F382912

General Info

Members Datasets Scaffolds Average Seq Length
279 159 279 134

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_101817102|Ga0070698_1018171021
Length 153
Sequence MTGVPSGAPLPSDPPPGAVPASSNARREVPRRSWLDVRWRQFRNAPRPVVRAVLSSLVVAVVLGLIYLAYDVSLRRGAVLPGGDLRVLYIVLDVVIVLLVGSVVTWLVVPQPRGSGRSTTRSPWSAALGFFAAVPVCYLVLVVVVQILEPLLG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
98 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.04
Rhizosphere 89.25
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10297192 3300003320 Bacteria 2261
2 rootH1_10133276 3300003323 Bacteria 1501
3 Ga0068869_100196984 3300005334 Bacteria 1587
4 Ga0070680_101521452 3300005336 Bacteria 580
5 Ga0070682_100068690 3300005337 Bacteria 2261
6 Ga0068868_100169495 3300005338 Unclassified 1807
7 Ga0068868_100340739 3300005338 Bacteria 1282
8 Ga0070660_101109309 3300005339 Bacteria 670
9 Ga0070687_100175837 3300005343 Unclassified 1278
10 Ga0070692_11120482 3300005345 Bacteria 556
11 Ga0070692_11149402 3300005345 Bacteria 550
12 Ga0070675_100742399 3300005354 Bacteria 895
13 Ga0070674_100317793 3300005356 Bacteria 1247
14 Ga0070659_100068352 3300005366 Bacteria 2818
15 Ga0070701_10085301 3300005438 Unclassified 1719
16 Ga0070701_10386394 3300005438 Bacteria 883
17 Ga0070711_101214727 3300005439 Unclassified 652
18 Ga0070705_100020761 3300005440 Unclassified 3483
19 Ga0070705_100030635 3300005440 Unclassified 2972
20 Ga0070705_100077824 3300005440 Bacteria 2027
21 Ga0070705_100332002 3300005440 Bacteria 1102
22 Ga0070705_101376898 3300005440 Bacteria 587
23 Ga0070700_100008693 3300005441 Bacteria 5540
24 Ga0070694_100004129 3300005444 Bacteria 8724
25 Ga0070694_100119305 3300005444 Bacteria 1891
26 Ga0070694_100321853 3300005444 Bacteria 1190
27 Ga0070694_100416471 3300005444 Bacteria 1055
28 Ga0070694_100446897 3300005444 Unclassified 1020
29 Ga0070708_100000819 3300005445 Bacteria 23459
30 Ga0070708_100001093 3300005445 Bacteria 20669
31 Ga0070708_100005467 3300005445 Bacteria 10074
32 Ga0070708_100059315 3300005445 Unclassified 3411
33 Ga0070708_100456255 3300005445 Bacteria 1206
34 Ga0070708_100474012 3300005445 Bacteria 1181
35 Ga0070663_100499282 3300005455 Unclassified 1010
36 Ga0070681_10218382 3300005458 Bacteria 1822
37 Ga0070706_100423707 3300005467 Unclassified 1239
38 Ga0070706_100840717 3300005467 Unclassified 849
39 Ga0070707_100000470 3300005468 Bacteria 39843
40 Ga0070707_100000730 3300005468 Bacteria 32771
41 Ga0070707_100935209 3300005468 Bacteria 832
42 Ga0070707_101266909 3300005468 Bacteria 703
43 Ga0070698_100014399 3300005471 Bacteria 8355
44 Ga0070698_100451214 3300005471 Unclassified 1222
45 Ga0070698_101817102 3300005471 Bacteria 562
46 Ga0070699_100002737 3300005518 Bacteria 15720
47 Ga0070699_100023133 3300005518 Bacteria 5354
48 Ga0070699_100266802 3300005518 Bacteria 1532
49 Ga0070679_100144533 3300005530 Bacteria 2357
50 Ga0070697_100016651 3300005536 Bacteria 5783
51 Ga0070697_100151940 3300005536 Bacteria 1952
