F383014

General Info

Members Datasets Scaffolds Average Seq Length
279 164 558 218

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11042583|Ga0111539_110425832
Length 246
Sequence MDDRIRGLAQTLWDYHHVNHQLARCDAILVLCSHDKTVAKRGAALFLEGWAPLLIFAGGLGAITRHLWHEPEADQFAAIAAGMGVPKERILVENRSTNTGENVQFTKQLLAEKEIDPRSFIVVQKPYMERRSYATFRKLWPEKPVVVTSPRLGMDDYLDRGTHQALSTAEVVSIMVGDLQRIRLYPARGFQIEQDIPADDGIAHTAAEERRPRDQRLRPVTTDEGFERQVDRPEQHPVEDRGDERQ

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
141 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
142 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
143 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
144 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
145 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
148 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
149 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.21
Stem 0
Stem Tuber 0
Unclassified 17.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_11042583 3300009094 Bacteria 951
2 Ga0065714_10064422 3300005288 Bacteria 270668
3 Ga0065704_10091183 3300005289 Unclassified 2728
4 Ga0065704_10159783 3300005289 Bacteria 1363
5 Ga0065712_10167747 3300005290 Bacteria 1262
6 Ga0065715_10001356 3300005293 Archaea 6632
7 Ga0065715_10098294 3300005293 Bacteria 3568
8 Ga0065715_10304825 3300005293 Bacteria 1033
9 Ga0065715_10411676 3300005293 Bacteria 869
10 Ga0065707_10018324 3300005295 Bacteria 1759
11 Ga0065707_10097527 3300005295 Bacteria 3167
12 Ga0065707_10403615 3300005295 Bacteria 849
13 Ga0070690_100037224 3300005330 Archaea 3065
14 Ga0070690_100060668 3300005330 Bacteria 2434
15 Ga0070670_100000174 3300005331 Bacteria 58017
16 Ga0068869_100003390 3300005334 Bacteria 9731
17 Ga0068869_100030610 3300005334 Unclassified 3780
18 Ga0070666_10481209 3300005335 Bacteria 899
19 Ga0070680_100022937 3300005336 Bacteria 4974
20 Ga0070689_100307174 3300005340 Bacteria 1322
21 Ga0070661_100134260 3300005344 Bacteria 1861
22 Ga0070668_100412660 3300005347 Bacteria 1155
23 Ga0070669_100011430 3300005353 Bacteria 6301
24 Ga0070671_100044892 3300005355 Bacteria 3672
25 Ga0070671_100404777 3300005355 Bacteria 1167
26 Ga0070674_100045939 3300005356 Bacteria 2985
27 Ga0070673_100218037 3300005364 Unclassified 1650
28 Ga0070659_100314278 3300005366 Bacteria 1308
29 Ga0070659_100581300 3300005366 Bacteria 961
30 Ga0070667_100031026 3300005367 Bacteria 4456
31 Ga0070701_10136989 3300005438 Unclassified 1396
32 Ga0070705_100401015 3300005440 Bacteria 1016
33 Ga0070700_100106259 3300005441 Bacteria 1858
34 Ga0070681_10224699 3300005458 Bacteria 1792
35 Ga0070681_10422806 3300005458 Unclassified 1244
36 Ga0070681_10665815 3300005458 Bacteria 956
37 Ga0070707_100000334 3300005468 Bacteria 46215
38 Ga0070707_100092702 3300005468 Bacteria 2925
39 Ga0070699_100111085 3300005518 Bacteria 2407
