F382973

General Info

Members Datasets Scaffolds Average Seq Length
279 163 558 218

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10082609|Ga0075370_100826092
Length 235
Sequence MFRFGASATTTARQTKDAQMISRSRLLVAASIAVALAGCKSRGELVVDDSVGVTAVRSACPAVGIPDYTGDVTIFRTPGDRTAANIDVVAAMTNVRSQCNDTGEKVFSQVTFDVLGRRLDTRGARQVTVPYYVSVLRGGSAVVTKRIGSVTLNFADGQERAQASSQGSAYIDRAEATLPADIRERITRKRKAGDADAAIDPLAEPEVKAAVARATFEVLVGFQLDQDQLAYNATR

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
159 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
160 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
161 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
162 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
163 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.26
Nodule 0.72
Rhizoplane 5.38
Rhizosphere 78.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10082609 3300006353 Bacteria 1848
2 Ga0065704_10073235 3300005289 Bacteria 7408
3 Ga0070658_10000736 3300005327 Bacteria 28080
4 Ga0070658_10037282 3300005327 Bacteria 3918
5 Ga0070658_10127575 3300005327 Bacteria 2118
6 Ga0070658_10259666 3300005327 Bacteria 1475
7 Ga0070658_10386812 3300005327 Bacteria 1200
8 Ga0070690_100016929 3300005330 Bacteria 4375
9 Ga0070666_10028507 3300005335 Bacteria 3664
10 Ga0070680_100010570 3300005336 Bacteria 7121
11 Ga0070682_100037137 3300005337 Bacteria 2980
12 Ga0070682_100082594 3300005337 Bacteria 2083
13 Ga0068868_100791121 3300005338 Bacteria 855
14 Ga0070660_100013611 3300005339 Bacteria 5844
15 Ga0070660_100107913 3300005339 Bacteria 2212
16 Ga0070689_100458137 3300005340 Bacteria 1086
17 Ga0070661_100055937 3300005344 Bacteria 2889
18 Ga0070661_100403833 3300005344 Bacteria 1081
19 Ga0070692_10040042 3300005345 Bacteria 2395
20 Ga0070668_100020723 3300005347 Bacteria 4965
21 Ga0070668_100045962 3300005347 Bacteria 3351
22 Ga0070669_100000889 3300005353 Bacteria 21745
23 Ga0070669_100408706 3300005353 Bacteria 1112
24 Ga0070675_100369350 3300005354 Bacteria 1275
25 Ga0070675_101188342 3300005354 Bacteria 702
26 Ga0070671_100000040 3300005355 Bacteria 92357
27 Ga0070671_100030283 3300005355 Bacteria 4466
28 Ga0070659_100001142 3300005366 Bacteria 19368
29 Ga0070659_100257499 3300005366 Bacteria 1447
30 Ga0070663_100143434 3300005455 Bacteria 1825
31 Ga0070663_100195140 3300005455 Bacteria 1578
32 Ga0070662_100005304 3300005457 Bacteria 8231
33 Ga0070662_100020925 3300005457 Bacteria 4462
34 Ga0070662_100054322 3300005457 Bacteria 2903
35 Ga0070679_100009522 3300005530 Bacteria 9188
36 Ga0070679_100073767 3300005530 Bacteria 3403
37 Ga0070679_100117911 3300005530 Bacteria 2639
38 Ga0070684_100650650 3300005535 Bacteria 981
39 Ga0068853_100015695 3300005539 Bacteria 6222
40 Ga0068853_100294480 3300005539 Bacteria 1499
41 Ga0070665_100031457 3300005548 Bacteria 5341
42 Ga0068855_100009219 3300005563 Bacteria 11922
43 Ga0068855_100018285 3300005563 Bacteria 8418
44 Ga0068855_100046015 3300005563 Bacteria 5159
45 Ga0068855_100094283 3300005563 Bacteria 3452
46 Ga0068855_100465020 3300005563 Bacteria 1379
47 Ga0070664_100105957 3300005564 Bacteria 2449
48 Ga0070664_100307118 3300005564 Bacteria 1435
