F383057

General Info

Members Datasets Scaffolds Average Seq Length
279 193 271 329

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10115272|Ga0157369_101152724
Length 369
Sequence MSAHPSRFGVVVIGRNEGERLRICLQSVLRSAARIVYVDSGSTDGSPALAQTLGVEVVALDLAIPFTAARARNAGYRRLLEIAPELTLVQFVDGDCEVVAGWTEVAVARLDERPELAVVCGRRRERHPEASIYNQLCDMEWNTPLGEATACGGDALMRLSALEAVGGFNPELIAGEEPELCVRLRARGYRIERLDAEMTLHDAAMTRFGQWWQRNVRAGHAYAEGAALHGRPPERHNVRAVQRAVFWAGLVPALAVAGAVPTAGASLLLFAGYPVLAARVYRGARRGGWSARAAALSAAFIVLGKFPELRGILKYRWSRARGRRSALIEYKGPARSAGPAPRAPLSGEGAGAAARPATDGGGPTPPRRP

Samples

Sample ID Description Type Environment
1 2511231018 Pseudomonas sp. GM60 Isolate Nodule
2 2511231021 Pseudomonas sp. GM78 Isolate Nodule
3 2511231024 Pseudomonas sp. GM84 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2765235841 Pseudomonas putida AA7 Isolate Unclassified
6 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
7 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
119 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
185 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
188 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
191 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
192 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
193 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.04
Nodule 1.43
Rhizoplane 3.23
Rhizosphere 77.06
Stem 0
Stem Tuber 0
Unclassified 8.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10097732 3300003316 Bacteria 2982
2 rootL2_10211767 3300003322 Unclassified 1585
3 JGI25404J52841_10000095 3300003659 Bacteria 8536
4 Ga0065165_1004419 3300005262 Bacteria 8752
5 Ga0070676_10007548 3300005328 Bacteria 5842
6 Ga0070670_100042577 3300005331 Bacteria 3904
7 Ga0070677_10003540 3300005333 Bacteria 5037
8 Ga0070677_10016380 3300005333 Bacteria 2638
9 Ga0068869_100047023 3300005334 Bacteria 3114
10 Ga0070666_10003905 3300005335 Bacteria 9056
11 Ga0070666_10063148 3300005335 Bacteria 2510
12 Ga0068868_100003639 3300005338 Bacteria 10753
13 Ga0070689_100018544 3300005340 Bacteria 5129
14 Ga0070668_100152710 3300005347 Bacteria 1869
15 Ga0070675_100002339 3300005354 Bacteria 14086
16 Ga0070675_100243479 3300005354 Bacteria 1572
17 Ga0070671_100034240 3300005355 Bacteria 4205
18 Ga0070674_100110228 3300005356 Bacteria 2020
19 Ga0070673_100003811 3300005364 Bacteria 9462
20 Ga0070688_100051403 3300005365 Bacteria 2571
21 Ga0070667_100128681 3300005367 Bacteria 2208
22 Ga0070713_100245321 3300005436 Bacteria 1632
23 Ga0070713_100460113 3300005436 Bacteria 1196
24 Ga0070663_100085446 3300005455 Bacteria 2328
25 Ga0070678_100010211 3300005456 Bacteria 5724
26 Ga0070678_100294010 3300005456 Bacteria 1378
27 Ga0070662_100020259 3300005457 Bacteria 4527
28 Ga0068867_100051111 3300005459 Bacteria 3048
29 Ga0068867_100097871 3300005459 Bacteria 2236
30 Ga0070685_10096796 3300005466 Bacteria 1796
31 Ga0070707_100166672 3300005468 Bacteria 2147
32 Ga0070679_100122242 3300005530 Bacteria 2588
33 Ga0070672_100036071 3300005543 Bacteria 3764
34 Ga0070672_100130130 3300005543 Bacteria 2067
35 Ga0070672_100156512 3300005543 Bacteria 1888
36 Ga0070686_100047228 3300005544 Bacteria 2721
37 Ga0070664_100017719 3300005564 Bacteria 5850
38 Ga0068856_100071263 3300005614 Bacteria 3440
39 Ga0068852_100106213 3300005616 Bacteria 2545
40 Ga0068859_100008226 3300005617 Bacteria 10583
41 Ga0068864_100000949 3300005618 Bacteria 24245
42 Ga0068861_100053436 3300005719 Bacteria 3073
43 Ga0068863_100076356 3300005841 Bacteria 3170
44 Ga0068858_100013857 3300005842 Bacteria 7605
45 Ga0068860_100033781 3300005843 Bacteria 4908
46 Ga0081540_1000161 3300005983 Bacteria 69395
47 Ga0081539_10056594 3300005985 Unclassified 2175
48 Ga0075432_10000429 3300006058 Bacteria 12305
49 Ga0075362_10047694 3300006177 Bacteria 1909
50 Ga0075367_10145588 3300006178 Bacteria 1469
51 Ga0075366_10004642 3300006195 Bacteria 7381
52 Ga0075366_10048385 3300006195 Bacteria 2521
53 Ga0075366_10126700 3300006195 Bacteria 1540
54 Ga0075370_10004219 3300006353 Bacteria 6945
55 Ga0075370_10010209 3300006353 Bacteria 4899
56 Ga0068871_100017380 3300006358 Bacteria 5441