40 Ga0070699_100561335 3300005518 Bacteria 1039
41 Ga0070679_100113266 3300005530 Bacteria 2698
42 Ga0070697_100058537 3300005536 Bacteria 3136
43 Ga0068853_100128344 3300005539 Bacteria 2267
44 Ga0070672_100318076 3300005543 Bacteria 1323
45 Ga0070686_100015633 3300005544 Archaea 4401
46 Ga0070695_100383164 3300005545 Bacteria 1061
47 Ga0070695_100540698 3300005545 Bacteria 907
48 Ga0070696_100033555 3300005546 Bacteria 3527
49 Ga0070696_100039725 3300005546 Bacteria 3249
50 Ga0070696_100090189 3300005546 Unclassified 2181
51 Ga0070665_100257789 3300005548 Bacteria 1745
52 Ga0070704_100053590 3300005549 Bacteria 2851
53 Ga0070704_100107732 3300005549 Bacteria 2114
54 Ga0070704_100192042 3300005549 Unclassified 1642
55 Ga0070704_101074969 3300005549 Bacteria 730
56 Ga0068855_101197071 3300005563 Bacteria 790
57 Ga0070664_100067466 3300005564 Bacteria 3057
58 Ga0070664_100404286 3300005564 Bacteria 1249
59 Ga0070664_100620520 3300005564 Bacteria 1004
60 Ga0068857_100208134 3300005577 Bacteria 1784
61 Ga0068854_100203722 3300005578 Bacteria 1557
62 Ga0070702_100004460 3300005615 Bacteria 6394
63 Ga0070702_100023388 3300005615 Bacteria 3283
64 Ga0070702_100153783 3300005615 Bacteria 1480
65 Ga0068859_100025095 3300005617 Bacteria 5982
66 Ga0068859_100076418 3300005617 Bacteria 3390
67 Ga0068859_100318144 3300005617 Bacteria 1650
68 Ga0068859_100510300 3300005617 Bacteria 1297
69 Ga0068859_100593269 3300005617 Bacteria 1201
70 Ga0068859_100812642 3300005617 Unclassified 1022
71 Ga0068864_100009372 3300005618 Bacteria 8077
72 Ga0068864_100143440 3300005618 Unclassified 2156
73 Ga0068864_100186482 3300005618 Unclassified 1899
74 Ga0068870_10257095 3300005840 Bacteria 1085
75 Ga0068863_100001980 3300005841 Bacteria 20355
76 Ga0068863_100140800 3300005841 Bacteria 2305
77 Ga0068863_100571307 3300005841 Bacteria 1118
78 Ga0068858_100144152 3300005842 Unclassified 2237
79 Ga0068860_100116194 3300005843 Unclassified 2560
80 Ga0068860_100474598 3300005843 Bacteria 1246
81 Ga0068862_100036059 3300005844 Bacteria 4189
82 Ga0068862_100903467 3300005844 Unclassified 868
83 Ga0081455_10037169 3300005937 Bacteria 4328
84 Ga0068871_100313346 3300006358 Bacteria 1380
85 Ga0075428_100004191 3300006844 Bacteria 15875
86 Ga0075428_100016524 3300006844 Bacteria 8149
87 Ga0075428_100219826 3300006844 Bacteria 2051
88 Ga0075430_100004048 3300006846 Bacteria 12372
89 Ga0075430_100078044 3300006846 Bacteria 2776
90 Ga0075431_100002803 3300006847 Bacteria 16885
91 Ga0075431_100115077 3300006847 Bacteria 2776
92 Ga0075431_100162576 3300006847 Unclassified 2295
93 Ga0075431_100458851 3300006847 Bacteria 1269
94 Ga0075433_10039112 3300006852 Bacteria 4100
95 Ga0075433_10059553 3300006852 Bacteria 3341
96 Ga0075433_10578625 3300006852 Bacteria 986
97 Ga0075434_100003838 3300006871 Bacteria 13434
98 Ga0075434_100017599 3300006871 Bacteria 6888
