616 Bacteria 17752
241 Ga0495669_0000704 3300046684 Bacteria 14606
242 Ga0495669_0017666 3300046684 Bacteria 3063
243 Ga0495669_0032638 3300046684 Bacteria 2290
244 Ga0495669_0091516 3300046684 Bacteria 1405
245 Ga0496100_0020773 3300048903 Bacteria 3944
246 Ga0496101_0015312 3300048904 Bacteria 5166
247 Ga0496105_0252247 3300048908 Bacteria 1429
248 Ga0496106_0001325 3300048909 Bacteria 18554
249 Ga0496107_0011693 3300048910 Bacteria 6118
250 Ga0496107_0119786 3300048910 Bacteria 1938
251 Ga0496107_0198098 3300048910 Bacteria 1493
252 Ga0496108_0182122 3300048911 Bacteria 1819
253 Ga0496109_0003929 3300048912 Bacteria 12421
254 Ga0496109_0103313 3300048912 Bacteria 2645
255 Ga0496109_0426553 3300048912 Bacteria 1253
256 Ga0496110_0005802 3300048913 Bacteria 9705
257 Ga0496110_0030427 3300048913 Bacteria 4654
258 Ga0496111_0001561 3300048914 Bacteria 13211
259 Ga0496111_0002550 3300048914 Bacteria 11006
260 Ga0496111_0029480 3300048914 Bacteria 3898
261 Ga0496111_0138797 3300048914 Bacteria 1801
262 Ga0496112_0002082 3300048915 Bacteria 15862
263 Ga0496112_0003485 3300048915 Bacteria 13028
264 Ga0496112_0024972 3300048915 Bacteria 5733
265 Ga0496112_0060785 3300048915 Bacteria 3723
266 Ga0496113_0011514 3300048916 Bacteria 5906
267 Ga0496113_0086521 3300048916 Bacteria 2408
268 Ga0496113_0118105 3300048916 Bacteria 2071
269 Ga0496114_0078902 3300048917 Bacteria 2778
270 Ga0496115_0009649 3300048918 Bacteria 7182
271 Ga0501074_0019492 3300049590 Bacteria 4926
272 Ga0501249_009339 3300049679 Bacteria 2040
273 Ga0501225_0008403 3300049705 Bacteria 2963
274 nmdc:mga09592_350630_c1 3300050508 Bacteria 1277
275 Ga0500658_0000032 3300053134 Bacteria 90863
276 2644127418 2643221622 Bacteria 4212502
277 2928029356 2928027323 Bacteria 4382488
278 2990268127 2990265787 Bacteria 3943888
279 2993696848 2993693658 Bacteria 4040749
280 Ga0496104_0383219
281 JGI24737J22298_10046648
282 Ga0070658_10016842
283 Ga0070658_10124056
284 Ga0070676_10216497
285 Ga0070683_100062807
286 Ga0070670_100000657
287 Ga0070677_10016231
288 Ga0070666_10006893
289 Ga0068868_100038196
290 Ga0068868_100099555
291 Ga0070660_100317808
292 Ga0070661_100083097
293 Ga0070661_100186128
294 Ga0070692_10022154
295 Ga0070669_100020318
296 Ga0070675_100000529
297 Ga0070671_100000620
298 Ga0070671_100012836
299 Ga0070671_100115081
300 Ga0070674_100007778
301 Ga0070673_100000890
302 Ga0070673_100110587
303 Ga0070659_100008919
304 Ga0070659_100099350
305 Ga0070667_100021799
306 Ga0070714_100015466
307 Ga0070714_100496003
308 Ga0070663_100130644
309 Ga0070663_100149644
310 Ga0070662_100053766
311 Ga0070684_100020259
312 Ga0070684_100224337
313 Ga0070672_100005114
314 Ga0070665_100001860
315 Ga0070665_100021323
316 Ga0070665_100205723
317 Ga0070665_100530520
318 Ga0068855_100012862
319 Ga0070664_100006233
320 Ga0070664_100037806
321 Ga0070664_100157184
322 Ga0068857_100121405
323 Ga0068854_100057778
324 Ga0068852_100000305
325 Ga0068852_100214159
326 Ga0068852_100219378
327 Ga0068859_100001231
328 Ga0068859_100008097
329 Ga0068859_100046110
330 Ga0068864_100000953
331 Ga0068864_100018995
332 Ga0068861_100000072
333 Ga0068863_100003718
334 Ga0068858_100000695
335 Ga0068858_100052637
336 Ga0068860_100005142
337 Ga0068860_100221855
