F382954

General Info

Members Datasets Scaffolds Average Seq Length
279 150 558 162

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10149869|Ga0081539_101498692
Length 177
Sequence VRSAVSRRGFIVWRVLLAIVSDTHLPRGGRALPPACVAAMRSADLIVHAGDFSSAEVLIEIEALGPPVAAVHGNVDSFELRAMLPAERVIDAGGVAIGIVHDGGPSRGRLERLRRRFPGAAAVIFGHSHLPLHERAPDGFQIFNPGSPTERRRAPAHTMGIGRVEGGALTLEHLTLG

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
60 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 8.24
Rhizosphere 83.87
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10149869 3300005985 Unclassified 1123
2 rootH2_10112371 3300003320 Bacteria 2391
3 JGI25407J50210_10011916 3300003373 Bacteria 2227
4 Ga0070658_10046978 3300005327 Bacteria 3493
5 Ga0070683_100028510 3300005329 Bacteria 5046
6 Ga0070680_100209352 3300005336 Bacteria 1645
7 Ga0070682_100502490 3300005337 Bacteria 940
8 Ga0070660_100127227 3300005339 Bacteria 2036
9 Ga0070691_10615359 3300005341 Bacteria 643
10 Ga0070671_100737219 3300005355 Bacteria 856
11 Ga0070659_100153631 3300005366 Bacteria 1879
12 Ga0070714_100003425 3300005435 Bacteria 11813
13 Ga0070714_100009659 3300005435 Bacteria 7596
14 Ga0070714_100032067 3300005435 Bacteria 4386
15 Ga0070713_100130793 3300005436 Bacteria 2213
16 Ga0070713_100298512 3300005436 Unclassified 1482
17 Ga0070681_10021983 3300005458 Bacteria 6401
18 Ga0070681_10145778 3300005458 Bacteria 2296
19 Ga0068867_101178094 3300005459 Bacteria 703
20 Ga0070679_100159466 3300005530 Bacteria 2230
21 Ga0070684_100014384 3300005535 Bacteria 6409
22 Ga0068855_100106947 3300005563 Bacteria 3214
23 Ga0070664_100473633 3300005564 Bacteria 1152
24 Ga0068857_100256529 3300005577 Bacteria 1604
25 Ga0068856_100012137 3300005614 Bacteria 8344
26 Ga0068852_101942838 3300005616 Bacteria 611
27 Ga0081455_10018418 3300005937 Bacteria 6654
28 Ga0081538_10000020 3300005981 Bacteria 139567
29 Ga0081538_10002312 3300005981 Bacteria 18817
30 Ga0081538_10004452 3300005981 Bacteria 12910
31 Ga0081538_10009245 3300005981 Bacteria 8254
32 Ga0081538_10060963 3300005981 Bacteria 2164
33 Ga0070717_10003099 3300006028 Bacteria 11855
34 Ga0070717_11331482 3300006028 Bacteria 653
35 Ga0075365_10351513 3300006038 Bacteria 1039
36 Ga0075364_10156310 3300006051 Unclassified 1538
37 Ga0075430_100061603 3300006846 Bacteria 3153
38 Ga0075431_100520622 3300006847 Unclassified 1179
39 Ga0075433_11460420 3300006852 Bacteria 591
40 Ga0075434_101503043 3300006871 Bacteria 683
41 Ga0105240_10403837 3300009093 Bacteria 1538
42 Ga0111539_10555616 3300009094 Bacteria 1337
43 Ga0114129_11406878 3300009147 Bacteria 860
44 Ga0114129_11563958 3300009147 Bacteria 808
45 Ga0105238_10093399 3300009551 Bacteria 2996
46 Ga0157369_10153852 3300013105 Bacteria 2430
47 Ga0157374_10156083 3300013296 Bacteria 2221
48 Ga0157372_10409312 3300013307 Bacteria 1580
49 Ga0182008_10104822 3300014497 Bacteria 1399
50 Ga0213874_10000090 3300021377 Bacteria 14202
51 Ga0213874_10073239 3300021377 Bacteria 1097
52 Ga0213874_10161668 3300021377 Bacteria 787
53 Ga0213876_10080487 3300021384 Bacteria 1722