99 Ga0075429_100001043 3300006880 Bacteria 22157
100 Ga0068865_100382898 3300006881 Bacteria 1148
101 Ga0075436_100005121 3300006914 Bacteria 9023
102 Ga0075436_100293017 3300006914 Bacteria 1165
103 Ga0097620_100025098 3300006931 Bacteria 5982
104 Ga0097620_100076416 3300006931 Bacteria 3390
105 Ga0097620_100318130 3300006931 Bacteria 1650
106 Ga0097620_100510296 3300006931 Bacteria 1297
107 Ga0097620_100593258 3300006931 Bacteria 1201
108 Ga0097620_100812612 3300006931 Unclassified 1022
109 Ga0075435_100000001 3300007076 Bacteria 207579
110 Ga0075435_100338529 3300007076 Bacteria 1289
111 Ga0111539_10000118 3300009094 Bacteria 88106
112 Ga0111539_10039970 3300009094 Bacteria 5649
113 Ga0111539_10319476 3300009094 Bacteria 1807
114 Ga0105245_10524366 3300009098 Bacteria 1204
115 Ga0105245_10711001 3300009098 Bacteria 1038
116 Ga0114129_10000324 3300009147 Bacteria 56067
117 Ga0114129_10017554 3300009147 Bacteria 10188
118 Ga0114129_10058466 3300009147 Bacteria 5392
119 Ga0114129_10089654 3300009147 Bacteria 4263
120 Ga0114129_10188610 3300009147 Bacteria 2801
121 Ga0114129_10192988 3300009147 Bacteria 2764
122 Ga0114129_10241496 3300009147 Bacteria 2428
123 Ga0105241_10687418 3300009174 Bacteria 933
124 Ga0105248_10063863 3300009177 Bacteria 4133
125 Ga0105248_10161357 3300009177 Bacteria 2528
126 Ga0105248_10695559 3300009177 Bacteria 1147
127 Ga0105248_10769292 3300009177 Bacteria 1087
128 Ga0105238_10016777 3300009551 Bacteria 7424
129 Ga0105249_10152262 3300009553 Bacteria 2227
130 Ga0157373_10016776 3300013100 Bacteria 5337
131 Ga0157378_10077667 3300013297 Archaea 2993
132 Ga0157378_10135946 3300013297 Bacteria 2279
133 Ga0157378_10490300 3300013297 Bacteria 1226
134 Ga0157378_10541500 3300013297 Bacteria 1168
135 Ga0163162_10009045 3300013306 Bacteria 9683
136 Ga0163163_10000208 3300014325 Bacteria 60820
137 Ga0163163_10021382 3300014325 Bacteria 6105
138 Ga0163163_10070230 3300014325 Unclassified 3488
139 Ga0163163_10131515 3300014325 Bacteria 2543
140 Ga0163163_10151723 3300014325 Unclassified 2360
141 Ga0163163_10318480 3300014325 Unclassified 1609
142 Ga0157380_10575468 3300014326 Unclassified 1110
143 Ga0157379_10028490 3300014968 Bacteria 4967
144 Ga0157379_10076863 3300014968 Bacteria 2989
145 Ga0163161_10027090 3300017792 Archaea 4064
146 Ga0163161_10119274 3300017792 Bacteria 1981
147 Ga0213876_10000275 3300021384 Bacteria 47627
148 Ga0207680_10453035 3300025903 Bacteria 911
149 Ga0207645_10079588 3300025907 Unclassified 2100
150 Ga0207643_10062381 3300025908 Unclassified 2130
151 Ga0207707_10188608 3300025912 Bacteria 1799
152 Ga0207707_10434972 3300025912 Unclassified 1123
153 Ga0207660_10008776 3300025917 Bacteria 6533
154 Ga0207662_10071574 3300025918 Unclassified 2100
155 Ga0207662_10273295 3300025918 Bacteria 1116
156 Ga0207649_10186301 3300025920 Bacteria 1456
157 Ga0207652_10125802 3300025921 Bacteria 2283