57 Ga0075431_100242112 3300006847 Unclassified 1835
58 Ga0097620_100008226 3300006931 Bacteria 10583
59 Ga0105251_10000570 3300009011 Bacteria 34517
60 Ga0105251_10011993 3300009011 Bacteria 4919
61 Ga0105240_10259249 3300009093 Bacteria 2006
62 Ga0105248_10010704 3300009177 Bacteria 10123
63 Ga0105248_10147190 3300009177 Bacteria 2658
64 Ga0105248_10155721 3300009177 Bacteria 2578
65 Ga0105238_10075730 3300009551 Bacteria 3356
66 Ga0157369_10115272 3300013105 Bacteria 2853
67 Ga0157369_10232145 3300013105 Bacteria 1929
68 Ga0157374_10028232 3300013296 Bacteria 5068
69 Ga0157374_10572619 3300013296 Bacteria 1138
70 Ga0157378_10277223 3300013297 Bacteria 1615
71 Ga0157378_10330946 3300013297 Bacteria 1482
72 Ga0163162_10004952 3300013306 Bacteria 12834
73 Ga0163162_10176825 3300013306 Bacteria 2260
74 Ga0157375_10017160 3300013308 Bacteria 6527
75 Ga0157375_10179816 3300013308 Bacteria 2266
76 Ga0163163_10011344 3300014325 Bacteria 8080
77 Ga0157380_10187819 3300014326 Bacteria 1821
78 Ga0157377_10247251 3300014745 Bacteria 1154
79 Ga0157379_10002482 3300014968 Bacteria 15445
80 Ga0157379_10304312 3300014968 Bacteria 1453
81 Ga0157376_10040413 3300014969 Bacteria 3812
82 Ga0209676_1000687 3300025292 Bacteria 47664
83 Ga0207426_1000375 3300025302 Bacteria 78261
84 Ga0209257_1017722 3300025304 Bacteria 2788
85 Ga0207713_1005291 3300025735 Bacteria 8118
86 Ga0207713_1033676 3300025735 Bacteria 2235
87 Ga0207713_1034074 3300025735 Bacteria 2216
88 Ga0207682_10016311 3300025893 Bacteria 2897
89 Ga0207680_10158717 3300025903 Bacteria 1514
90 Ga0207695_10169130 3300025913 Bacteria 2112
91 Ga0207652_10102150 3300025921 Bacteria 2533
92 Ga0207646_10094407 3300025922 Bacteria 2679
93 Ga0207659_10003604 3300025926 Bacteria 9323
94 Ga0207659_10123669 3300025926 Bacteria 1986
95 Ga0207706_10077324 3300025933 Bacteria 2926
96 Ga0207706_10080647 3300025933 Bacteria 2861
97 Ga0207670_10007196 3300025936 Bacteria 6200
98 Ga0207669_10069214 3300025937 Bacteria 2207
99 Ga0207691_10025177 3300025940 Bacteria 5588
100 Ga0207691_10057384 3300025940 Bacteria 3544
101 Ga0207711_10185333 3300025941 Bacteria 1894
102 Ga0207689_10025424 3300025942 Bacteria 4963
103 Ga0207651_10002649 3300025960 Bacteria 8560
104 Ga0207658_10016945 3300025986 Bacteria 5016
105 Ga0207658_10043624 3300025986 Bacteria 3261
106 Ga0207677_10001786 3300026023 Bacteria 11355
107 Ga0207703_10005621 3300026035 Bacteria 10064
108 Ga0207678_10053859 3300026067 Bacteria 3466
109 Ga0207702_10108019 3300026078 Bacteria 2468
110 Ga0207641_10006121 3300026088 Bacteria 10183
111 Ga0207676_10002399 3300026095 Bacteria 13365
112 Ga0207676_10099901 3300026095 Bacteria 2403
113 Ga0207683_10003520 3300026121 Bacteria 13656
114 Ga0207683_10010214 3300026121 Bacteria 8007
115 Ga0268264_10060314 3300028381 Bacteria 3179
116 Ga0307515_10214552 3300028794 Bacteria 1759
117 Ga0307513_10171667 3300031456 Bacteria 2045
118 Ga0307509_10000577 3300031507 Bacteria 62808
119 Ga0307509_10029953 3300031507 Bacteria 6026
120 Ga0307408_100137684 3300031548 Bacteria 1912
121 Ga0307408_100193459 3300031548 Bacteria 1641
122 Ga0307508_10002244 3300031616 Bacteria 20612
123 Ga0307514_10072999 3300031649 Bacteria 2567
124 Ga0307413_10077987 3300031824 Bacteria 2112
125 Ga0307410_10083902 3300031852 Bacteria 2245
126 Ga0307406_10098565 3300031901 Bacteria 1985
127 Ga0307412_10137717 3300031911 Bacteria 1783
128 Ga0307409_100079427 3300031995 Bacteria 2644
129 Ga0307510_10000553 3300033180 Bacteria 37544
130 Ga0307510_10042682 3300033180 Bacteria 4939
131 Ga0307510_10193668 3300033180 Bacteria 1577
132 Ga0373954_0001128 3300035118 Bacteria 10710
133 Ga0373954_0013074 3300035118 Bacteria 3696
134 Ga0373955_0046541 3300035172 Bacteria 2345
135 Ga0373955_0285067 3300035172 Bacteria 994
136 Ga0373933_0024051 3300035724 Bacteria 3487
137 Ga0373937_0000547 3300036401 Bacteria 33520
138 Ga0373937_0056659 3300036401 Bacteria 3600
139 Ga0395899_0000102 3300037312 Bacteria 149017
140 Ga0395900_0000067 3300037418 Bacteria 193958
141 Ga0395898_0000214 3300037466 Bacteria 149002
142 Ga0395905_0000060 3300037471 Bacteria 193958
143 Ga0395901_0000063 3300038443 Bacteria 149493