54 Ga0213876_10166546 3300021384 Bacteria 1172
55 Ga0207647_10128290 3300025904 Bacteria 1492
56 Ga0207705_10074903 3300025909 Bacteria 2458
57 Ga0207707_10059555 3300025912 Bacteria 3323
58 Ga0207695_10295212 3300025913 Bacteria 1512
59 Ga0207657_10018729 3300025919 Bacteria 6596
60 Ga0207649_10218420 3300025920 Bacteria 1356
61 Ga0207646_10709183 3300025922 Bacteria 899
62 Ga0207687_10760223 3300025927 Bacteria 825
63 Ga0207664_10004391 3300025929 Bacteria 9551
64 Ga0207664_10040027 3300025929 Bacteria 3641
65 Ga0207664_10088313 3300025929 Bacteria 2536
66 Ga0207690_10145626 3300025932 Bacteria 1751
67 Ga0207690_10263096 3300025932 Bacteria 1337
68 Ga0207679_10158046 3300025945 Bacteria 1853
69 Ga0207702_10051427 3300026078 Bacteria 3482
70 Ga0207674_10331710 3300026116 Bacteria 1471
71 Ga0307410_10434082 3300031852 Bacteria 1068
72 Ga0307416_100126515 3300032002 Bacteria 2290
73 Ga0307416_100373901 3300032002 Bacteria 1452
74 Ga0307416_100717194 3300032002 Bacteria 1090
75 Ga0307411_10898414 3300032005 Bacteria 787
76 Ga0307411_10943163 3300032005 Bacteria 769
77 Ga0307415_100193361 3300032126 Bacteria 1607
78 Ga0307415_100297571 3300032126 Bacteria 1335
79 Ga0307415_100652015 3300032126 Bacteria 944
80 Ga0307415_101925244 3300032126 Bacteria 574
81 Ga0373956_0031081 3300035119 Bacteria 2338
82 Ga0373924_0304652 3300035410 Bacteria 708
83 Ga0373937_0019266 3300036401 Bacteria 6107
84 Ga0395900_0037663 3300037418 Bacteria 4986
85 Ga0395898_0183256 3300037466 Bacteria 2001
86 Ga0436364_0090961 3300037853 Bacteria 1789
87 Ga0436364_0912156 3300037853 Bacteria 848
88 Ga0436364_1560505 3300037853 Bacteria 6783
89 Ga0395901_0232159 3300038443 Bacteria 1926
90 Ga0395901_0252693 3300038443 Unclassified 1836
91 Ga0436365_0270369 3300039437 Bacteria 3947
92 Ga0436365_0313766 3300039437 Bacteria 8018
93 Ga0436365_1093652 3300039437 Bacteria 18228
94 Ga0436365_1383902 3300039437 Bacteria 871
95 Ga0436363_0186117 3300039450 Bacteria 2837
96 Ga0436363_0539224 3300039450 Bacteria 945
97 Ga0436363_0654155 3300039450 Bacteria 35800
98 Ga0436363_0698566 3300039450 Bacteria 1913
99 Ga0436363_0786889 3300039450 Bacteria 13292
100 Ga0436363_1275798 3300039450 Bacteria 1137
101 Ga0436362_0438632 3300039453 Bacteria 1165
102 Ga0436362_0715611 3300039453 Bacteria 719
103 Ga0466969_0000256 3300044656 Bacteria 29049
104 Ga0466972_0432742 3300044658 Unclassified 617
105 Ga0466965_0037068 3300044683 Bacteria 2394
106 Ga0466966_0351812 3300044684 Unclassified 885
107 Ga0466961_0002714 3300044693 Bacteria 11004
108 Ga0466961_0113768 3300044693 Unclassified 1701
109 Ga0466961_0160697 3300044693 Bacteria 1400
110 Ga0466961_0277299 3300044693 Bacteria 1026
111 Ga0466963_0000010 3300044694 Bacteria 68690
112 Ga0466963_0000729 3300044694 Bacteria 16148
113 Ga0466963_0002932 3300044694 Bacteria 9647
114 Ga0466963_0006305 3300044694 Bacteria 7013
115 Ga0466963_0008542 3300044694 Bacteria 6148
116 Ga0466963_0015548 3300044694 Bacteria 4715
117 Ga0466963_0030071 3300044694 Bacteria 3501
118 Ga0466963_0039287 3300044694 Bacteria 3098