338 Ga0081539_10009264
339 Ga0097620_100001231
340 Ga0097620_100008097
341 Ga0097620_100046110
342 Ga0105240_10012132
343 Ga0105245_10000170
344 Ga0105247_10070819
345 Ga0105243_10048674
346 Ga0105243_10185897
347 Ga0105242_10006985
348 Ga0105248_10000184
349 Ga0105248_10002231
350 Ga0105248_10002857
351 Ga0105248_10006865
352 Ga0105248_10011637
353 Ga0105248_10019427
354 Ga0105248_10070023
355 Ga0105248_10091461
356 Ga0105248_10092384
357 Ga0105249_10014496
358 Ga0105246_10039446
359 Ga0157373_10005169
360 Ga0157373_10025319
361 Ga0157371_10118921
362 Ga0157369_10011088
363 Ga0157369_10087950
364 Ga0157374_10210814
365 Ga0163162_10075978
366 Ga0157372_10214483
367 Ga0157375_10350749
368 Ga0163163_10000131
369 Ga0163161_10195877
370 Ga0207682_10014102
371 Ga0207688_10021022
372 Ga0207680_10011125
373 Ga0207647_10021124
374 Ga0207645_10213230
375 Ga0207643_10063294
376 Ga0207705_10008145
377 Ga0207705_10015837
378 Ga0207705_10032140
379 Ga0207705_10073569
380 Ga0207705_10336050
381 Ga0207660_10000099
382 Ga0207657_10257508
383 Ga0207649_10104870
384 Ga0207681_10034324
385 Ga0207650_10003840
386 Ga0207650_10044277
387 Ga0207659_10000784
388 Ga0207659_10054050
389 Ga0207664_10176713
390 Ga0207644_10011383
391 Ga0207644_10054088
392 Ga0207644_10146222
393 Ga0207690_10030774
394 Ga0207690_10132610
395 Ga0207690_10176963
396 Ga0207691_10006424
397 Ga0207711_10000105
398 Ga0207711_10000413
399 Ga0207711_10001816
400 Ga0207711_10007955
401 Ga0207711_10041023
402 Ga0207661_10146065
403 Ga0207679_10003801
404 Ga0207679_10012211
405 Ga0207679_10211651
406 Ga0207679_10335633
407 Ga0207651_10000602
408 Ga0207651_10021024
409 Ga0207658_10002159
410 Ga0207658_10007613
411 Ga0207677_10135807
412 Ga0207703_10005297
413 Ga0207703_10039416
414 Ga0207678_10018288
415 Ga0207678_10132854
416 Ga0207678_10275329
417 Ga0207641_10000172
418 Ga0207641_10025760
419 Ga0207676_10002758
420 Ga0207674_10008177
421 Ga0207675_100000277
422 Ga0207698_10002051
423 Ga0268266_10000200
424 Ga0268266_10101239
425 Ga0268264_10001019
426 Ga0316176_1148994
427 Ga0316181_1095602
428 Ga0307408_100034318
429 Ga0307408_100035253
430 Ga0307408_100121314
431 Ga0307405_10030756
432 Ga0307413_10062673
433 Ga0307410_10037665
434 Ga0307406_10089881
435 Ga0307406_10139924
436 Ga0307407_10039218
437 Ga0307407_10202165
438 Ga0307412_10002333
439 Ga0307412_10075457
440 Ga0307412_10240359
441 Ga0307409_100015316
442 Ga0307409_100076974
443 Ga0307409_100081510
444 Ga0307416_100001757
445 Ga0307416_100006944
446 Ga0307416_100096578
447 Ga0307416_100249771
448 Ga0307414_10018003
449 Ga0307414_10053598
450 Ga0307411_10008012
451 Ga0307411_10057106
452 Ga0307411_10141616
453 Ga0307411_10210276
454 Ga0307411_10214701
455 Ga0307415_100009474
456 Ga0307415_100033808
457 Ga0307415_100061077
458 Ga0395899_0026181
459 Ga0395899_0082354
460 Ga0395899_0105562
461 Ga0395899_0152201
462 Ga0395900_0008602
463 Ga0395900_0034863
464 Ga0395900_0065484
465 Ga0395900_0089841
466 Ga0395900_0095700
467 Ga0395900_0106690
468 Ga0395900_0111599
469 Ga0395900_0173764
470 Ga0395898_0030537
471 Ga0395898_0061180
472 Ga0395898_0111323
473 Ga0395898_0118981
474 Ga0395905_0000232
475 Ga0395905_0002796
476 Ga0395905_0018897
477 Ga0395905_0036497
478 Ga0395905_0068211
479 Ga0395905_0169838