52 Ga0070697_100201997 3300005536 Unclassified 1690
53 Ga0070697_100249445 3300005536 Bacteria 1518
54 Ga0070695_100060725 3300005545 Unclassified 2450
55 Ga0070695_100094052 3300005545 Bacteria 2006
56 Ga0070695_100101567 3300005545 Bacteria 1938
57 Ga0070695_100273377 3300005545 Bacteria 1238
58 Ga0070696_100007410 3300005546 Bacteria 7335
59 Ga0070696_100021535 3300005546 Bacteria 4371
60 Ga0070696_100052906 3300005546 Unclassified 2825
61 Ga0070696_100067189 3300005546 Bacteria 2516
62 Ga0070696_100210047 3300005546 Bacteria 1456
63 Ga0070704_100006060 3300005549 Bacteria 7091
64 Ga0070704_100014833 3300005549 Bacteria 4876
65 Ga0070704_100024509 3300005549 Bacteria 3960
66 Ga0070704_100106611 3300005549 Unclassified 2124
67 Ga0070704_100484635 3300005549 Bacteria 1070
68 Ga0068855_100657410 3300005563 Bacteria 1125
69 Ga0070664_100466501 3300005564 Bacteria 1161
70 Ga0068857_100898518 3300005577 Bacteria 849
71 Ga0068854_100920686 3300005578 Bacteria 769
72 Ga0068859_100456596 3300005617 Unclassified 1374
73 Ga0068864_100480019 3300005618 Unclassified 1193
74 Ga0068864_101456708 3300005618 Archaea 687
75 Ga0068866_10319435 3300005718 Unclassified 976
76 Ga0068861_100016007 3300005719 Bacteria 5296
77 Ga0068861_101182516 3300005719 Unclassified 739
78 Ga0068870_10237901 3300005840 Unclassified 1123
79 Ga0068858_100695573 3300005842 Unclassified 989
80 Ga0068860_100030951 3300005843 Bacteria 5146
81 Ga0068860_100301901 3300005843 Unclassified 1569
82 Ga0068860_101017520 3300005843 Unclassified 847
83 Ga0068862_100182049 3300005844 Bacteria 1886
84 Ga0068862_100264672 3300005844 Unclassified 1571
85 Ga0081539_10004730 3300005985 Bacteria 14725
86 Ga0070716_100445956 3300006173 Unclassified 942
87 Ga0075428_100862787 3300006844 Unclassified 961
88 Ga0075433_10059994 3300006852 Bacteria 3330
89 Ga0075434_100075778 3300006871 Unclassified 3358
90 Ga0075434_102500245 3300006871 Bacteria 518
91 Ga0075429_100997551 3300006880 Bacteria 732
92 Ga0097620_100456614 3300006931 Unclassified 1374
93 Ga0097620_100516035 3300006931 Unclassified 1290
94 Ga0075435_100053083 3300007076 Bacteria 3268
95 Ga0111539_10182364 3300009094 Bacteria 2451
96 Ga0111539_10205595 3300009094 Unclassified 2295
97 Ga0111539_10443300 3300009094 Unclassified 1512
98 Ga0105245_10046515 3300009098 Bacteria 3878
99 Ga0105245_10192470 3300009098 Bacteria 1954
100 Ga0105245_10216041 3300009098 Bacteria 1848
101 Ga0105245_10669808 3300009098 Bacteria 1069
102 Ga0114129_10398524 3300009147 Unclassified 1814
103 Ga0114129_11202293 3300009147 Unclassified 944
104 Ga0114129_13130246 3300009147 Bacteria 540
105 Ga0105243_10084561 3300009148 Bacteria 2599
106 Ga0105243_10235969 3300009148 Bacteria 1625
107 Ga0105243_10258710 3300009148 Unclassified 1557
108 Ga0105243_10573913 3300009148 Unclassified 1082
109 Ga0105242_10645903 3300009176 Bacteria 1028
110 Ga0105249_10037180 3300009553 Bacteria 4418
111 Ga0105249_10303157 3300009553 Bacteria 1603
112 Ga0105249_11090151 3300009553 Unclassified 869