144 Ga0400490_43767 3300038726 Unclassified 2565
145 Ga0436365_0328727 3300039437 Bacteria 1781
146 Ga0439438_011710 3300041405 Bacteria 2719
147 Ga0439466_0029926 3300041411 Bacteria 1870
148 Ga0451853_0705802 3300041512 Bacteria 1510
149 Ga0450902_003592 3300042137 Bacteria 2277
150 Ga0453684_0001291 3300044712 Bacteria 74478
151 Ga0453684_0001296 3300044712 Bacteria 74312
152 Ga0453684_0042030 3300044712 Bacteria 6169
153 Ga0495627_001349 3300046453 Bacteria 14783
154 Ga0495627_012894 3300046453 Bacteria 2951
155 Ga0495592_0003027 3300046454 Bacteria 11967
156 Ga0495590_0001323 3300046457 Bacteria 10774
157 Ga0495590_0006496 3300046457 Bacteria 4562
158 Ga0495591_000021 3300046458 Bacteria 203554
159 Ga0495638_0000240 3300046460 Bacteria 75170
160 Ga0495638_0003112 3300046460 Bacteria 13149
161 Ga0495638_0007327 3300046460 Bacteria 7924
162 Ga0495650_0000876 3300046471 Bacteria 35723
163 Ga0495605_0048756 3300046474 Bacteria 2072
164 Ga0495584_0008750 3300046491 Bacteria 5235
165 Ga0495584_0018971 3300046491 Bacteria 3494
166 Ga0495584_0024990 3300046491 Bacteria 3028
167 Ga0495585_0004725 3300046492 Bacteria 8772
168 Ga0495596_0000012 3300046500 Bacteria 125996
169 Ga0495607_0002386 3300046501 Bacteria 15314
170 Ga0495607_0004180 3300046501 Bacteria 10725
171 Ga0495607_0094108 3300046501 Bacteria 1617
172 Ga0495606_0004185 3300046507 Bacteria 14617
173 Ga0495610_0027472 3300046512 Bacteria 3023
174 Ga0495616_0012792 3300046513 Bacteria 4749
175 Ga0495616_0026738 3300046513 Bacteria 3066
176 Ga0495616_0111807 3300046513 Bacteria 1268
177 Ga0495620_0002765 3300046515 Bacteria 10102
178 Ga0495620_0079627 3300046515 Bacteria 1327
179 Ga0495632_0000643 3300046519 Bacteria 32025
180 Ga0495632_0002445 3300046519 Bacteria 14134
181 Ga0495632_0003029 3300046519 Bacteria 12254
182 Ga0495632_0031136 3300046519 Bacteria 2761
183 Ga0495637_0000373 3300046520 Bacteria 33702
184 Ga0495637_0004649 3300046520 Bacteria 7091
185 Ga0495644_0000094 3300046523 Bacteria 43486
186 Ga0495644_0000344 3300046523 Bacteria 21115
187 Ga0495648_0033698 3300046524 Bacteria 3342
188 Ga0495648_0166528 3300046524 Bacteria 1134
189 Ga0495654_0041236 3300046530 Bacteria 2296
190 Ga0495654_0063232 3300046530 Bacteria 1772
191 Ga0495654_0100056 3300046530 Bacteria 1335
192 Ga0495597_0010060 3300046542 Bacteria 4640
193 Ga0495597_0010780 3300046542 Bacteria 4453
194 Ga0495656_0024272 3300046615 Bacteria 2393
195 Ga0495656_0123609 3300046615 Bacteria 1224
196 Ga0495668_0000176 3300046616 Bacteria 95098
197 Ga0495611_0001887 3300046648 Bacteria 9967
198 Ga0495625_0002207 3300046660 Bacteria 21532
199 Ga0495625_0008922 3300046660 Bacteria 8474
200 Ga0495661_0033845 3300046665 Bacteria 3220
201 Ga0495661_0053961 3300046665 Bacteria 2415
202 Ga0495670_0013804 3300046691 Bacteria 3972
203 Ga0495671_0006885 3300046692 Bacteria 6522
204 Ga0495671_0086505 3300046692 Bacteria 1535
205 Ga0495649_0000703 3300046694 Bacteria 27310
206 Ga0495649_0000800 3300046694 Bacteria 25336
207 Ga0495649_0001168 3300046694 Bacteria 20405
208 Ga0495589_0001300 3300046794 Bacteria 14709
209 Ga0495589_0020200 3300046794 Bacteria 3408
210 Ga0495660_0023630 3300046810 Bacteria 3506
211 Ga0495660_0038721 3300046810 Bacteria 2649
212 Ga0495672_0000185 3300047320 Bacteria 90160
213 Ga0495672_0000218 3300047320 Bacteria 81743
214 Ga0495672_0008719 3300047320 Bacteria 7436
215 Ga0495672_0025695 3300047320 Bacteria 3764
216 Ga0495680_0005545 3300047322 Bacteria 11847
217 Ga0495680_0096035 3300047322 Bacteria 2215
218 Ga0495683_0001692 3300047323 Bacteria 14022
219 Ga0495683_0002680 3300047323 Bacteria 10617
220 Ga0495683_0006503 3300047323 Bacteria 6383
221 Ga0495687_001857 3300047443 Bacteria 18408
222 Ga0495677_0062118 3300047445 Bacteria 1386
223 Ga0495673_0000422 3300047469 Bacteria 48075
224 Ga0495673_0001526 3300047469 Bacteria 18247
225 Ga0495673_0009150 3300047469 Bacteria 5498
226 Ga0495673_0009445 3300047469 Bacteria 5399
227 Ga0495681_0000156 3300047470 Bacteria 57235
228 Ga0495681_0001093 3300047470 Bacteria 20580
229 Ga0495684_0190395 3300047471 Bacteria 1517
230 Ga0495686_0000137 3300047472 Bacteria 148290