480 Ga0395905_0170363
481 Ga0395905_0183705
482 Ga0395905_0187076
483 Ga0395905_0231836
484 Ga0395905_0318277
485 Ga0395905_0355193
486 Ga0395905_0485194
487 Ga0395901_0010520
488 Ga0395901_0013378
489 Ga0395901_0064779
490 Ga0395901_0089890
491 Ga0395901_0136362
492 Ga0395901_0259432
493 Ga0395901_0479028
494 Ga0436365_0027266
495 Ga0439461_0004380
496 Ga0439465_0001355
497 Ga0439431_0036115
498 Ga0439445_0006037
499 Ga0439455_0017898
500 Ga0439458_0000023
501 Ga0439458_0001457
502 Ga0466963_0063891
503 Ga0466963_0202464
504 Ga0466957_0203516
505 Ga0466960_0094012
506 Ga0466960_0163162
507 Ga0466959_0126315
508 Ga0466958_0091901
509 Ga0466967_0051510
510 Ga0466967_0179794
511 Ga0466967_0244658
512 Ga0466967_0363493
513 Ga0466967_0498679
514 Ga0466967_0565523
515 Ga0495585_0040745
516 Ga0495644_0079547
517 Ga0495663_0012398
518 Ga0495663_0050027
519 Ga0495668_0002012
520 Ga0495669_0000704
521 Ga0495669_0017666
522 Ga0495669_0032638
523 Ga0495669_0091516
524 Ga0496100_0020773
525 Ga0496101_0015312
526 Ga0496105_0252247
527 Ga0496106_0001325
528 Ga0496107_0011693
529 Ga0496107_0119786
530 Ga0496107_0198098
531 Ga0496108_0182122
532 Ga0496109_0003929
533 Ga0496109_0103313
534 Ga0496109_0426553
535 Ga0496110_0005802
536 Ga0496110_0030427
537 Ga0496111_0001561
538 Ga0496111_0002550
539 Ga0496111_0029480
540 Ga0496111_0138797
541 Ga0496112_0002082
542 Ga0496112_0003485
543 Ga0496112_0024972
544 Ga0496112_0060785
545 Ga0496113_0011514
546 Ga0496113_0086521
547 Ga0496113_0118105
548 Ga0496114_0078902
549 Ga0496115_0009649
550 Ga0501074_0019492
551 Ga0501249_009339
552 Ga0501225_0008403
553 nmdc:mga09592_350630_c1
554 Ga0500658_0000032
555 2644127418
556 2928029356
557 2990268127
558 2993696848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

1

315

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r3s-assembly1.cif.gz_A uroporphyrinogen decarboxylase single mutant d86g in complex with coproporphyrinogen-i 0.95 14 350
1jph-assembly1.cif.gz_A-2 ile260thr mutant of human urod, human uroporphyrinogen iii decarboxylase 0.9495 14 350
1r3r-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase with mutation d86n 0.9488 14 350
1jpi-assembly1.cif.gz_A-2 phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase 0.9476 14 350
1r3w-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase y164f mutant in complex with coproporphyrinogen-iii 0.9466 14 350
ID Description Score Start End Superfamily
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.95 14 350 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9453 14 349 3.20.20.210
af_P9WFE1_2_357_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9279 14 350 3.20.20.210
2ejaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9191 16 352 3.20.20.210
4wshB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.919 18 350 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A2N8FMB6-F1-model_v4 deleted 0.9919 131 234
AF-A0A6N0WZN4-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9914 15 351 GO:0004853
GO:0005829
GO:0019353
AF-A0A6L4A2C3-F1-model_v4 deleted 0.9909 181 352
AF-A0A519EBC1-F1-model_v4 deleted 0.9905 251 351
AF-A0A653J780-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9892 17 352 GO:0004853
GO:0005829
GO:0019353

Map