119 Ga0466963_0055229 3300044694 Bacteria 2640
120 Ga0466963_0102531 3300044694 Bacteria 1959
121 Ga0466963_0175619 3300044694 Unclassified 1494
122 Ga0466963_0315078 3300044694 Bacteria 1101
123 Ga0466963_0478943 3300044694 Bacteria 879
124 Ga0466963_0832213 3300044694 Bacteria 651
125 Ga0466964_0002663 3300044706 Bacteria 6393
126 Ga0466964_0005533 3300044706 Bacteria 4691
127 Ga0466964_0006257 3300044706 Bacteria 4437
128 Ga0466964_0013059 3300044706 Bacteria 3147
129 Ga0466964_0024038 3300044706 Bacteria 2372
130 Ga0466964_0094423 3300044706 Bacteria 1307
131 Ga0466964_0455234 3300044706 Bacteria 679
132 Ga0466971_0002599 3300044719 Bacteria 7639
133 Ga0466971_0024052 3300044719 Bacteria 2716
134 Ga0466971_0051273 3300044719 Bacteria 1857
135 Ga0466971_0471144 3300044719 Bacteria 617
136 Ga0466968_0000894 3300044735 Bacteria 10485
137 Ga0466968_0020054 3300044735 Bacteria 2695
138 Ga0466968_0039038 3300044735 Unclassified 1997
139 Ga0466968_0042250 3300044735 Unclassified 1927
140 Ga0466968_0461315 3300044735 Viruses 629
141 Ga0466970_0046182 3300044765 Bacteria 2319
142 Ga0466970_0128302 3300044765 Bacteria 1392
143 Ga0466957_0006060 3300044842 Bacteria 6825
144 Ga0466957_0082192 3300044842 Unclassified 2007
145 Ga0466957_0153563 3300044842 Bacteria 1491
146 Ga0466957_0170641 3300044842 Bacteria 1417
147 Ga0466957_0197780 3300044842 Bacteria 1319
148 Ga0466957_0397866 3300044842 Bacteria 942
149 Ga0466957_0517900 3300044842 Bacteria 828
150 Ga0466960_0004968 3300044901 Bacteria 5238
151 Ga0466960_0067726 3300044901 Bacteria 1769
152 Ga0466960_0068161 3300044901 Bacteria 1764
153 Ga0466960_0145638 3300044901 Bacteria 1261
154 Ga0466959_0006028 3300045049 Bacteria 8368
155 Ga0466959_0017610 3300045049 Bacteria 5238
156 Ga0466959_0033619 3300045049 Bacteria 3792
157 Ga0466959_0093160 3300045049 Unclassified 2162
158 Ga0466959_1037493 3300045049 Bacteria 546
159 Ga0466958_0020069 3300045836 Bacteria 3895
160 Ga0466958_0025303 3300045836 Bacteria 3499
161 Ga0466958_0037503 3300045836 Bacteria 2904
162 Ga0466958_0056441 3300045836 Bacteria 2385
163 Ga0466958_0110724 3300045836 Bacteria 1714
164 Ga0466958_0130872 3300045836 Unclassified 1575
165 Ga0466958_0149376 3300045836 Bacteria 1473
166 Ga0466958_0858864 3300045836 Unclassified 592
167 Ga0466967_0000714 3300045976 Bacteria 16931
168 Ga0466967_0006182 3300045976 Bacteria 8436
169 Ga0466967_0014509 3300045976 Bacteria 6140
170 Ga0466967_0028335 3300045976 Bacteria 4674
171 Ga0466967_0034359 3300045976 Bacteria 4303
172 Ga0466967_0045070 3300045976 Bacteria 3830
173 Ga0466967_0050048 3300045976 Bacteria 3657
174 Ga0466967_0057084 3300045976 Bacteria 3445
175 Ga0466967_0061309 3300045976 Bacteria 3336
176 Ga0466967_0083214 3300045976 Bacteria 2893
177 Ga0466967_0139015 3300045976 Bacteria 2261
178 Ga0466967_0162677 3300045976 Bacteria 2096
179 Ga0466967_0208433 3300045976 Bacteria 1853
180 Ga0466967_0213842 3300045976 Bacteria 1829
181 Ga0466967_0326028 3300045976 Unclassified 1482
182 Ga0466967_0596954 3300045976 Bacteria 1089
183 Ga0466967_1151002 3300045976 Unclassified 773