231 Ga0495686_0043383 3300047472 Bacteria 2851
232 Ga0495626_0000143 3300048091 Bacteria 90432
233 Ga0496104_0114449 3300048907 Bacteria 2587
234 Ga0496104_0127753 3300048907 Bacteria 2441
235 Ga0496105_0044158 3300048908 Bacteria 3675
236 Ga0496106_0378849 3300048909 Bacteria 1137
237 Ga0496110_0028251 3300048913 Bacteria 4816
238 Ga0496110_0040852 3300048913 Bacteria 4044
239 Ga0496114_0000715 3300048917 Bacteria 24708
240 Ga0496114_0002426 3300048917 Bacteria 14224
241 Ga0496114_0099693 3300048917 Bacteria 2478
242 Ga0496122_0115074 3300048925 Bacteria 1753
243 Ga0496123_0035424 3300048926 Bacteria 3556
244 Ga0496124_0001034 3300048927 Bacteria 44037
245 Ga0496124_0003876 3300048927 Bacteria 17886
246 Ga0496125_0002114 3300048928 Bacteria 26692
247 Ga0496125_0150867 3300048928 Bacteria 1596
248 Ga0496126_0010258 3300048929 Bacteria 9844
249 Ga0495678_000712 3300049459 Bacteria 30241
250 Ga0495678_003307 3300049459 Bacteria 10062
251 nmdc:mga0k408_11762_c1 3300050493 Bacteria 4775
252 nmdc:mga0k408_2250_c1 3300050493 Bacteria 10305
253 nmdc:mga0k408_49088_c1 3300050493 Bacteria 2443
254 nmdc:mga06z11_7164_c1 3300050494 Unclassified 4578
255 nmdc:mga07m45_6164_c1 3300050496 Bacteria 6048
256 nmdc:mga07m45_66728_c1 3300050496 Bacteria 2044
257 nmdc:mga0qj67_339181_c1 3300050509 Unclassified 1216
258 nmdc:mga06r32_234230_c1 3300050510 Unclassified 1824
259 nmdc:mga08x19_59751_c1 3300050514 Bacteria 2468
260 Ga0495619_0095608 3300053085 Bacteria 2016
261 Ga0500644_0002040 3300053088 Bacteria 5127
262 Ga0500651_0116942 3300053093 Unclassified 1622
263 Ga0500621_074804 3300053126 Bacteria 1363
264 Ga0500658_0000910 3300053134 Bacteria 12105
265 Ga0500559_0000014 3300053136 Bacteria 160139
266 Ga0500564_104329 3300053138 Bacteria 1250
267 Ga0500577_0025039 3300053142 Bacteria 2014
268 Ga0500622_0009597 3300053156 Bacteria 5348
269 Ga0500636_0054139 3300053177 Bacteria 2353
270 Ga0500637_0018204 3300053178 Bacteria 3771
271 Ga0500587_001479 3300053739 Bacteria 3325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100242112 Ga0075431_1002421122 289
2 3300050509 nmdc:mga0qj67_339181_c1 nmdc:mga0qj67_339181_c1_18_965 289
3 3300003322 rootL2_10211767 rootL2_102117672 291
4 3300053142 Ga0500577_0025039 Ga0500577_0025039_290_1291 292
5 3300035172 Ga0373955_0285067 Ga0373955_0285067_76_984 294
6 3300047469 Ga0495673_0009150 Ga0495673_0009150_24_920 298
7 3300013105 Ga0157369_10232145 Ga0157369_102321452 301
8 3300050496 nmdc:mga07m45_66728_c1 nmdc:mga07m45_66728_c1_219_1211 306
9 3300050510 nmdc:mga06r32_234230_c1 nmdc:mga06r32_234230_c1_657_1676 309
10 3300025735 Ga0207713_1033676 Ga0207713_10336762 310
11 3300048917 Ga0496114_0002426 Ga0496114_0002426_10071_11003 310
12 3300005436 Ga0070713_100460113 Ga0070713_1004601131 314
13 iso_pu_bacteria 2513237094 2513644090 315
14 3300033180 Ga0307510_10000553 Ga0307510_1000055322 316
15 3300033180 Ga0307510_10042682 Ga0307510_100426824 316
16 3300046512 Ga0495610_0027472 Ga0495610_0027472_747_1739 316
17 3300053088 Ga0500644_0002040 Ga0500644_0002040_1982_2974 316
18 3300053126 Ga0500621_074804 Ga0500621_074804_217_1209 316
19 3300053136 Ga0500559_0000014 Ga0500559_0000014_106584_107576 316
20 3300053156 Ga0500622_0009597 Ga0500622_0009597_1901_2893 316
21 3300053177 Ga0500636_0054139 Ga0500636_0054139_778_1770 316
22 3300053739 Ga0500587_001479 Ga0500587_001479_1661_2653 316
23 3300006353 Ga0075370_10010209 Ga0075370_100102092 318
24 3300050493 nmdc:mga0k408_49088_c1 nmdc:mga0k408_49088_c1_1300_2256 318
25 3300050496 nmdc:mga07m45_6164_c1 nmdc:mga07m45_6164_c1_1664_2620 318
26 3300005262 Ga0065165_1004419 Ga0065165_10044192 319
27 3300005468 Ga0070707_100166672 Ga0070707_1001666722 319
28 3300025302 Ga0207426_1000375 Ga0207426_100037533 319
29 3300025922 Ga0207646_10094407 Ga0207646_100944072 319
30 3300025941 Ga0207711_10185333 Ga0207711_101853332 319
31 3300031507 Ga0307509_10000577 Ga0307509_1000057731 319
32 3300031649 Ga0307514_10072999 Ga0307514_100729993 319
33 3300041512 Ga0451853_0705802 Ga0451853_0705802_463_1488 319
34 3300044712 Ga0453684_0042030 Ga0453684_0042030_1766_2776 319