158 Ga0207646_10000375 3300025922 Bacteria 59832
159 Ga0207646_10030229 3300025922 Bacteria 4914
160 Ga0207681_10047722 3300025923 Bacteria 2887
161 Ga0207681_10500281 3300025923 Bacteria 995
162 Ga0207694_10001471 3300025924 Bacteria 20135
163 Ga0207650_10000011 3300025925 Bacteria 450115
164 Ga0207644_10213008 3300025931 Unclassified 1528
165 Ga0207690_10409181 3300025932 Bacteria 1083
166 Ga0207706_10127135 3300025933 Bacteria 2241
167 Ga0207706_10432192 3300025933 Unclassified 1140
168 Ga0207686_10304297 3300025934 Bacteria 1185
169 Ga0207709_10009515 3300025935 Bacteria 5347
170 Ga0207670_10056017 3300025936 Bacteria 2667
171 Ga0207669_10074177 3300025937 Bacteria 2150
172 Ga0207669_10082759 3300025937 Bacteria 2061
173 Ga0207691_10081841 3300025940 Unclassified 2901
174 Ga0207691_10421927 3300025940 Unclassified 1137
175 Ga0207711_10013068 3300025941 Bacteria 6897
176 Ga0207711_10105494 3300025941 Bacteria 2499
177 Ga0207689_10016051 3300025942 Bacteria 6340
178 Ga0207689_10017573 3300025942 Bacteria 6045
179 Ga0207667_10778218 3300025949 Bacteria 955
180 Ga0207651_10176450 3300025960 Unclassified 1690
181 Ga0207640_10329406 3300025981 Unclassified 1219
182 Ga0207658_10327102 3300025986 Bacteria 1328
183 Ga0207703_10291611 3300026035 Bacteria 1485
184 Ga0207639_10252577 3300026041 Bacteria 1538
185 Ga0207678_10177773 3300026067 Bacteria 1817
186 Ga0207708_10139459 3300026075 Bacteria 1901
187 Ga0207708_10474638 3300026075 Unclassified 1045
188 Ga0207641_10002002 3300026088 Bacteria 19433
189 Ga0207648_10593171 3300026089 Bacteria 1021
190 Ga0207676_10002182 3300026095 Bacteria 14115
191 Ga0207674_10000169 3300026116 Bacteria 78781
192 Ga0207674_10160481 3300026116 Unclassified 2203
193 Ga0207683_10270247 3300026121 Bacteria 1553
194 Ga0210002_1026712 3300027617 Bacteria 948
195 Ga0207428_10000967 3300027907 Bacteria 31825
196 Ga0207428_10310418 3300027907 Bacteria 1166
197 Ga0268265_10007905 3300028380 Bacteria 7176
198 Ga0268264_10067725 3300028381 Bacteria 3014
199 Ga0268264_10087063 3300028381 Unclassified 2685
200 Ga0268264_10162347 3300028381 Bacteria 2014
201 Ga0268264_10199262 3300028381 Bacteria 1830
202 Ga0307408_100007392 3300031548 Bacteria 7266
203 Ga0307408_100015965 3300031548 Bacteria 5007
204 Ga0307408_100352230 3300031548 Unclassified 1250
205 Ga0265314_10123916 3300031711 Bacteria 1622
206 Ga0307410_10359181 3300031852 Unclassified 1166
207 Ga0307407_10050149 3300031903 Bacteria 2387
208 Ga0307412_10016168 3300031911 Bacteria 4438
209 Ga0307416_100270830 3300032002 Bacteria 1667
210 Ga0307416_101707730 3300032002 Bacteria 734
211 Ga0307414_10439367 3300032004 Bacteria 1142
212 Ga0307411_10023627 3300032005 Bacteria 3646
213 Ga0307411_10047946 3300032005 Bacteria 2765
214 Ga0307415_100343773 3300032126 Bacteria 1253
215 Ga0373961_0179985 3300035241 Unclassified 736