49 Ga0068857_100084082 3300005577 Bacteria 2844
50 Ga0068857_100124152 3300005577 Bacteria 2326
51 Ga0068857_100285898 3300005577 Bacteria 1518
52 Ga0068857_100318441 3300005577 Bacteria 1436
53 Ga0068857_100482529 3300005577 Bacteria 1162
54 Ga0068854_100002884 3300005578 Bacteria 10694
55 Ga0068854_100027610 3300005578 Bacteria 3914
56 Ga0068854_100415327 3300005578 Bacteria 1116
57 Ga0068856_100643871 3300005614 Bacteria 1081
58 Ga0068852_100000727 3300005616 Bacteria 21589
59 Ga0068852_100144828 3300005616 Bacteria 2203
60 Ga0068852_100154012 3300005616 Bacteria 2140
61 Ga0068852_100581097 3300005616 Bacteria 1123
62 Ga0068852_100656260 3300005616 Bacteria 1057
63 Ga0068859_100009826 3300005617 Bacteria 9661
64 Ga0068851_10180221 3300005834 Bacteria 1170
65 Ga0068863_100081204 3300005841 Bacteria 3071
66 Ga0068858_100013531 3300005842 Bacteria 7699
67 Ga0068858_100027640 3300005842 Bacteria 5269
68 Ga0068860_100120752 3300005843 Bacteria 2509
69 Ga0075365_10011211 3300006038 Bacteria 5263
70 Ga0075368_10004816 3300006042 Bacteria 4599
71 Ga0075363_100009793 3300006048 Bacteria 4516
72 Ga0075432_10014653 3300006058 Bacteria 2669
73 Ga0075362_10014650 3300006177 Bacteria 3169
74 Ga0075367_10013556 3300006178 Bacteria 4386
75 Ga0075369_10031549 3300006186 Bacteria 2238
76 Ga0075366_10010003 3300006195 Bacteria 5314
77 Ga0075366_10196771 3300006195 Bacteria 1225
78 Ga0075370_10007903 3300006353 Bacteria 5443
79 Ga0075370_10024893 3300006353 Bacteria 3309
80 Ga0075370_10042522 3300006353 Bacteria 2567
81 Ga0075370_10136876 3300006353 Bacteria 1431
82 Ga0097620_100009826 3300006931 Bacteria 9661
83 Ga0079104_1009671 3300006946 Bacteria 3248
84 Ga0105240_10028866 3300009093 Bacteria 7236
85 Ga0105241_10282876 3300009174 Bacteria 1417
86 Ga0105248_10011556 3300009177 Bacteria 9727
87 Ga0105248_10255941 3300009177 Bacteria 1971
88 Ga0105246_10006120 3300011119 Bacteria 7341
89 Ga0157373_10024115 3300013100 Bacteria 4409
90 Ga0157371_10013166 3300013102 Bacteria 6297
91 Ga0157371_10038521 3300013102 Bacteria 3420
92 Ga0157371_10345636 3300013102 Bacteria 1082
93 Ga0157371_10478457 3300013102 Bacteria 918
94 Ga0157370_10002125 3300013104 Bacteria 24196
95 Ga0157369_10001309 3300013105 Bacteria 30938
96 Ga0157369_10641948 3300013105 Bacteria 1095
97 Ga0157374_10337562 3300013296 Bacteria 1495
98 Ga0163162_10046071 3300013306 Bacteria 4371
99 Ga0157372_10064070 3300013307 Bacteria 4123
100 Ga0157372_10763223 3300013307 Bacteria 1124
101 Ga0157375_10109478 3300013308 Bacteria 2859
102 Ga0157380_10212943 3300014326 Bacteria 1723
103 Ga0157380_10608596 3300014326 Bacteria 1082
104 Ga0163161_10005639 3300017792 Bacteria 8681
105 Ga0207688_10472230 3300025901 Bacteria 784
106 Ga0207647_10026459 3300025904 Bacteria 3796
107 Ga0207647_10211730 3300025904 Bacteria 1119
108 Ga0207705_10000009 3300025909 Bacteria 576128
109 Ga0207705_10001272 3300025909 Bacteria 20230
110 Ga0207705_10024401 3300025909 Bacteria 4316
111 Ga0207705_10067822 3300025909 Bacteria 2582
112 Ga0207705_10326452 3300025909 Bacteria 1180
113 Ga0207654_10216531 3300025911 Bacteria 1268
114 Ga0207707_10092770 3300025912 Bacteria 2638
115 Ga0207695_10022006 3300025913 Bacteria 7255