184 Ga0495592_0000123 3300046454 Bacteria 68503
185 Ga0495651_0000029 3300046462 Bacteria 105042
186 Ga0495653_0003956 3300046463 Bacteria 11963
187 Ga0495608_0002826 3300046511 Bacteria 12446
188 Ga0495628_0000016 3300046516 Bacteria 170260
189 Ga0495644_0155590 3300046523 Bacteria 876
190 Ga0495652_0000045 3300046529 Bacteria 122469
191 Ga0495587_0000083 3300046536 Bacteria 73166
192 Ga0495645_0000306 3300046543 Bacteria 35497
193 Ga0495657_0002001 3300046675 Bacteria 17366
194 Ga0495599_0000219 3300046678 Bacteria 36729
195 Ga0495623_0000429 3300046679 Bacteria 27648
196 Ga0495646_0088146 3300046680 Bacteria 1797
197 Ga0495624_0087752 3300046690 Bacteria 1921
198 Ga0495600_0083052 3300046809 Bacteria 2091
199 Ga0495604_0000072 3300047317 Bacteria 88631
200 Ga0495676_0357214 3300047321 Bacteria 976
201 Ga0495680_0003161 3300047322 Bacteria 16400
202 Ga0495675_0000031 3300047444 Bacteria 99240
203 Ga0495602_0000133 3300048088 Bacteria 69392
204 Ga0496100_0298378 3300048903 Bacteria 1205
205 Ga0496101_0135155 3300048904 Bacteria 1876
206 Ga0496104_0056716 3300048907 Bacteria 3705
207 Ga0496105_0029884 3300048908 Bacteria 4461
208 Ga0496106_0373362 3300048909 Unclassified 1146
209 Ga0496107_0277352 3300048910 Bacteria 1248
210 Ga0496108_0023711 3300048911 Bacteria 5050
211 Ga0496108_0233016 3300048911 Bacteria 1601
212 Ga0496108_0497472 3300048911 Unclassified 1065
213 Ga0496109_0010434 3300048912 Bacteria 7935
214 Ga0496109_0053401 3300048912 Bacteria 3685
215 Ga0496109_0165862 3300048912 Bacteria 2070
216 Ga0496110_0018546 3300048913 Bacteria 5835
217 Ga0496110_0183013 3300048913 Bacteria 1903
218 Ga0496111_0377224 3300048914 Bacteria 1049
219 Ga0496111_0460531 3300048914 Bacteria 938
220 Ga0496112_0308442 3300048915 Bacteria 1528
221 Ga0496112_0857469 3300048915 Bacteria 831
222 Ga0496113_0234408 3300048916 Bacteria 1464
223 Ga0496113_1223207 3300048916 Bacteria 586
224 Ga0496114_1221989 3300048917 Bacteria 638
225 Ga0496115_0036936 3300048918 Bacteria 3869
226 Ga0496115_0389504 3300048918 Bacteria 1132
227 Ga0501031_0480561 3300049568 Bacteria 802
228 Ga0501036_0159219 3300049572 Bacteria 1904
229 Ga0501036_0463398 3300049572 Bacteria 1055
230 Ga0501037_0808474 3300049573 Bacteria 619
231 Ga0501038_0381280 3300049574 Unclassified 1094
232 Ga0501039_0434998 3300049575 Bacteria 1030
233 Ga0501039_0699768 3300049575 Bacteria 792
234 Ga0501040_0096294 3300049576 Bacteria 2061
235 Ga0501040_0665741 3300049576 Bacteria 752
236 Ga0501041_0118135 3300049577 Bacteria 1647
237 Ga0501041_0432580 3300049577 Bacteria 835
238 Ga0501042_0040397 3300049578 Bacteria 3317
239 Ga0501046_0223235 3300049580 Bacteria 1394
240 Ga0501048_0049795 3300049582 Bacteria 2985
241 Ga0501048_0095715 3300049582 Bacteria 2094
242 Ga0501048_0149869 3300049582 Bacteria 1650
243 Ga0501069_0462324 3300049585 Bacteria 755
244 Ga0501070_0244712 3300049586 Bacteria 1468
245 Ga0501071_0489015 3300049587 Bacteria 943
246 Ga0501072_0177806 3300049588 Bacteria 1697
247 Ga0501074_0064903 3300049590 Bacteria 2628
248 Ga0501074_0485209 3300049590 Bacteria 876