113 Ga0105249_11271934 3300009553 Bacteria 807
114 Ga0105239_10083578 3300010375 Bacteria 3516
115 Ga0105246_10236637 3300011119 Bacteria 1441
116 Ga0105246_10488495 3300011119 Unclassified 1043
117 Ga0105246_11260879 3300011119 Unclassified 683
118 Ga0157378_11035354 3300013297 Bacteria 856
119 Ga0157378_11584662 3300013297 Bacteria 700
120 Ga0163162_10361885 3300013306 Unclassified 1584
121 Ga0157375_12734145 3300013308 Unclassified 590
122 Ga0182008_10079880 3300014497 Bacteria 1609
123 Ga0157379_10004420 3300014968 Bacteria 12049
124 Ga0157379_10317885 3300014968 Unclassified 1421
125 Ga0157379_11238424 3300014968 Unclassified 719
126 Ga0163161_10107090 3300017792 Bacteria 2086
127 Ga0207653_10117690 3300025885 Bacteria 954
128 Ga0207688_10191959 3300025901 Bacteria 1222
129 Ga0207688_10776484 3300025901 Bacteria 607
130 Ga0207643_10220476 3300025908 Unclassified 1161
131 Ga0207684_10008158 3300025910 Bacteria 9329
132 Ga0207684_10010499 3300025910 Bacteria 8149
133 Ga0207684_10011891 3300025910 Bacteria 7587
134 Ga0207684_10017925 3300025910 Bacteria 6069
135 Ga0207684_10087217 3300025910 Bacteria 2658
136 Ga0207684_10624437 3300025910 Bacteria 919
137 Ga0207660_10089341 3300025917 Bacteria 2280
138 Ga0207662_10165548 3300025918 Unclassified 1415
139 Ga0207662_10443927 3300025918 Bacteria 886
140 Ga0207646_10002379 3300025922 Bacteria 22215
141 Ga0207646_10003416 3300025922 Bacteria 17931
142 Ga0207646_10017797 3300025922 Bacteria 6639
143 Ga0207646_10423622 3300025922 Unclassified 1201
144 Ga0207646_11064818 3300025922 Bacteria 713
145 Ga0207646_11375519 3300025922 Bacteria 615
146 Ga0207687_10966693 3300025927 Bacteria 730
147 Ga0207706_10377028 3300025933 Bacteria 1231
148 Ga0207686_10164812 3300025934 Bacteria 1557
149 Ga0207686_10215854 3300025934 Bacteria 1382
150 Ga0207709_10050642 3300025935 Unclassified 2541
151 Ga0207709_10853472 3300025935 Unclassified 738
152 Ga0207665_11401919 3300025939 Unclassified 556
153 Ga0207689_10008751 3300025942 Bacteria 8803
154 Ga0207689_10193010 3300025942 Bacteria 1680
155 Ga0207689_10640575 3300025942 Unclassified 895
156 Ga0207712_10831898 3300025961 Bacteria 813
157 Ga0207712_10960008 3300025961 Bacteria 757
158 Ga0207640_11286435 3300025981 Bacteria 652
159 Ga0207677_10242043 3300026023 Unclassified 1460
160 Ga0207678_10892483 3300026067 Bacteria 786
161 Ga0207708_10483802 3300026075 Unclassified 1035
162 Ga0207648_10214013 3300026089 Unclassified 1711
163 Ga0207676_10326436 3300026095 Unclassified 1411
164 Ga0207674_10427774 3300026116 Bacteria 1279
165 Ga0209983_1026339 3300027665 Archaea 1230
166 Ga0209971_1058952 3300027682 Bacteria 929
167 Ga0207428_10056839 3300027907 Bacteria 3108
168 Ga0207428_10276094 3300027907 Unclassified 1248
169 Ga0268265_10394543 3300028380 Unclassified 1277
170 Ga0268265_10701133 3300028380 Unclassified 978
171 Ga0307410_10041258 3300031852 Bacteria 3043
172 Ga0307410_10414055 3300031852 Bacteria 1092
173 Ga0307409_100054065 3300031995 Bacteria 3090
174 Ga0307414_11082030 3300032004 Bacteria 740