116 Ga0207660_10014091 3300025917 Bacteria 5249
117 Ga0207660_10533431 3300025917 Bacteria 954
118 Ga0207657_10000336 3300025919 Bacteria 49702
119 Ga0207657_10119352 3300025919 Bacteria 2170
120 Ga0207657_10119946 3300025919 Bacteria 2164
121 Ga0207657_10133478 3300025919 Bacteria 2033
122 Ga0207649_10019829 3300025920 Bacteria 3848
123 Ga0207652_10017725 3300025921 Bacteria 5832
124 Ga0207652_10622711 3300025921 Bacteria 966
125 Ga0207681_10000396 3300025923 Bacteria 30438
126 Ga0207681_10379992 3300025923 Bacteria 1137
127 Ga0207644_10000005 3300025931 Bacteria 441948
128 Ga0207690_10179755 3300025932 Bacteria 1592
129 Ga0207706_10000700 3300025933 Bacteria 35067
130 Ga0207706_10018684 3300025933 Bacteria 6237
131 Ga0207706_10101235 3300025933 Bacteria 2535
132 Ga0207670_10015639 3300025936 Bacteria 4539
133 Ga0207661_10703641 3300025944 Bacteria 929
134 Ga0207679_10399189 3300025945 Bacteria 1209
135 Ga0207667_10001997 3300025949 Bacteria 25597
136 Ga0207667_10003406 3300025949 Bacteria 19632
137 Ga0207667_10062889 3300025949 Bacteria 3880
138 Ga0207667_10273687 3300025949 Bacteria 1726
139 Ga0207640_10003333 3300025981 Bacteria 8655
140 Ga0207640_10058785 3300025981 Bacteria 2535
141 Ga0207703_10006273 3300026035 Bacteria 9507
142 Ga0207703_10136942 3300026035 Bacteria 2120
143 Ga0207639_10000589 3300026041 Bacteria 25026
144 Ga0207639_10430320 3300026041 Bacteria 1195
145 Ga0207678_10010622 3300026067 Bacteria 8089
146 Ga0207678_10030554 3300026067 Bacteria 4702
147 Ga0207676_10088059 3300026095 Bacteria 2541
148 Ga0207674_10059990 3300026116 Bacteria 3848
149 Ga0207674_10084312 3300026116 Bacteria 3176
150 Ga0207674_10248167 3300026116 Bacteria 1727
151 Ga0207674_10265210 3300026116 Bacteria 1665
152 Ga0207674_10377397 3300026116 Bacteria 1371
153 Ga0207674_10562135 3300026116 Bacteria 1102
154 Ga0207674_10687551 3300026116 Bacteria 988
155 Ga0207698_10000084 3300026142 Bacteria 62453
156 Ga0207698_10091455 3300026142 Bacteria 2491
157 Ga0207698_10122638 3300026142 Bacteria 2203
158 Ga0207698_10207230 3300026142 Bacteria 1761
159 Ga0207698_10546039 3300026142 Bacteria 1135
160 Ga0209281_1015615 3300027111 Bacteria 1578
161 Ga0209813_10000044 3300027866 Bacteria 50649
162 Ga0207428_10532761 3300027907 Bacteria 851
163 Ga0268265_10248901 3300028380 Bacteria 1573
164 Ga0316177_1201258 3300030731 Bacteria 1818
165 Ga0307408_100026149 3300031548 Bacteria 4004
166 Ga0307408_100343523 3300031548 Bacteria 1264
167 Ga0307508_10012526 3300031616 Bacteria 7755
168 Ga0307405_10402127 3300031731 Bacteria 1072
169 Ga0307405_10406339 3300031731 Bacteria 1067
170 Ga0307405_10614248 3300031731 Bacteria 889
171 Ga0307413_10426935 3300031824 Bacteria 1045
172 Ga0307410_10037956 3300031852 Bacteria 3151
173 Ga0307406_10202531 3300031901 Bacteria 1462
174 Ga0307406_10325569 3300031901 Bacteria 1191
175 Ga0307407_10150148 3300031903 Bacteria 1513
176 Ga0307412_10010354 3300031911 Bacteria 5368
177 Ga0307412_10103224 3300031911 Bacteria 2020
178 Ga0307412_10110523 3300031911 Bacteria 1962
179 Ga0307412_10336025 3300031911 Bacteria 1207
180 Ga0307412_10415489 3300031911 Bacteria 1099