35 3300046454 Ga0495592_0003027 Ga0495592_0003027_2785_3777 319
36 3300053138 Ga0500564_104329 Ga0500564_104329_89_1081 319
37 3300031901 Ga0307406_10098565 Ga0307406_100985653 320
38 3300046507 Ga0495606_0004185 Ga0495606_0004185_7393_8412 320
39 3300046524 Ga0495648_0166528 Ga0495648_0166528_153_1115 320
40 3300047472 Ga0495686_0000137 Ga0495686_0000137_135246_136265 320
41 3300003659 JGI25404J52841_10000095 JGI25404J52841_100000952 321
42 3300005983 Ga0081540_1000161 Ga0081540_10001618 321
43 iso_pu_bacteria 2511231018 2511340871 321
44 iso_pu_bacteria 2511231024 2511377873 321
45 iso_pu_bacteria 2765235841 2765584200 321
46 iso_pu_bacteria 3007803356 3007808440 321
47 iso_pu_bacteria 3007872151 3007877111 321
48 iso_pu_bacteria 8056137416 8056140247 321
49 3300005614 Ga0068856_100071263 Ga0068856_1000712633 322
50 3300026078 Ga0207702_10108019 Ga0207702_101080193 322
51 3300035118 Ga0373954_0013074 Ga0373954_0013074_2571_3563 322
52 3300036401 Ga0373937_0056659 Ga0373937_0056659_132_1124 322
53 3300044712 Ga0453684_0001291 Ga0453684_0001291_17738_18763 322
54 3300044712 Ga0453684_0001296 Ga0453684_0001296_29686_30675 322
55 3300006177 Ga0075362_10047694 Ga0075362_100476941 323
56 3300006178 Ga0075367_10145588 Ga0075367_101455882 323
57 3300006195 Ga0075366_10004642 Ga0075366_100046422 323
58 3300006195 Ga0075366_10048385 Ga0075366_100483852 323
59 3300006353 Ga0075370_10004219 Ga0075370_100042196 323
60 3300035118 Ga0373954_0001128 Ga0373954_0001128_471_1502 323
61 3300035172 Ga0373955_0046541 Ga0373955_0046541_410_1441 323
62 3300035724 Ga0373933_0024051 Ga0373933_0024051_1885_2916 323
63 3300036401 Ga0373937_0000547 Ga0373937_0000547_10239_11270 323
64 3300041405 Ga0439438_011710 Ga0439438_011710_35_1006 323
65 3300041411 Ga0439466_0029926 Ga0439466_0029926_299_1270 323
66 3300046519 Ga0495632_0002445 Ga0495632_0002445_12621_13616 323
67 3300046694 Ga0495649_0000800 Ga0495649_0000800_12309_13304 323
68 3300047322 Ga0495680_0096035 Ga0495680_0096035_398_1429 323
69 3300047443 Ga0495687_001857 Ga0495687_001857_11783_12778 323
70 3300047471 Ga0495684_0190395 Ga0495684_0190395_237_1229 323
71 3300050493 nmdc:mga0k408_11762_c1 nmdc:mga0k408_11762_c1_885_1880 323
72 3300050493 nmdc:mga0k408_2250_c1 nmdc:mga0k408_2250_c1_4697_5692 323
73 3300050494 nmdc:mga06z11_7164_c1 nmdc:mga06z11_7164_c1_258_1253 323
74 3300053085 Ga0495619_0095608 Ga0495619_0095608_897_1928 323
75 3300053093 Ga0500651_0116942 Ga0500651_0116942_149_1144 323
76 3300053134 Ga0500658_0000910 Ga0500658_0000910_1053_2048 323
77 3300009093 Ga0105240_10259249 Ga0105240_102592491 324
78 3300009177 Ga0105248_10147190 Ga0105248_101471902 324
79 3300025304 Ga0209257_1017722 Ga0209257_10177222 324
80 3300025913 Ga0207695_10169130 Ga0207695_101691302 324
81 3300038726 Ga0400490_43767 Ga0400490_43767_156_1202 324
82 iso_pu_bacteria 2511231021 2511357943 324
83 3300005331 Ga0070670_100042577 Ga0070670_1000425772 325
84 3300005335 Ga0070666_10063148 Ga0070666_100631482 325
85 3300005354 Ga0070675_100243479 Ga0070675_1002434792 325
86 3300005436 Ga0070713_100245321 Ga0070713_1002453212 325
87 3300005456 Ga0070678_100294010 Ga0070678_1002940102 325
88 3300005530 Ga0070679_100122242 Ga0070679_1001222422 325
89 3300005985 Ga0081539_10056594 Ga0081539_100565942 325
90 3300009011 Ga0105251_10011993 Ga0105251_100119935 325
91 3300009551 Ga0105238_10075730 Ga0105238_100757302 325
92 3300013297 Ga0157378_10277223 Ga0157378_102772232 325
93 3300013308 Ga0157375_10179816 Ga0157375_101798162 325
94 3300025292 Ga0209676_1000687 Ga0209676_10006879 325
95 3300025735 Ga0207713_1034074 Ga0207713_10340742 325
96 3300025903 Ga0207680_10158717 Ga0207680_101587171 325
97 3300025921 Ga0207652_10102150 Ga0207652_101021502 325
98 3300025926 Ga0207659_10123669 Ga0207659_101236691 325
99 3300028794 Ga0307515_10214552 Ga0307515_102145522 325
100 3300031548 Ga0307408_100137684 Ga0307408_1001376842 325
101 3300031548 Ga0307408_100193459 Ga0307408_1001934592 325
102 3300031824 Ga0307413_10077987 Ga0307413_100779872 325
103 3300031852 Ga0307410_10083902 Ga0307410_100839022 325
104 3300031911 Ga0307412_10137717 Ga0307412_101377172 325