175 Ga0307415_101048038 3300032126 Bacteria 761
176 Ga0373945_0227463 3300035116 Bacteria 782
177 Ga0373943_0114243 3300035170 Bacteria 1428
178 Ga0373947_0277405 3300035725 Bacteria 1114
179 Ga0373925_0993697 3300037068 Bacteria 691
180 Ga0450910_007258 3300042147 Bacteria 1542
181 Ga0439434_0036818 3300042435 Bacteria 1498
182 Ga0439434_0227558 3300042435 Bacteria 634
183 Ga0439435_0137580 3300042436 Bacteria 776
184 Ga0451577_0054316 3300042876 Bacteria 3576
185 Ga0453684_0299026 3300044712 Bacteria 1830
186 Ga0451576_0320328 3300045051 Bacteria 1622
187 Ga0451576_0627618 3300045051 Bacteria 1129
188 Ga0495584_0411696 3300046491 Bacteria 687
189 Ga0495628_0888076 3300046516 Bacteria 619
190 Ga0495647_0073899 3300046681 Bacteria 1370
191 Ga0495658_0258828 3300046683 Bacteria 1095
192 Ga0496100_0326210 3300048903 Unclassified 1154
193 Ga0496100_0781277 3300048903 Unclassified 748
194 Ga0496102_0052469 3300048905 Bacteria 3716
195 Ga0496102_0098114 3300048905 Bacteria 2718
196 Ga0496102_0221837 3300048905 Bacteria 1782
197 Ga0496102_0378646 3300048905 Bacteria 1332
198 Ga0496102_0442632 3300048905 Bacteria 1219
199 Ga0496102_0650244 3300048905 Bacteria 977
200 Ga0496103_0028951 3300048906 Unclassified 3364
201 Ga0496103_0157481 3300048906 Bacteria 1456
202 Ga0496104_0351667 3300048907 Bacteria 1386
203 Ga0496105_0640127 3300048908 Bacteria 821
204 Ga0496105_0977316 3300048908 Bacteria 634
205 Ga0496106_0065415 3300048909 Unclassified 2768
206 Ga0496106_0409198 3300048909 Unclassified 1090
207 Ga0496107_0024738 3300048910 Unclassified 4249
208 Ga0496107_0401690 3300048910 Bacteria 1019
209 Ga0496108_0044041 3300048911 Bacteria 3727
210 Ga0496108_0819056 3300048911 Bacteria 802
211 Ga0496109_0375880 3300048912 Bacteria 1342
212 Ga0496109_0533690 3300048912 Bacteria 1107
213 Ga0496109_1628336 3300048912 Bacteria 580
214 Ga0496110_0236016 3300048913 Bacteria 1664
215 Ga0496111_0122010 3300048914 Bacteria 1925
216 Ga0496111_0148576 3300048914 Bacteria 1738
217 Ga0496112_0003631 3300048915 Bacteria 12850
218 Ga0496114_0219341 3300048917 Bacteria 1669
219 Ga0496114_0561193 3300048917 Bacteria 1008
220 Ga0501031_0022606 3300049568 Bacteria 4097
221 Ga0501031_0535776 3300049568 Bacteria 754
222 Ga0501032_0158371 3300049569 Bacteria 1487
223 Ga0501032_0242725 3300049569 Unclassified 1170
224 Ga0501033_0050585 3300049570 Bacteria 3082
225 Ga0501034_0756623 3300049571 Bacteria 867
226 Ga0501036_0014745 3300049572 Bacteria 6518
227 Ga0501036_0417934 3300049572 Unclassified 1118
228 Ga0501036_0680561 3300049572 Bacteria 851
229 Ga0501037_0021150 3300049573 Bacteria 4807
230 Ga0501038_0101262 3300049574 Bacteria 2398
231 Ga0501039_0013001 3300049575 Bacteria 6363
232 Ga0501039_0140229 3300049575 Unclassified 1899
233 Ga0501040_0140197 3300049576 Unclassified 1703
234 Ga0501040_0222376 3300049576 Unclassified 1343
235 Ga0501041_0016408 3300049577 Bacteria 4402
236 Ga0501042_0153281 3300049578 Unclassified 1662
237 Ga0501043_0202405 3300049579 Unclassified 1541