181 Ga0307412_10438804 3300031911 Bacteria 1073
182 Ga0307412_10489163 3300031911 Bacteria 1022
183 Ga0307409_100135504 3300031995 Bacteria 2112
184 Ga0307416_100107172 3300032002 Bacteria 2451
185 Ga0307416_100185258 3300032002 Bacteria 1956
186 Ga0307416_100420583 3300032002 Bacteria 1380
187 Ga0307416_100503473 3300032002 Bacteria 1276
188 Ga0307416_101233862 3300032002 Bacteria 853
189 Ga0307414_10038490 3300032004 Bacteria 3212
190 Ga0307414_11070080 3300032004 Bacteria 744
191 Ga0307411_10037412 3300032005 Bacteria 3051
192 Ga0307411_10104829 3300032005 Bacteria 2009
193 Ga0307411_10119757 3300032005 Bacteria 1902
194 Ga0307411_10225933 3300032005 Bacteria 1456
195 Ga0307411_10324852 3300032005 Bacteria 1244
196 Ga0307415_100130229 3300032126 Bacteria 1903
197 Ga0307415_100505718 3300032126 Bacteria 1057
198 Ga0307415_100573838 3300032126 Bacteria 999
199 Ga0316582_0000702 3300036647 Bacteria 13259
200 Ga0316582_0132408 3300036647 Bacteria 1676
201 Ga0316584_0085660 3300036712 Bacteria 2359
202 Ga0451853_3743381 3300041512 Bacteria 1065
203 Ga0450912_000090 3300042116 Bacteria 3063
204 Ga0451577_0146178 3300042876 Bacteria 2126
205 Ga0453684_0038304 3300044712 Bacteria 6558
206 Ga0453684_0220618 3300044712 Bacteria 2197
207 Ga0451576_0037651 3300045051 Bacteria 5124
208 Ga0451576_1307623 3300045051 Bacteria 756
209 Ga0495638_0015657 3300046460 Bacteria 5087
210 Ga0495607_0013450 3300046501 Bacteria 5361
211 Ga0495610_0000104 3300046512 Bacteria 98197
212 Ga0495643_0000023 3300046522 Bacteria 288590
213 Ga0495643_0014875 3300046522 Bacteria 4617
214 Ga0495643_0072657 3300046522 Bacteria 1803
215 Ga0495598_0072701 3300046537 Bacteria 1086
216 Ga0495668_0149232 3300046616 Bacteria 1280
217 Ga0495625_0066788 3300046660 Bacteria 2533
218 Ga0495671_0369219 3300046692 Bacteria 688
219 Ga0495615_0001501 3300048090 Bacteria 3494
220 Ga0496101_0066280 3300048904 Bacteria 2633
221 Ga0496102_0118552 3300048905 Bacteria 2470
222 Ga0496102_0180442 3300048905 Bacteria 1989
223 Ga0496103_0069570 3300048906 Bacteria 2200
224 Ga0496103_0430961 3300048906 Bacteria 846
225 Ga0496105_0038890 3300048908 Bacteria 3919
226 Ga0496106_0001368 3300048909 Bacteria 18276
227 Ga0496107_0057015 3300048910 Bacteria 2823
228 Ga0496108_0210897 3300048911 Bacteria 1686
229 Ga0496109_0133957 3300048912 Bacteria 2314
230 Ga0496111_0041690 3300048914 Bacteria 3294
231 Ga0496111_0433703 3300048914 Bacteria 970
232 Ga0496112_0133462 3300048915 Bacteria 2453
233 Ga0496113_0016765 3300048916 Bacteria 5067
234 Ga0496114_0038426 3300048917 Bacteria 3961
235 Ga0496121_0592934 3300048924 Bacteria 685
236 Ga0496124_0296690 3300048927 Bacteria 1170
237 Ga0496126_0002621 3300048929 Bacteria 23931
238 Ga0501033_0135487 3300049570 Bacteria 1782
239 Ga0501033_0140933 3300049570 Bacteria 1743
240 Ga0501034_0121886 3300049571 Bacteria 2594
241 Ga0501036_0219991 3300049572 Bacteria 1595
242 Ga0501037_0298631 3300049573 Bacteria 1119
243 Ga0501043_0249936 3300049579 Bacteria 1366
244 Ga0501047_0230030 3300049581 Bacteria 1708
245 Ga0501047_0232520 3300049581 Bacteria 1696
246 Ga0501047_0414870 3300049581 Bacteria 1178
247 Ga0501070_0429293 3300049586 Bacteria 1067