105 3300031995 Ga0307409_100079427 Ga0307409_1000794272 325
106 3300037312 Ga0395899_0000102 Ga0395899_0000102_66202_67191 325
107 3300037418 Ga0395900_0000067 Ga0395900_0000067_81827_82816 325
108 3300037466 Ga0395898_0000214 Ga0395898_0000214_81801_82790 325
109 3300037471 Ga0395905_0000060 Ga0395905_0000060_111143_112132 325
110 3300038443 Ga0395901_0000063 Ga0395901_0000063_66678_67667 325
111 3300039437 Ga0436365_0328727 Ga0436365_0328727_533_1555 325
112 3300047469 Ga0495673_0000422 Ga0495673_0000422_31900_32877 325
113 3300048913 Ga0496110_0040852 Ga0496110_0040852_2351_3328 325
114 3300048917 Ga0496114_0000715 Ga0496114_0000715_18554_19561 325
115 3300048925 Ga0496122_0115074 Ga0496122_0115074_634_1611 325
116 3300048926 Ga0496123_0035424 Ga0496123_0035424_959_1936 325
117 3300048927 Ga0496124_0001034 Ga0496124_0001034_27121_28098 325
118 3300048928 Ga0496125_0002114 Ga0496125_0002114_11832_12809 325
119 3300048928 Ga0496125_0150867 Ga0496125_0150867_367_1344 325
120 3300048929 Ga0496126_0010258 Ga0496126_0010258_6539_7516 325
121 3300053178 Ga0500637_0018204 Ga0500637_0018204_419_1417 325
122 3300005328 Ga0070676_10007548 Ga0070676_100075483 326
123 3300005333 Ga0070677_10003540 Ga0070677_100035403 326
124 3300005333 Ga0070677_10016380 Ga0070677_100163803 326
125 3300005334 Ga0068869_100047023 Ga0068869_1000470233 326
126 3300005335 Ga0070666_10003905 Ga0070666_100039052 326
127 3300005338 Ga0068868_100003639 Ga0068868_1000036395 326
128 3300005340 Ga0070689_100018544 Ga0070689_1000185443 326
129 3300005347 Ga0070668_100152710 Ga0070668_1001527103 326
130 3300005354 Ga0070675_100002339 Ga0070675_10000233912 326
131 3300005355 Ga0070671_100034240 Ga0070671_1000342402 326
132 3300005356 Ga0070674_100110228 Ga0070674_1001102282 326
133 3300005364 Ga0070673_100003811 Ga0070673_1000038116 326
134 3300005365 Ga0070688_100051403 Ga0070688_1000514032 326
135 3300005367 Ga0070667_100128681 Ga0070667_1001286813 326
136 3300005455 Ga0070663_100085446 Ga0070663_1000854462 326
137 3300005456 Ga0070678_100010211 Ga0070678_1000102115 326
138 3300005457 Ga0070662_100020259 Ga0070662_1000202593 326
139 3300005459 Ga0068867_100051111 Ga0068867_1000511113 326
140 3300005459 Ga0068867_100097871 Ga0068867_1000978712 326
141 3300005466 Ga0070685_10096796 Ga0070685_100967962 326
142 3300005543 Ga0070672_100036071 Ga0070672_1000360712 326
143 3300005543 Ga0070672_100130130 Ga0070672_1001301302 326
144 3300005543 Ga0070672_100156512 Ga0070672_1001565122 326
145 3300005544 Ga0070686_100047228 Ga0070686_1000472283 326
146 3300005564 Ga0070664_100017719 Ga0070664_1000177192 326
147 3300005616 Ga0068852_100106213 Ga0068852_1001062132 326
148 3300005617 Ga0068859_100008226 Ga0068859_1000082266 326
149 3300005618 Ga0068864_100000949 Ga0068864_10000094915 326
150 3300005719 Ga0068861_100053436 Ga0068861_1000534363 326
151 3300005841 Ga0068863_100076356 Ga0068863_1000763562 326
152 3300005842 Ga0068858_100013857 Ga0068858_1000138575 326
153 3300005843 Ga0068860_100033781 Ga0068860_1000337813 326
154 3300006058 Ga0075432_10000429 Ga0075432_100004298 326
155 3300006195 Ga0075366_10126700 Ga0075366_101267002 326
156 3300006358 Ga0068871_100017380 Ga0068871_1000173803 326
157 3300006931 Ga0097620_100008226 Ga0097620_1000082266 326
158 3300009011 Ga0105251_10000570 Ga0105251_1000057013 326
159 3300009177 Ga0105248_10010704 Ga0105248_100107047 326
160 3300013105 Ga0157369_10115272 Ga0157369_101152724 326
161 3300013296 Ga0157374_10028232 Ga0157374_100282325 326
162 3300013297 Ga0157378_10330946 Ga0157378_103309462 326
163 3300013306 Ga0163162_10004952 Ga0163162_100049527 326
164 3300013308 Ga0157375_10017160 Ga0157375_100171606 326
165 3300014325 Ga0163163_10011344 Ga0163163_100113444 326
166 3300014326 Ga0157380_10187819 Ga0157380_101878192 326
167 3300014745 Ga0157377_10247251 Ga0157377_102472512 326
168 3300014968 Ga0157379_10002482 Ga0157379_100024828 326
169 3300014969 Ga0157376_10040413 Ga0157376_100404135 326
170 3300025735 Ga0207713_1005291 Ga0207713_10052915 326
171 3300025893 Ga0207682_10016311 Ga0207682_100163114 326
172 3300025926 Ga0207659_10003604 Ga0207659_100036045 326