238 Ga0501043_0265057 3300049579 Bacteria 1320
239 Ga0501046_0067261 3300049580 Unclassified 2790
240 Ga0501046_0574231 3300049580 Unclassified 802
241 Ga0501048_0288719 3300049582 Unclassified 1166
242 Ga0501067_0141412 3300049583 Bacteria 1340
243 Ga0501068_0164598 3300049584 Unclassified 1398
244 Ga0501068_0252022 3300049584 Bacteria 1125
245 Ga0501069_0070179 3300049585 Unclassified 1962
246 Ga0501069_0152663 3300049585 Bacteria 1328
247 Ga0501070_0165880 3300049586 Bacteria 1820
248 Ga0501070_0323600 3300049586 Bacteria 1254
249 Ga0501071_0025885 3300049587 Bacteria 4113
250 Ga0501071_0244974 3300049587 Unclassified 1352
251 Ga0501072_0137568 3300049588 Bacteria 1947
252 Ga0501072_0206470 3300049588 Unclassified 1566
253 Ga0501073_0066604 3300049589 Bacteria 2511
254 Ga0501074_0205281 3300049590 Bacteria 1404
255 Ga0501075_0033088 3300049591 Bacteria 3845
256 Ga0501075_0196679 3300049591 Bacteria 1537
257 Ga0501077_0011500 3300049593 Bacteria 5529
258 Ga0501079_0125245 3300049741 Unclassified 1999
259 Ga0501080_0187856 3300049742 Bacteria 1899
260 Ga0501081_0256427 3300049743 Unclassified 1277
261 Ga0501083_0062162 3300049744 Bacteria 2492
262 Ga0501035_0148522 3300049822 Unclassified 2035
263 Ga0501035_1396619 3300049822 Unclassified 537
264 Ga0501044_0178585 3300049823 Unclassified 2091
265 Ga0501045_0153159 3300049824 Bacteria 1715
266 nmdc:mga05p37_246896_c1 3300050507 Bacteria 2142
267 nmdc:mga08y16_124856_c1 3300050511 Bacteria 2677
268 nmdc:mga08y16_64904_c1 3300050511 Bacteria 3812
269 nmdc:mga0n895_225972_c1 3300050512 Bacteria 1900
270 nmdc:mga0n895_254230_c1 3300050512 Unclassified 1783
271 nmdc:mga08x19_172453_c1 3300050514 Unclassified 1473
272 nmdc:mga0a205_7511_c1 3300050515 Bacteria 9874
273 Ga0495601_0231453 3300053077 Bacteria 1207
274 Ga0501084_0058164 3300054114 Bacteria 3235
275 Ga0501084_0295707 3300054114 Unclassified 1367
276 Ga0501082_0050506 3300060353 Unclassified 3586
277 Ga0501082_0221948 3300060353 Bacteria 1644
278 Ga0530510_0330144 3300061734 Bacteria 1144
279 Ga0530510_1204633 3300061734 Bacteria 580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100068690 Ga0070682_1000686902 122
2 3300009098 Ga0105245_10669808 Ga0105245_106698082 122
3 3300006871 Ga0075434_100075778 Ga0075434_1000757782 123
4 3300005440 Ga0070705_100030635 Ga0070705_1000306352 125
5 3300005445 Ga0070708_100000819 Ga0070708_10000081918 125
6 3300005445 Ga0070708_100456255 Ga0070708_1004562553 126
7 3300042435 Ga0439434_0227558 Ga0439434_0227558_224_610 126
8 3300005445 Ga0070708_100059315 Ga0070708_1000593153 127
9 3300005467 Ga0070706_100840717 Ga0070706_1008407172 127
10 3300005468 Ga0070707_100000470 Ga0070707_10000047011 127
11 3300005518 Ga0070699_100002737 Ga0070699_10000273713 127
12 3300025922 Ga0207646_10003416 Ga0207646_1000341611 127
13 3300005334 Ga0068869_100196984 Ga0068869_1001969843 128
14 3300005339 Ga0070660_101109309 Ga0070660_1011093092 128
15 3300005343 Ga0070687_100175837 Ga0070687_1001758372 128