216 Ga0395905_0246832 3300037471 Bacteria 1668
217 Ga0436365_1275248 3300039437 Bacteria 24183
218 Ga0439455_0034755 3300042012 Bacteria 1270
219 Ga0439435_0002503 3300042436 Bacteria 3666
220 Ga0439464_0004118 3300042439 Bacteria 3700
221 Ga0495625_0317813 3300046660 Unclassified 992
222 Ga0495600_0129550 3300046809 Unclassified 1641
223 Ga0496106_0041521 3300048909 Bacteria 3447
224 Ga0496106_0503402 3300048909 Bacteria 973
225 Ga0496107_0244463 3300048910 Unclassified 1335
226 Ga0501298_037462 3300049521 Bacteria 973
227 Ga0501037_0273935 3300049573 Unclassified 1177
228 Ga0501040_0664182 3300049576 Unclassified 753
229 Ga0501072_0069207 3300049588 Unclassified 2787
230 Ga0501074_0593918 3300049590 Bacteria 783
231 Ga0501075_0120229 3300049591 Bacteria 1999
232 Ga0501076_0044724 3300049592 Bacteria 3493
233 Ga0501076_0095964 3300049592 Unclassified 2388
234 Ga0501077_0014188 3300049593 Bacteria 5001
235 Ga0501202_011444 3300049652 Unclassified 1662
236 Ga0501208_008318 3300049655 Unclassified 1396
237 Ga0501216_018444 3300049660 Unclassified 1201
238 Ga0501235_022066 3300049669 Bacteria 1416
239 Ga0501250_003837 3300049680 Unclassified 1465
240 Ga0501259_024919 3300049688 Bacteria 1092
241 Ga0501079_0167576 3300049741 Bacteria 1713
242 Ga0501278_002340 3300049774 Bacteria 1334
243 Ga0501279_013129 3300049775 Bacteria 1132
244 Ga0501283_013165 3300049779 Bacteria 1251
245 Ga0501045_0015621 3300049824 Bacteria 5387
246 nmdc:mga05p37_211935_c1 3300050507 Bacteria 2341
247 nmdc:mga05p37_3009_c1 3300050507 Bacteria 19557
248 nmdc:mga05p37_35901_c1 3300050507 Bacteria 6082
249 nmdc:mga05p37_41748_c1 3300050507 Bacteria 5633
250 nmdc:mga05p37_70307_c1 3300050507 Bacteria 4305
251 nmdc:mga05p37_752810_c1 3300050507 Bacteria 1073
252 nmdc:mga05p37_85_c1 3300050507 Bacteria 83588
253 nmdc:mga09592_259423_c1 3300050508 Bacteria 1507
254 nmdc:mga09592_326948_c1 3300050508 Unclassified 1328
255 nmdc:mga09592_4546_c1 3300050508 Bacteria 11224
256 nmdc:mga0qj67_12014_c1 3300050509 Bacteria 6508
257 nmdc:mga0qj67_5745_c1 3300050509 Bacteria 9080
258 nmdc:mga06r32_4718_c1 3300050510 Bacteria 12256
259 nmdc:mga08y16_131_c1 3300050511 Bacteria 64623
260 nmdc:mga08y16_25336_c1 3300050511 Bacteria 6254
261 nmdc:mga08y16_526811_c1 3300050511 Bacteria 1198
262 nmdc:mga0n895_2962_c1 3300050512 Bacteria 13476
263 nmdc:mga0n895_410912_c1 3300050512 Bacteria 1368
264 nmdc:mga0n895_56350_c1 3300050512 Bacteria 3872
265 nmdc:mga0n895_604658_c1 3300050512 Unclassified 1098
266 nmdc:mga0n895_790287_c1 3300050512 Unclassified 940
267 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
268 nmdc:mga0rr50_325249_c1 3300050513 Bacteria 1290
269 nmdc:mga08x19_275413_c1 3300050514 Bacteria 1165
270 nmdc:mga08x19_3054_c1 3300050514 Bacteria 10064
271 nmdc:mga0a205_318843_c1 3300050515 Bacteria 1425
272 nmdc:mga0a205_47827_c1 3300050515 Bacteria 4128