249 Ga0501075_0052672 3300049591 Bacteria 3060
250 Ga0501075_0164727 3300049591 Bacteria 1691
251 Ga0501076_0108917 3300049592 Bacteria 2238
252 Ga0501076_0611932 3300049592 Bacteria 899
253 Ga0501077_0294439 3300049593 Bacteria 1034
254 Ga0501079_0036993 3300049741 Bacteria 3760
255 Ga0501079_0349578 3300049741 Bacteria 1158
256 Ga0501080_0088367 3300049742 Bacteria 2879
257 Ga0501035_0563230 3300049822 Bacteria 932
258 Ga0501045_0076704 3300049824 Bacteria 2463
259 Ga0501045_0971113 3300049824 Bacteria 623
260 nmdc:mga0yw44_615106_c1 3300050492 Unclassified 738
261 nmdc:mga0qj67_572323_c1 3300050509 Bacteria 905
262 nmdc:mga06r32_1121927_c1 3300050510 Archaea 735
263 nmdc:mga08y16_96794_c1 3300050511 Bacteria 3073
264 Ga0495601_0000626 3300053077 Bacteria 18860
265 Ga0495595_0009312 3300053084 Bacteria 4059
266 Ga0495619_0001267 3300053085 Bacteria 16579
267 Ga0501084_0169494 3300054114 Bacteria 1843
268 Ga0501084_0340709 3300054114 Bacteria 1266
269 Ga0501082_0257858 3300060353 Bacteria 1517
270 Ga0466962_0002011 3300061719 Bacteria 9595
271 Ga0466962_0022551 3300061719 Bacteria 3025
272 Ga0466962_0035627 3300061719 Bacteria 2381
273 Ga0466962_0078332 3300061719 Bacteria 1580
274 Ga0466962_0113495 3300061719 Bacteria 1305
275 Ga0466962_0128689 3300061719 Bacteria 1223
276 Ga0466962_0157870 3300061719 Bacteria 1102
277 Ga0530510_0002728 3300061734 Bacteria 12154
278 Ga0530510_0471402 3300061734 Bacteria 950
279 Ga0530510_0557731 3300061734 Bacteria 870
280 Ga0081539_10149869
281 rootH2_10112371
282 JGI25407J50210_10011916
283 Ga0070658_10046978
284 Ga0070683_100028510
285 Ga0070680_100209352
286 Ga0070682_100502490
287 Ga0070660_100127227
288 Ga0070691_10615359
289 Ga0070671_100737219
290 Ga0070659_100153631
291 Ga0070714_100003425
292 Ga0070714_100009659
293 Ga0070714_100032067
294 Ga0070713_100130793
295 Ga0070713_100298512
296 Ga0070681_10021983
297 Ga0070681_10145778
298 Ga0068867_101178094
299 Ga0070679_100159466
300 Ga0070684_100014384
301 Ga0068855_100106947
302 Ga0070664_100473633
303 Ga0068857_100256529
304 Ga0068856_100012137
305 Ga0068852_101942838
306 Ga0081455_10018418
307 Ga0081538_10000020
308 Ga0081538_10002312
309 Ga0081538_10004452
310 Ga0081538_10009245
311 Ga0081538_10060963
312 Ga0070717_10003099
313 Ga0070717_11331482
314 Ga0075365_10351513
315 Ga0075364_10156310
316 Ga0075430_100061603
317 Ga0075431_100520622
318 Ga0075433_11460420
319 Ga0075434_101503043
320 Ga0105240_10403837
321 Ga0111539_10555616
322 Ga0114129_11406878
323 Ga0114129_11563958
324 Ga0105238_10093399
325 Ga0157369_10153852
326 Ga0157374_10156083
327 Ga0157372_10409312
328 Ga0182008_10104822
329 Ga0213874_10000090
330 Ga0213874_10073239
331 Ga0213874_10161668
332 Ga0213876_10080487
333 Ga0213876_10166546
334 Ga0207647_10128290
335 Ga0207705_10074903
336 Ga0207707_10059555
337 Ga0207695_10295212
338 Ga0207657_10018729
339 Ga0207649_10218420
340 Ga0207646_10709183
341 Ga0207687_10760223
342 Ga0207664_10004391
343 Ga0207664_10040027
344 Ga0207664_10088313
345 Ga0207690_10145626
346 Ga0207690_10263096