16 3300005345 Ga0070692_11120482 Ga0070692_111204821 128
17 3300005440 Ga0070705_100020761 Ga0070705_1000207613 128
18 3300005440 Ga0070705_100332002 Ga0070705_1003320021 128
19 3300005444 Ga0070694_100446897 Ga0070694_1004468972 128
20 3300005455 Ga0070663_100499282 Ga0070663_1004992822 128
21 3300005468 Ga0070707_100935209 Ga0070707_1009352091 128
22 3300005468 Ga0070707_101266909 Ga0070707_1012669092 128
23 3300005471 Ga0070698_100451214 Ga0070698_1004512142 128
24 3300005518 Ga0070699_100023133 Ga0070699_1000231332 128
25 3300005545 Ga0070695_100060725 Ga0070695_1000607253 128
26 3300005546 Ga0070696_100007410 Ga0070696_1000074104 128
27 3300005546 Ga0070696_100210047 Ga0070696_1002100472 128
28 3300005549 Ga0070704_100006060 Ga0070704_1000060608 128
29 3300005563 Ga0068855_100657410 Ga0068855_1006574102 128
30 3300005719 Ga0068861_101182516 Ga0068861_1011825161 128
31 3300006852 Ga0075433_10059994 Ga0075433_100599944 128
32 3300006871 Ga0075434_102500245 Ga0075434_1025002451 128
33 3300007076 Ga0075435_100053083 Ga0075435_1000530834 128
34 3300009148 Ga0105243_10258710 Ga0105243_102587102 128
35 3300011119 Ga0105246_11260879 Ga0105246_112608792 128
36 3300025901 Ga0207688_10191959 Ga0207688_101919592 128
37 3300025918 Ga0207662_10165548 Ga0207662_101655482 128
38 3300025922 Ga0207646_11064818 Ga0207646_110648182 128
39 3300025927 Ga0207687_10966693 Ga0207687_109666932 128
40 3300025933 Ga0207706_10377028 Ga0207706_103770281 128
41 3300025934 Ga0207686_10164812 Ga0207686_101648121 128
42 3300025935 Ga0207709_10050642 Ga0207709_100506422 128
43 3300025942 Ga0207689_10193010 Ga0207689_101930103 128
44 3300026067 Ga0207678_10892483 Ga0207678_108924832 128
45 3300026075 Ga0207708_10483802 Ga0207708_104838022 128
46 3300046491 Ga0495584_0411696 Ga0495584_0411696_112_525 128
47 3300048905 Ga0496102_0052469 Ga0496102_0052469_2532_2924 128
48 3300048906 Ga0496103_0028951 Ga0496103_0028951_509_901 128
49 3300048909 Ga0496106_0065415 Ga0496106_0065415_1680_2072 128
50 3300048910 Ga0496107_0024738 Ga0496107_0024738_2156_2548 128
51 3300005345 Ga0070692_11149402 Ga0070692_111494021 129
52 3300005536 Ga0070697_100016651 Ga0070697_1000166515 129
53 3300005545 Ga0070695_100101567 Ga0070695_1001015672 129
54 3300013297 Ga0157378_11584662 Ga0157378_115846621 129
55 3300025918 Ga0207662_10443927 Ga0207662_104439272 129
56 3300025922 Ga0207646_10017797 Ga0207646_100177975 129
57 3300005338 Ga0068868_100169495 Ga0068868_1001694952 130
58 3300005354 Ga0070675_100742399 Ga0070675_1007423991 130
59 3300005356 Ga0070674_100317793 Ga0070674_1003177932 130
60 3300005438 Ga0070701_10085301 Ga0070701_100853013 130
61 3300005438 Ga0070701_10386394 Ga0070701_103863941 130
62 3300005441 Ga0070700_100008693 Ga0070700_1000086932 130
63 3300005444 Ga0070694_100321853 Ga0070694_1003218531 130
64 3300005471 Ga0070698_100014399 Ga0070698_1000143997 130
65 3300005536 Ga0070697_100249445 Ga0070697_1002494453 130
66 3300005546 Ga0070696_100052906 Ga0070696_1000529065 130
67 3300005549 Ga0070704_100024509 Ga0070704_1000245093 130