248 Ga0501044_0000340 3300049823 Bacteria 59157
249 Ga0501044_0079151 3300049823 Bacteria 3331
250 Ga0501044_0131436 3300049823 Bacteria 2497
251 Ga0501044_0398717 3300049823 Bacteria 1289
252 Ga0501044_0500798 3300049823 Bacteria 1116
253 nmdc:mga03683_1109_c1 3300050489 Bacteria 7881
254 nmdc:mga03683_7209_c1 3300050489 Bacteria 3850
255 nmdc:mga03n38_8859_c1 3300050490 Bacteria 3632
256 nmdc:mga0yw44_27278_c1 3300050492 Bacteria 3270
257 nmdc:mga0k408_2765_c1 3300050493 Bacteria 9329
258 nmdc:mga06z11_494_c1 3300050494 Bacteria 14527
259 nmdc:mga04h51_31_c1 3300050495 Bacteria 48962
260 nmdc:mga07m45_23_c1 3300050496 Bacteria 115627
261 nmdc:mga07m45_687_c2 3300050496 Bacteria 10168
262 nmdc:mga0sz30_8672_c1 3300050516 Bacteria 3846
263 Ga0500643_000004 3300053087 Bacteria 857484
264 Ga0500595_028742 3300053119 Bacteria 1893
265 Ga0500607_000122 3300053121 Bacteria 62944
266 Ga0500607_000828 3300053121 Bacteria 29784
267 Ga0500608_056112 3300053122 Bacteria 1888
268 Ga0500559_0000350 3300053136 Bacteria 34594
269 Ga0500559_0002607 3300053136 Bacteria 9203
270 Ga0500568_0090546 3300053139 Bacteria 1154
271 Ga0500573_0353488 3300053140 Bacteria 713
272 Ga0500616_0003571 3300053153 Bacteria 11771
273 Ga0500622_0000910 3300053156 Bacteria 25133
274 Ga0500637_0029843 3300053178 Bacteria 3028
275 Ga0500645_005802 3300053730 Bacteria 4490
276 2895883156 2895880812 Bacteria 11255272
277 2896254526 2896253425 Bacteria 3418029
278 3000866617 3000865235 Bacteria 3106258
279 8054302793 8054302542 Bacteria 5698134
280 Ga0075370_10082609
281 Ga0065704_10073235
282 Ga0070658_10000736
283 Ga0070658_10037282
284 Ga0070658_10127575
285 Ga0070658_10259666
286 Ga0070658_10386812
287 Ga0070690_100016929
288 Ga0070666_10028507
289 Ga0070680_100010570
290 Ga0070682_100037137
291 Ga0070682_100082594
292 Ga0068868_100791121
293 Ga0070660_100013611
294 Ga0070660_100107913
295 Ga0070689_100458137
296 Ga0070661_100055937
297 Ga0070661_100403833
298 Ga0070692_10040042
299 Ga0070668_100020723
300 Ga0070668_100045962
301 Ga0070669_100000889
302 Ga0070669_100408706
303 Ga0070675_100369350
304 Ga0070675_101188342
305 Ga0070671_100000040
306 Ga0070671_100030283
307 Ga0070659_100001142
308 Ga0070659_100257499
309 Ga0070663_100143434
310 Ga0070663_100195140
311 Ga0070662_100005304
312 Ga0070662_100020925
313 Ga0070662_100054322
314 Ga0070679_100009522
315 Ga0070679_100073767
316 Ga0070679_100117911
317 Ga0070684_100650650
318 Ga0068853_100015695
319 Ga0068853_100294480
320 Ga0070665_100031457
321 Ga0068855_100009219
322 Ga0068855_100018285
323 Ga0068855_100046015
324 Ga0068855_100094283
325 Ga0068855_100465020
326 Ga0070664_100105957
327 Ga0070664_100307118
328 Ga0068857_100084082
329 Ga0068857_100124152
330 Ga0068857_100285898
331 Ga0068857_100318441
332 Ga0068857_100482529
333 Ga0068854_100002884
334 Ga0068854_100027610
335 Ga0068854_100415327
336 Ga0068856_100643871
337 Ga0068852_100000727
338 Ga0068852_100144828
339 Ga0068852_100154012
340 Ga0068852_100581097
341 Ga0068852_100656260
342 Ga0068859_100009826
343 Ga0068851_10180221
344 Ga0068863_100081204
345 Ga0068858_100013531
346 Ga0068858_100027640
347 Ga0068860_100120752
348 Ga0075365_10011211