273 nmdc:mga0a205_52471_c1 3300050515 Bacteria 3935
274 nmdc:mga0a205_552939_c1 3300050515 Bacteria 1006
275 Ga0501084_0018511 3300054114 Bacteria 5798
276 Ga0590071_002491 3300059421 Bacteria 4632
277 Ga0590075_002500 3300059424 Bacteria 4396
278 Ga0590077_001937 3300059426 Bacteria 4565
279 Ga0530510_0204885 3300061734 Unclassified 1466
280 Ga0111539_11042583
281 Ga0065714_10064422
282 Ga0065704_10091183
283 Ga0065704_10159783
284 Ga0065712_10167747
285 Ga0065715_10001356
286 Ga0065715_10098294
287 Ga0065715_10304825
288 Ga0065715_10411676
289 Ga0065707_10018324
290 Ga0065707_10097527
291 Ga0065707_10403615
292 Ga0070690_100037224
293 Ga0070690_100060668
294 Ga0070670_100000174
295 Ga0068869_100003390
296 Ga0068869_100030610
297 Ga0070666_10481209
298 Ga0070680_100022937
299 Ga0070689_100307174
300 Ga0070661_100134260
301 Ga0070668_100412660
302 Ga0070669_100011430
303 Ga0070671_100044892
304 Ga0070671_100404777
305 Ga0070674_100045939
306 Ga0070673_100218037
307 Ga0070659_100314278
308 Ga0070659_100581300
309 Ga0070667_100031026
310 Ga0070701_10136989
311 Ga0070705_100401015
312 Ga0070700_100106259
313 Ga0070681_10224699
314 Ga0070681_10422806
315 Ga0070681_10665815
316 Ga0070707_100000334
317 Ga0070707_100092702
318 Ga0070699_100111085
319 Ga0070699_100561335
320 Ga0070679_100113266
321 Ga0070697_100058537
322 Ga0068853_100128344
323 Ga0070672_100318076
324 Ga0070686_100015633
325 Ga0070695_100383164
326 Ga0070695_100540698
327 Ga0070696_100033555
328 Ga0070696_100039725
329 Ga0070696_100090189
330 Ga0070665_100257789
331 Ga0070704_100053590
332 Ga0070704_100107732
333 Ga0070704_100192042
334 Ga0070704_101074969
335 Ga0068855_101197071
336 Ga0070664_100067466
337 Ga0070664_100404286
338 Ga0070664_100620520
339 Ga0068857_100208134
340 Ga0068854_100203722
341 Ga0070702_100004460
342 Ga0070702_100023388
343 Ga0070702_100153783
344 Ga0068859_100025095
345 Ga0068859_100076418
346 Ga0068859_100318144
347 Ga0068859_100510300
348 Ga0068859_100593269
349 Ga0068859_100812642
350 Ga0068864_100009372
351 Ga0068864_100143440
352 Ga0068864_100186482
353 Ga0068870_10257095
354 Ga0068863_100001980
355 Ga0068863_100140800
356 Ga0068863_100571307
357 Ga0068858_100144152
358 Ga0068860_100116194
359 Ga0068860_100474598
360 Ga0068862_100036059
361 Ga0068862_100903467
362 Ga0081455_10037169
363 Ga0068871_100313346
364 Ga0075428_100004191
365 Ga0075428_100016524
366 Ga0075428_100219826
367 Ga0075430_100004048
368 Ga0075430_100078044
369 Ga0075431_100002803
370 Ga0075431_100115077
371 Ga0075431_100162576
372 Ga0075431_100458851
373 Ga0075433_10039112
374 Ga0075433_10059553
375 Ga0075433_10578625
376 Ga0075434_100003838
377 Ga0075434_100017599
378 Ga0075429_100001043
379 Ga0068865_100382898
380 Ga0075436_100005121
381 Ga0075436_100293017
382 Ga0097620_100025098
383 Ga0097620_100076416
384 Ga0097620_100318130