68 3300005564 Ga0070664_100466501 Ga0070664_1004665013 130
69 3300005578 Ga0068854_100920686 Ga0068854_1009206861 130
70 3300005617 Ga0068859_100456596 Ga0068859_1004565964 130
71 3300005618 Ga0068864_101456708 Ga0068864_1014567081 130
72 3300005719 Ga0068861_100016007 Ga0068861_1000160073 130
73 3300005840 Ga0068870_10237901 Ga0068870_102379013 130
74 3300005843 Ga0068860_101017520 Ga0068860_1010175201 130
75 3300005844 Ga0068862_100264672 Ga0068862_1002646724 130
76 3300005985 Ga0081539_10004730 Ga0081539_100047304 130
77 3300006844 Ga0075428_100862787 Ga0075428_1008627872 130
78 3300006880 Ga0075429_100997551 Ga0075429_1009975511 130
79 3300006931 Ga0097620_100456614 Ga0097620_1004566142 130
80 3300009094 Ga0111539_10205595 Ga0111539_102055953 130
81 3300009094 Ga0111539_10443300 Ga0111539_104433002 130
82 3300009098 Ga0105245_10046515 Ga0105245_100465152 130
83 3300009147 Ga0114129_10398524 Ga0114129_103985242 130
84 3300009147 Ga0114129_11202293 Ga0114129_112022931 130
85 3300009147 Ga0114129_13130246 Ga0114129_131302462 130
86 3300009148 Ga0105243_10084561 Ga0105243_100845614 130
87 3300009553 Ga0105249_11271934 Ga0105249_112719341 130
88 3300011119 Ga0105246_10236637 Ga0105246_102366372 130
89 3300011119 Ga0105246_10488495 Ga0105246_104884953 130
90 3300025901 Ga0207688_10776484 Ga0207688_107764841 130
91 3300025908 Ga0207643_10220476 Ga0207643_102204763 130
92 3300025910 Ga0207684_10087217 Ga0207684_100872173 130
93 3300025942 Ga0207689_10008751 Ga0207689_100087513 130
94 3300025942 Ga0207689_10640575 Ga0207689_106405753 130
95 3300025961 Ga0207712_10960008 Ga0207712_109600082 130
96 3300025981 Ga0207640_11286435 Ga0207640_112864351 130
97 3300026089 Ga0207648_10214013 Ga0207648_102140132 130
98 3300026095 Ga0207676_10326436 Ga0207676_103264362 130
99 3300026116 Ga0207674_10427774 Ga0207674_104277743 130
100 3300027665 Ga0209983_1026339 Ga0209983_10263392 130
101 3300027682 Ga0209971_1058952 Ga0209971_10589521 130
102 3300027907 Ga0207428_10056839 Ga0207428_100568392 130
103 3300027907 Ga0207428_10276094 Ga0207428_102760942 130
104 3300028380 Ga0268265_10701133 Ga0268265_107011332 130
105 3300031852 Ga0307410_10041258 Ga0307410_100412585 130
106 3300031852 Ga0307410_10414055 Ga0307410_104140552 130
107 3300031995 Ga0307409_100054065 Ga0307409_1000540653 130
108 3300032004 Ga0307414_11082030 Ga0307414_110820301 130
109 3300032126 Ga0307415_101048038 Ga0307415_1010480382 130
110 3300042147 Ga0450910_007258 Ga0450910_007258_767_1162 130
111 3300048905 Ga0496102_0650244 Ga0496102_0650244_461_853 130
112 3300049568 Ga0501031_0022606 Ga0501031_0022606_1393_1785 130
113 3300049569 Ga0501032_0158371 Ga0501032_0158371_35_427 130
114 3300049569 Ga0501032_0242725 Ga0501032_0242725_25_417 130
115 3300049570 Ga0501033_0050585 Ga0501033_0050585_186_578 130
116 3300049571 Ga0501034_0756623 Ga0501034_0756623_25_417 130
117 3300049572 Ga0501036_0014745 Ga0501036_0014745_3338_3730 130
118 3300049573 Ga0501037_0021150 Ga0501037_0021150_3139_3531 130