349 Ga0075368_10004816
350 Ga0075363_100009793
351 Ga0075432_10014653
352 Ga0075362_10014650
353 Ga0075367_10013556
354 Ga0075369_10031549
355 Ga0075366_10010003
356 Ga0075366_10196771
357 Ga0075370_10007903
358 Ga0075370_10024893
359 Ga0075370_10042522
360 Ga0075370_10136876
361 Ga0097620_100009826
362 Ga0079104_1009671
363 Ga0105240_10028866
364 Ga0105241_10282876
365 Ga0105248_10011556
366 Ga0105248_10255941
367 Ga0105246_10006120
368 Ga0157373_10024115
369 Ga0157371_10013166
370 Ga0157371_10038521
371 Ga0157371_10345636
372 Ga0157371_10478457
373 Ga0157370_10002125
374 Ga0157369_10001309
375 Ga0157369_10641948
376 Ga0157374_10337562
377 Ga0163162_10046071
378 Ga0157372_10064070
379 Ga0157372_10763223
380 Ga0157375_10109478
381 Ga0157380_10212943
382 Ga0157380_10608596
383 Ga0163161_10005639
384 Ga0207688_10472230
385 Ga0207647_10026459
386 Ga0207647_10211730
387 Ga0207705_10000009
388 Ga0207705_10001272
389 Ga0207705_10024401
390 Ga0207705_10067822
391 Ga0207705_10326452
392 Ga0207654_10216531
393 Ga0207707_10092770
394 Ga0207695_10022006
395 Ga0207660_10014091
396 Ga0207660_10533431
397 Ga0207657_10000336
398 Ga0207657_10119352
399 Ga0207657_10119946
400 Ga0207657_10133478
401 Ga0207649_10019829
402 Ga0207652_10017725
403 Ga0207652_10622711
404 Ga0207681_10000396
405 Ga0207681_10379992
406 Ga0207644_10000005
407 Ga0207690_10179755
408 Ga0207706_10000700
409 Ga0207706_10018684
410 Ga0207706_10101235
411 Ga0207670_10015639
412 Ga0207661_10703641
413 Ga0207679_10399189
414 Ga0207667_10001997
415 Ga0207667_10003406
416 Ga0207667_10062889
417 Ga0207667_10273687
418 Ga0207640_10003333
419 Ga0207640_10058785
420 Ga0207703_10006273
421 Ga0207703_10136942
422 Ga0207639_10000589
423 Ga0207639_10430320
424 Ga0207678_10010622
425 Ga0207678_10030554
426 Ga0207676_10088059
427 Ga0207674_10059990
428 Ga0207674_10084312
429 Ga0207674_10248167
430 Ga0207674_10265210
431 Ga0207674_10377397
432 Ga0207674_10562135
433 Ga0207674_10687551
434 Ga0207698_10000084
435 Ga0207698_10091455
436 Ga0207698_10122638
437 Ga0207698_10207230
438 Ga0207698_10546039
439 Ga0209281_1015615
440 Ga0209813_10000044
441 Ga0207428_10532761
442 Ga0268265_10248901
443 Ga0316177_1201258
444 Ga0307408_100026149
445 Ga0307408_100343523
446 Ga0307508_10012526
447 Ga0307405_10402127
448 Ga0307405_10406339
449 Ga0307405_10614248
450 Ga0307413_10426935
451 Ga0307410_10037956
452 Ga0307406_10202531
453 Ga0307406_10325569
454 Ga0307407_10150148
455 Ga0307412_10010354
456 Ga0307412_10103224
457 Ga0307412_10110523
458 Ga0307412_10336025
459 Ga0307412_10415489
460 Ga0307412_10438804
461 Ga0307412_10489163
462 Ga0307409_100135504
463 Ga0307416_100107172
464 Ga0307416_100185258
465 Ga0307416_100420583
466 Ga0307416_100503473
467 Ga0307416_101233862
468 Ga0307414_10038490
469 Ga0307414_11070080
470 Ga0307411_10037412
471 Ga0307411_10104829
472 Ga0307411_10119757
473 Ga0307411_10225933
474 Ga0307411_10324852
475 Ga0307415_100130229
476 Ga0307415_100505718
477 Ga0307415_100573838
478 Ga0316582_0000702
479 Ga0316582_0132408
480 Ga0316584_0085660
481 Ga0451853_3743381
482 Ga0450912_000090
483 Ga0451577_0146178
484 Ga0453684_0038304
485 Ga0453684_0220618