385 Ga0097620_100510296
386 Ga0097620_100593258
387 Ga0097620_100812612
388 Ga0075435_100000001
389 Ga0075435_100338529
390 Ga0111539_10000118
391 Ga0111539_10039970
392 Ga0111539_10319476
393 Ga0105245_10524366
394 Ga0105245_10711001
395 Ga0114129_10000324
396 Ga0114129_10017554
397 Ga0114129_10058466
398 Ga0114129_10089654
399 Ga0114129_10188610
400 Ga0114129_10192988
401 Ga0114129_10241496
402 Ga0105241_10687418
403 Ga0105248_10063863
404 Ga0105248_10161357
405 Ga0105248_10695559
406 Ga0105248_10769292
407 Ga0105238_10016777
408 Ga0105249_10152262
409 Ga0157373_10016776
410 Ga0157378_10077667
411 Ga0157378_10135946
412 Ga0157378_10490300
413 Ga0157378_10541500
414 Ga0163162_10009045
415 Ga0163163_10000208
416 Ga0163163_10021382
417 Ga0163163_10070230
418 Ga0163163_10131515
419 Ga0163163_10151723
420 Ga0163163_10318480
421 Ga0157380_10575468
422 Ga0157379_10028490
423 Ga0157379_10076863
424 Ga0163161_10027090
425 Ga0163161_10119274
426 Ga0213876_10000275
427 Ga0207680_10453035
428 Ga0207645_10079588
429 Ga0207643_10062381
430 Ga0207707_10188608
431 Ga0207707_10434972
432 Ga0207660_10008776
433 Ga0207662_10071574
434 Ga0207662_10273295
435 Ga0207649_10186301
436 Ga0207652_10125802
437 Ga0207646_10000375
438 Ga0207646_10030229
439 Ga0207681_10047722
440 Ga0207681_10500281
441 Ga0207694_10001471
442 Ga0207650_10000011
443 Ga0207644_10213008
444 Ga0207690_10409181
445 Ga0207706_10127135
446 Ga0207706_10432192
447 Ga0207686_10304297
448 Ga0207709_10009515
449 Ga0207670_10056017
450 Ga0207669_10074177
451 Ga0207669_10082759
452 Ga0207691_10081841
453 Ga0207691_10421927
454 Ga0207711_10013068
455 Ga0207711_10105494
456 Ga0207689_10016051
457 Ga0207689_10017573
458 Ga0207667_10778218
459 Ga0207651_10176450
460 Ga0207640_10329406
461 Ga0207658_10327102
462 Ga0207703_10291611
463 Ga0207639_10252577
464 Ga0207678_10177773
465 Ga0207708_10139459
466 Ga0207708_10474638
467 Ga0207641_10002002
468 Ga0207648_10593171
469 Ga0207676_10002182
470 Ga0207674_10000169
471 Ga0207674_10160481
472 Ga0207683_10270247
473 Ga0210002_1026712
474 Ga0207428_10000967
475 Ga0207428_10310418
476 Ga0268265_10007905
477 Ga0268264_10067725
478 Ga0268264_10087063
479 Ga0268264_10162347
480 Ga0268264_10199262
481 Ga0307408_100007392
482 Ga0307408_100015965
483 Ga0307408_100352230
484 Ga0265314_10123916
485 Ga0307410_10359181
486 Ga0307407_10050149
487 Ga0307412_10016168
488 Ga0307416_100270830
489 Ga0307416_101707730
490 Ga0307414_10439367
491 Ga0307411_10023627
492 Ga0307411_10047946
493 Ga0307415_100343773
494 Ga0373961_0179985
495 Ga0395905_0246832
496 Ga0436365_1275248
497 Ga0439455_0034755
498 Ga0439435_0002503
499 Ga0439464_0004118
500 Ga0495625_0317813
501 Ga0495600_0129550
502 Ga0496106_0041521
503 Ga0496106_0503402
504 Ga0496107_0244463
505 Ga0501298_037462
506 Ga0501037_0273935
507 Ga0501040_0664182
508 Ga0501072_0069207