173 3300025933 Ga0207706_10077324 Ga0207706_100773242 326
174 3300025933 Ga0207706_10080647 Ga0207706_100806472 326
175 3300025936 Ga0207670_10007196 Ga0207670_100071964 326
176 3300025937 Ga0207669_10069214 Ga0207669_100692142 326
177 3300025940 Ga0207691_10025177 Ga0207691_100251774 326
178 3300025940 Ga0207691_10057384 Ga0207691_100573843 326
179 3300025942 Ga0207689_10025424 Ga0207689_100254244 326
180 3300025960 Ga0207651_10002649 Ga0207651_100026495 326
181 3300025986 Ga0207658_10016945 Ga0207658_100169452 326
182 3300025986 Ga0207658_10043624 Ga0207658_100436243 326
183 3300026023 Ga0207677_10001786 Ga0207677_100017864 326
184 3300026035 Ga0207703_10005621 Ga0207703_100056216 326
185 3300026067 Ga0207678_10053859 Ga0207678_100538593 326
186 3300026088 Ga0207641_10006121 Ga0207641_100061214 326
187 3300026095 Ga0207676_10002399 Ga0207676_100023995 326
188 3300026095 Ga0207676_10099901 Ga0207676_100999012 326
189 3300026121 Ga0207683_10003520 Ga0207683_100035209 326
190 3300026121 Ga0207683_10010214 Ga0207683_100102146 326
191 3300028381 Ga0268264_10060314 Ga0268264_100603141 326
192 3300031456 Ga0307513_10171667 Ga0307513_101716672 326
193 3300031507 Ga0307509_10029953 Ga0307509_100299534 326
194 3300031616 Ga0307508_10002244 Ga0307508_100022444 326
195 3300033180 Ga0307510_10193668 Ga0307510_101936682 326
196 3300042137 Ga0450902_003592 Ga0450902_003592_164_1147 326
197 3300046453 Ga0495627_001349 Ga0495627_001349_10863_11849 326
198 3300046453 Ga0495627_012894 Ga0495627_012894_1085_2071 326
199 3300046457 Ga0495590_0001323 Ga0495590_0001323_384_1376 326
200 3300046457 Ga0495590_0006496 Ga0495590_0006496_1182_2168 326
201 3300046458 Ga0495591_000021 Ga0495591_000021_38797_39783 326
202 3300046460 Ga0495638_0000240 Ga0495638_0000240_12648_13640 326
203 3300046460 Ga0495638_0003112 Ga0495638_0003112_11082_12065 326
204 3300046460 Ga0495638_0007327 Ga0495638_0007327_6070_7056 326
205 3300046471 Ga0495650_0000876 Ga0495650_0000876_9096_10082 326
206 3300046474 Ga0495605_0048756 Ga0495605_0048756_202_1188 326
207 3300046491 Ga0495584_0008750 Ga0495584_0008750_3646_4638 326
208 3300046491 Ga0495584_0018971 Ga0495584_0018971_2063_3055 326
209 3300046491 Ga0495584_0024990 Ga0495584_0024990_1933_2919 326
210 3300046492 Ga0495585_0004725 Ga0495585_0004725_5035_6021 326
211 3300046500 Ga0495596_0000012 Ga0495596_0000012_43023_44009 326
212 3300046501 Ga0495607_0002386 Ga0495607_0002386_12076_13062 326
213 3300046501 Ga0495607_0004180 Ga0495607_0004180_5963_6949 326
214 3300046501 Ga0495607_0094108 Ga0495607_0094108_58_1044 326
215 3300046513 Ga0495616_0012792 Ga0495616_0012792_3674_4666 326
216 3300046513 Ga0495616_0026738 Ga0495616_0026738_1121_2107 326
217 3300046513 Ga0495616_0111807 Ga0495616_0111807_84_1076 326
218 3300046515 Ga0495620_0002765 Ga0495620_0002765_2121_3107 326
219 3300046515 Ga0495620_0079627 Ga0495620_0079627_119_1111 326
220 3300046519 Ga0495632_0000643 Ga0495632_0000643_20752_21738 326
221 3300046519 Ga0495632_0003029 Ga0495632_0003029_7375_8367 326
222 3300046519 Ga0495632_0031136 Ga0495632_0031136_523_1509 326
223 3300046520 Ga0495637_0000373 Ga0495637_0000373_10737_11723 326
224 3300046520 Ga0495637_0004649 Ga0495637_0004649_2037_3023 326
225 3300046523 Ga0495644_0000094 Ga0495644_0000094_22254_23240 326
226 3300046523 Ga0495644_0000344 Ga0495644_0000344_10876_11862 326
227 3300046524 Ga0495648_0033698 Ga0495648_0033698_755_1741 326
228 3300046530 Ga0495654_0041236 Ga0495654_0041236_869_1855 326
229 3300046530 Ga0495654_0063232 Ga0495654_0063232_278_1270 326
230 3300046530 Ga0495654_0100056 Ga0495654_0100056_278_1270 326
231 3300046542 Ga0495597_0010060 Ga0495597_0010060_924_1910 326
232 3300046542 Ga0495597_0010780 Ga0495597_0010780_2374_3360 326
233 3300046615 Ga0495656_0024272 Ga0495656_0024272_350_1336 326
234 3300046615 Ga0495656_0123609 Ga0495656_0123609_209_1192 326
235 3300046616 Ga0495668_0000176 Ga0495668_0000176_73585_74571 326
236 3300046648 Ga0495611_0001887 Ga0495611_0001887_8546_9538 326
237 3300046660 Ga0495625_0002207 Ga0495625_0002207_8499_9485 326
238 3300046660 Ga0495625_0008922 Ga0495625_0008922_5934_6920 326