486 Ga0451576_0037651
487 Ga0451576_1307623
488 Ga0495638_0015657
489 Ga0495607_0013450
490 Ga0495610_0000104
491 Ga0495643_0000023
492 Ga0495643_0014875
493 Ga0495643_0072657
494 Ga0495598_0072701
495 Ga0495668_0149232
496 Ga0495625_0066788
497 Ga0495671_0369219
498 Ga0495615_0001501
499 Ga0496101_0066280
500 Ga0496102_0118552
501 Ga0496102_0180442
502 Ga0496103_0069570
503 Ga0496103_0430961
504 Ga0496105_0038890
505 Ga0496106_0001368
506 Ga0496107_0057015
507 Ga0496108_0210897
508 Ga0496109_0133957
509 Ga0496111_0041690
510 Ga0496111_0433703
511 Ga0496112_0133462
512 Ga0496113_0016765
513 Ga0496114_0038426
514 Ga0496121_0592934
515 Ga0496124_0296690
516 Ga0496126_0002621
517 Ga0501033_0135487
518 Ga0501033_0140933
519 Ga0501034_0121886
520 Ga0501036_0219991
521 Ga0501037_0298631
522 Ga0501043_0249936
523 Ga0501047_0230030
524 Ga0501047_0232520
525 Ga0501047_0414870
526 Ga0501070_0429293
527 Ga0501044_0000340
528 Ga0501044_0079151
529 Ga0501044_0131436
530 Ga0501044_0398717
531 Ga0501044_0500798
532 nmdc:mga03683_1109_c1
533 nmdc:mga03683_7209_c1
534 nmdc:mga03n38_8859_c1
535 nmdc:mga0yw44_27278_c1
536 nmdc:mga0k408_2765_c1
537 nmdc:mga06z11_494_c1
538 nmdc:mga04h51_31_c1
539 nmdc:mga07m45_23_c1
540 nmdc:mga07m45_687_c2
541 nmdc:mga0sz30_8672_c1
542 Ga0500643_000004
543 Ga0500595_028742
544 Ga0500607_000122
545 Ga0500607_000828
546 Ga0500608_056112
547 Ga0500559_0000350
548 Ga0500559_0002607
549 Ga0500568_0090546
550 Ga0500573_0353488
551 Ga0500616_0003571
552 Ga0500622_0000910
553 Ga0500637_0029843
554 Ga0500645_005802
555 2895883156
556 2896254526
557 3000866617
558 8054302793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bye-assembly1.cif.gz_B crystal structure of the gh2 exo-beta-mannanase from xanthomonas axonopodis pv. citri in complex with mannose 0.764 74 157
6byc-assembly1.cif.gz_A crystal structure of the gh2 exo-beta-mannanase from xanthomonas axonopodis pv. citri 0.7584 74 157
6byg-assembly1.cif.gz_B crystal structure of the nucleophile mutant (e575a) of the gh2 exo-beta-mannanase from xanthomonas axonopodis pv. citri 0.7578 74 157
6byi-assembly1.cif.gz_B crystal structure of the acid-base mutant (e477a) of the gh2 exo-beta-mannanase from xanthomonas axonopodis pv. citri 0.7571 74 157
6l9f-assembly1.cif.gz_A crystal structure of tead4 in complex with a novel fam181a peptide 0.7493 90 149
ID Description Score Start End Superfamily
2je8B02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7858 74 157 2.60.40.10
4ypjB02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6591 79 157 2.60.40.10
5z1aA02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6511 79 157 2.60.40.10
af_Q5VPR5_44_200_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6437 72 155 2.60.40.1820
af_Q75LD9_32_182_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6255 72 154 2.60.40.1820
ID Description Score Start End GO Terms
AF-A0A2N8ELW7-F1-model_v4 deleted 0.9722 77 156
AF-A0A2W6VKQ5-F1-model_v4 Lipoprotein 0.972 41 219
AF-A0A840YV47-F1-model_v4 Uncharacterized protein 0.9669 36 219
AF-A0A7C9KWJ6-F1-model_v4 DUF4403 family protein 0.9658 41 219
AF-A0A418W7Y6-F1-model_v4 Uncharacterized protein 0.9647 36 219

Map