347 Ga0207679_10158046
348 Ga0207702_10051427
349 Ga0207674_10331710
350 Ga0307410_10434082
351 Ga0307416_100126515
352 Ga0307416_100373901
353 Ga0307416_100717194
354 Ga0307411_10898414
355 Ga0307411_10943163
356 Ga0307415_100193361
357 Ga0307415_100297571
358 Ga0307415_100652015
359 Ga0307415_101925244
360 Ga0373956_0031081
361 Ga0373924_0304652
362 Ga0373937_0019266
363 Ga0395900_0037663
364 Ga0395898_0183256
365 Ga0436364_0090961
366 Ga0436364_0912156
367 Ga0436364_1560505
368 Ga0395901_0232159
369 Ga0395901_0252693
370 Ga0436365_0270369
371 Ga0436365_0313766
372 Ga0436365_1093652
373 Ga0436365_1383902
374 Ga0436363_0186117
375 Ga0436363_0539224
376 Ga0436363_0654155
377 Ga0436363_0698566
378 Ga0436363_0786889
379 Ga0436363_1275798
380 Ga0436362_0438632
381 Ga0436362_0715611
382 Ga0466969_0000256
383 Ga0466972_0432742
384 Ga0466965_0037068
385 Ga0466966_0351812
386 Ga0466961_0002714
387 Ga0466961_0113768
388 Ga0466961_0160697
389 Ga0466961_0277299
390 Ga0466963_0000010
391 Ga0466963_0000729
392 Ga0466963_0002932
393 Ga0466963_0006305
394 Ga0466963_0008542
395 Ga0466963_0015548
396 Ga0466963_0030071
397 Ga0466963_0039287
398 Ga0466963_0055229
399 Ga0466963_0102531
400 Ga0466963_0175619
401 Ga0466963_0315078
402 Ga0466963_0478943
403 Ga0466963_0832213
404 Ga0466964_0002663
405 Ga0466964_0005533
406 Ga0466964_0006257
407 Ga0466964_0013059
408 Ga0466964_0024038
409 Ga0466964_0094423
410 Ga0466964_0455234
411 Ga0466971_0002599
412 Ga0466971_0024052
413 Ga0466971_0051273
414 Ga0466971_0471144
415 Ga0466968_0000894
416 Ga0466968_0020054
417 Ga0466968_0039038
418 Ga0466968_0042250
419 Ga0466968_0461315
420 Ga0466970_0046182
421 Ga0466970_0128302
422 Ga0466957_0006060
423 Ga0466957_0082192
424 Ga0466957_0153563
425 Ga0466957_0170641
426 Ga0466957_0197780
427 Ga0466957_0397866
428 Ga0466957_0517900
429 Ga0466960_0004968
430 Ga0466960_0067726
431 Ga0466960_0068161
432 Ga0466960_0145638
433 Ga0466959_0006028
434 Ga0466959_0017610
435 Ga0466959_0033619
436 Ga0466959_0093160
437 Ga0466959_1037493
438 Ga0466958_0020069
439 Ga0466958_0025303
440 Ga0466958_0037503
441 Ga0466958_0056441
442 Ga0466958_0110724
443 Ga0466958_0130872
444 Ga0466958_0149376
445 Ga0466958_0858864
446 Ga0466967_0000714
447 Ga0466967_0006182
448 Ga0466967_0014509
449 Ga0466967_0028335
450 Ga0466967_0034359
451 Ga0466967_0045070
452 Ga0466967_0050048
453 Ga0466967_0057084
454 Ga0466967_0061309
455 Ga0466967_0083214
456 Ga0466967_0139015
457 Ga0466967_0162677
458 Ga0466967_0208433
459 Ga0466967_0213842
460 Ga0466967_0326028
461 Ga0466967_0596954
462 Ga0466967_1151002
463 Ga0495592_0000123
464 Ga0495651_0000029
465 Ga0495653_0003956
466 Ga0495608_0002826
467 Ga0495628_0000016
468 Ga0495644_0155590
469 Ga0495652_0000045
470 Ga0495587_0000083
471 Ga0495645_0000306
472 Ga0495657_0002001
473 Ga0495599_0000219
474 Ga0495623_0000429
475 Ga0495646_0088146
476 Ga0495624_0087752
477 Ga0495600_0083052
478 Ga0495604_0000072
479 Ga0495676_0357214
480 Ga0495680_0003161
481 Ga0495675_0000031
482 Ga0495602_0000133
483 Ga0496100_0298378
484 Ga0496101_0135155