239 3300046665 Ga0495661_0033845 Ga0495661_0033845_2125_3111 326
240 3300046665 Ga0495661_0053961 Ga0495661_0053961_316_1302 326
241 3300046691 Ga0495670_0013804 Ga0495670_0013804_1011_1997 326
242 3300046692 Ga0495671_0006885 Ga0495671_0006885_3674_4666 326
243 3300046692 Ga0495671_0086505 Ga0495671_0086505_421_1407 326
244 3300046694 Ga0495649_0000703 Ga0495649_0000703_12404_13396 326
245 3300046694 Ga0495649_0001168 Ga0495649_0001168_11255_12238 326
246 3300046794 Ga0495589_0001300 Ga0495589_0001300_12118_13104 326
247 3300046794 Ga0495589_0020200 Ga0495589_0020200_1006_1992 326
248 3300046810 Ga0495660_0023630 Ga0495660_0023630_2311_3303 326
249 3300046810 Ga0495660_0038721 Ga0495660_0038721_442_1428 326
250 3300047320 Ga0495672_0000185 Ga0495672_0000185_68413_69405 326
251 3300047320 Ga0495672_0000218 Ga0495672_0000218_61568_62560 326
252 3300047320 Ga0495672_0008719 Ga0495672_0008719_5102_6085 326
253 3300047320 Ga0495672_0025695 Ga0495672_0025695_1094_2080 326
254 3300047322 Ga0495680_0005545 Ga0495680_0005545_9356_10348 326
255 3300047323 Ga0495683_0001692 Ga0495683_0001692_2125_3111 326
256 3300047323 Ga0495683_0002680 Ga0495683_0002680_8183_9175 326
257 3300047323 Ga0495683_0006503 Ga0495683_0006503_2552_3538 326
258 3300047445 Ga0495677_0062118 Ga0495677_0062118_138_1130 326
259 3300047469 Ga0495673_0001526 Ga0495673_0001526_3847_4833 326
260 3300047469 Ga0495673_0009445 Ga0495673_0009445_4008_4994 326
261 3300047470 Ga0495681_0000156 Ga0495681_0000156_10984_11970 326
262 3300047470 Ga0495681_0001093 Ga0495681_0001093_9163_10149 326
263 3300047472 Ga0495686_0043383 Ga0495686_0043383_1808_2794 326
264 3300048091 Ga0495626_0000143 Ga0495626_0000143_32490_33476 326
265 3300048907 Ga0496104_0114449 Ga0496104_0114449_1377_2357 326
266 3300048907 Ga0496104_0127753 Ga0496104_0127753_318_1427 326
267 3300048908 Ga0496105_0044158 Ga0496105_0044158_2652_3632 326
268 3300048913 Ga0496110_0028251 Ga0496110_0028251_811_1797 326
269 3300048917 Ga0496114_0099693 Ga0496114_0099693_1433_2413 326
270 3300048927 Ga0496124_0003876 Ga0496124_0003876_1835_2827 326
271 3300049459 Ga0495678_000712 Ga0495678_000712_17888_18871 326
272 3300049459 Ga0495678_003307 Ga0495678_003307_8242_9234 326
273 3300050514 nmdc:mga08x19_59751_c1 nmdc:mga08x19_59751_c1_1248_2234 326
274 3300003316 rootH1_10097732 rootH1_100977322 327
275 3300009177 Ga0105248_10155721 Ga0105248_101557213 327
276 3300013296 Ga0157374_10572619 Ga0157374_105726191 327
277 3300013306 Ga0163162_10176825 Ga0163162_101768252 327
278 3300014968 Ga0157379_10304312 Ga0157379_103043122 327
279 3300048909 Ga0496106_0378849 Ga0496106_0378849_96_1124 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

9

165

0.87

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

89

298

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7931 4 201
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7778 4 201
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7703 4 201
2z86-assembly1.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7522 1 201
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.752 4 201
ID Description Score Start End Superfamily
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8612 4 194 3.90.550.10
af_Q9RQP9_29_257_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8257 3 202 3.90.550.10
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8255 5 208 3.90.550.10
af_P37653_262_483_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.813 4 202 3.90.550.10
af_P9WKW9_5_162_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8083 9 116 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A832H6L3-F1-model_v4 Glycosyltransferase family 2 protein 0.9898 1 216 GO:0016740
AF-A0A349S694-F1-model_v4 Glycosyl transferase 0.9853 5 157 GO:0016740
AF-A0A832H6L3-F1-model_v4 Glycosyltransferase family 2 protein 0.9852 1 216 GO:0016740
AF-A0A060CF16-F1-model_v4 CAZy families GT2 protein 0.9793 34 195
AF-A0A1B9S8Z3-F1-model_v4 Glycosyl transferase 0.9779 4 327 GO:0016020
GO:0016740

Feature Viewer

pLDDT pTM Quality
92.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map