509 Ga0501074_0593918
510 Ga0501075_0120229
511 Ga0501076_0044724
512 Ga0501076_0095964
513 Ga0501077_0014188
514 Ga0501202_011444
515 Ga0501208_008318
516 Ga0501216_018444
517 Ga0501235_022066
518 Ga0501250_003837
519 Ga0501259_024919
520 Ga0501079_0167576
521 Ga0501278_002340
522 Ga0501279_013129
523 Ga0501283_013165
524 Ga0501045_0015621
525 nmdc:mga05p37_211935_c1
526 nmdc:mga05p37_3009_c1
527 nmdc:mga05p37_35901_c1
528 nmdc:mga05p37_41748_c1
529 nmdc:mga05p37_70307_c1
530 nmdc:mga05p37_752810_c1
531 nmdc:mga05p37_85_c1
532 nmdc:mga09592_259423_c1
533 nmdc:mga09592_326948_c1
534 nmdc:mga09592_4546_c1
535 nmdc:mga0qj67_12014_c1
536 nmdc:mga0qj67_5745_c1
537 nmdc:mga06r32_4718_c1
538 nmdc:mga08y16_131_c1
539 nmdc:mga08y16_25336_c1
540 nmdc:mga08y16_526811_c1
541 nmdc:mga0n895_2962_c1
542 nmdc:mga0n895_410912_c1
543 nmdc:mga0n895_56350_c1
544 nmdc:mga0n895_604658_c1
545 nmdc:mga0n895_790287_c1
546 nmdc:mga0rr50_11_c1
547 nmdc:mga0rr50_325249_c1
548 nmdc:mga08x19_275413_c1
549 nmdc:mga08x19_3054_c1
550 nmdc:mga0a205_318843_c1
551 nmdc:mga0a205_47827_c1
552 nmdc:mga0a205_52471_c1
553 nmdc:mga0a205_552939_c1
554 Ga0501084_0018511
555 Ga0590071_002491
556 Ga0590075_002500
557 Ga0590077_001937
558 Ga0530510_0204885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02698

DUF218

DUF218 domain

26

182

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ca8-assembly2.cif.gz_B crystal structure of escherichia coli ydcf, an s-adenosyl-l-methionine utilizing enzyme 0.8118 2 195
3ca8-assembly2.cif.gz_B crystal structure of escherichia coli ydcf, an s-adenosyl-l-methionine utilizing enzyme 0.7822 2 195
6l1g-assembly2.cif.gz_B crystal structure of light-dependent protochlorophyllide oxidoreductase from synechocystis sp. pcc 6803 0.6788 9 108
6r48-assembly2.cif.gz_B crystal structure of lpor (synechocystis) complexed with nadph at 1.87a resolution. 0.677 8 104
6r48-assembly1.cif.gz_A crystal structure of lpor (synechocystis) complexed with nadph at 1.87a resolution. 0.6766 9 104
ID Description Score Start End Superfamily
af_P34209_28_181_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8455 2 131 3.40.50.620
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8362 2 116 3.40.50.620
af_Q54FL1_98_236_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7969 9 129 3.40.50.620
af_P42598_32_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7678 5 166 3.40.50.620
af_P87055_79_280_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7308 11 146 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W1C0Y2-F1-model_v4 YdcF family protein 1.001 1 141 GO:0005886
AF-A0A6P1TT74-F1-model_v4 YdcF family protein 0.9903 1 201 GO:0005886
AF-A0A354KPC2-F1-model_v4 deleted 0.9879 1 145
AF-A0A4Q3VKQ8-F1-model_v4 YdcF family protein 0.9856 22 201 GO:0005886
AF-A0A6P1TT74-F1-model_v4 YdcF family protein 0.9855 1 201 GO:0005886

Map