485 Ga0496104_0056716
486 Ga0496105_0029884
487 Ga0496106_0373362
488 Ga0496107_0277352
489 Ga0496108_0023711
490 Ga0496108_0233016
491 Ga0496108_0497472
492 Ga0496109_0010434
493 Ga0496109_0053401
494 Ga0496109_0165862
495 Ga0496110_0018546
496 Ga0496110_0183013
497 Ga0496111_0377224
498 Ga0496111_0460531
499 Ga0496112_0308442
500 Ga0496112_0857469
501 Ga0496113_0234408
502 Ga0496113_1223207
503 Ga0496114_1221989
504 Ga0496115_0036936
505 Ga0496115_0389504
506 Ga0501031_0480561
507 Ga0501036_0159219
508 Ga0501036_0463398
509 Ga0501037_0808474
510 Ga0501038_0381280
511 Ga0501039_0434998
512 Ga0501039_0699768
513 Ga0501040_0096294
514 Ga0501040_0665741
515 Ga0501041_0118135
516 Ga0501041_0432580
517 Ga0501042_0040397
518 Ga0501046_0223235
519 Ga0501048_0049795
520 Ga0501048_0095715
521 Ga0501048_0149869
522 Ga0501069_0462324
523 Ga0501070_0244712
524 Ga0501071_0489015
525 Ga0501072_0177806
526 Ga0501074_0064903
527 Ga0501074_0485209
528 Ga0501075_0052672
529 Ga0501075_0164727
530 Ga0501076_0108917
531 Ga0501076_0611932
532 Ga0501077_0294439
533 Ga0501079_0036993
534 Ga0501079_0349578
535 Ga0501080_0088367
536 Ga0501035_0563230
537 Ga0501045_0076704
538 Ga0501045_0971113
539 nmdc:mga0yw44_615106_c1
540 nmdc:mga0qj67_572323_c1
541 nmdc:mga06r32_1121927_c1
542 nmdc:mga08y16_96794_c1
543 Ga0495601_0000626
544 Ga0495595_0009312
545 Ga0495619_0001267
546 Ga0501084_0169494
547 Ga0501084_0340709
548 Ga0501082_0257858
549 Ga0466962_0002011
550 Ga0466962_0022551
551 Ga0466962_0035627
552 Ga0466962_0078332
553 Ga0466962_0113495
554 Ga0466962_0128689
555 Ga0466962_0157870
556 Ga0530510_0002728
557 Ga0530510_0471402
558 Ga0530510_0557731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

15

167

0.91

PF00149

Metallophos

Calcineurin-like phosphoesterase

15

92

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.8093 1 162
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.8084 2 161
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8059 2 160
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.8047 1 162
5osi-assembly3.cif.gz_G structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) 0.8033 1 160
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8782 1 159 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8677 1 159 3.60.21.10
af_Q86D99_1_187_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8547 2 162 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8464 1 162 3.60.21.10
af_Q86D99_1_187_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8451 2 162 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A538BP00-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9824 1 162 GO:0016787
GO:0046872
AF-A0A538I762-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9808 1 162 GO:0016787
GO:0046872
AF-A0A7V9RXL7-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9806 2 162 GO:0016787
GO:0046872
AF-A0A537TJZ4-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9801 1 162 GO:0016787
GO:0046872
AF-A0A7W1JVR0-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9777 2 161 GO:0016787
GO:0046872

Map