119 3300049574 Ga0501038_0101262 Ga0501038_0101262_631_1023 130
120 3300049575 Ga0501039_0013001 Ga0501039_0013001_5649_6041 130
121 3300049576 Ga0501040_0222376 Ga0501040_0222376_266_658 130
122 3300049577 Ga0501041_0016408 Ga0501041_0016408_701_1093 130
123 3300049579 Ga0501043_0265057 Ga0501043_0265057_83_475 130
124 3300049580 Ga0501046_0067261 Ga0501046_0067261_159_551 130
125 3300049582 Ga0501048_0288719 Ga0501048_0288719_710_1102 130
126 3300049583 Ga0501067_0141412 Ga0501067_0141412_540_974 130
127 3300049584 Ga0501068_0252022 Ga0501068_0252022_580_972 130
128 3300049585 Ga0501069_0070179 Ga0501069_0070179_945_1337 130
129 3300049586 Ga0501070_0165880 Ga0501070_0165880_1244_1636 130
130 3300049587 Ga0501071_0025885 Ga0501071_0025885_2373_2765 130
131 3300049588 Ga0501072_0137568 Ga0501072_0137568_208_600 130
132 3300049589 Ga0501073_0066604 Ga0501073_0066604_235_627 130
133 3300049590 Ga0501074_0205281 Ga0501074_0205281_262_654 130
134 3300049591 Ga0501075_0196679 Ga0501075_0196679_545_937 130
135 3300049593 Ga0501077_0011500 Ga0501077_0011500_2194_2586 130
136 3300049742 Ga0501080_0187856 Ga0501080_0187856_1459_1851 130
137 3300049743 Ga0501081_0256427 Ga0501081_0256427_188_580 130
138 3300049744 Ga0501083_0062162 Ga0501083_0062162_646_1038 130
139 3300049822 Ga0501035_0148522 Ga0501035_0148522_854_1246 130
140 3300049823 Ga0501044_0178585 Ga0501044_0178585_726_1118 130
141 3300049824 Ga0501045_0153159 Ga0501045_0153159_105_497 130
142 3300050507 nmdc:mga05p37_246896_c1 nmdc:mga05p37_246896_c1_1417_1809 130
143 3300050511 nmdc:mga08y16_64904_c1 nmdc:mga08y16_64904_c1_1682_2074 130
144 3300050515 nmdc:mga0a205_7511_c1 nmdc:mga0a205_7511_c1_7844_8236 130
145 3300054114 Ga0501084_0295707 Ga0501084_0295707_918_1310 130
146 3300060353 Ga0501082_0221948 Ga0501082_0221948_745_1137 130
147 3300061734 Ga0530510_1204633 Ga0530510_1204633_145_537 130
148 3300005336 Ga0070680_101521452 Ga0070680_1015214522 131
149 3300005338 Ga0068868_100340739 Ga0068868_1003407391 131
150 3300005366 Ga0070659_100068352 Ga0070659_1000683521 131
151 3300005439 Ga0070711_101214727 Ga0070711_1012147272 131
152 3300005440 Ga0070705_101376898 Ga0070705_1013768981 131
153 3300005444 Ga0070694_100004129 Ga0070694_1000041295 131
154 3300005444 Ga0070694_100119305 Ga0070694_1001193054 131
155 3300005467 Ga0070706_100423707 Ga0070706_1004237073 131
156 3300005468 Ga0070707_100000730 Ga0070707_10000073011 131
157 3300005530 Ga0070679_100144533 Ga0070679_1001445334 131
158 3300005545 Ga0070695_100094052 Ga0070695_1000940522 131
159 3300005545 Ga0070695_100273377 Ga0070695_1002733771 131
160 3300005546 Ga0070696_100021535 Ga0070696_1000215355 131
161 3300005546 Ga0070696_100067189 Ga0070696_1000671894 131
162 3300005549 Ga0070704_100014833 Ga0070704_1000148335 131
163 3300005549 Ga0070704_100106611 Ga0070704_1001066112 131
164 3300005577 Ga0068857_100898518 Ga0068857_1008985182 131
165 3300005842 Ga0068858_100695573 Ga0068858_1006955732 131
166 3300005843 Ga0068860_100030951 Ga0068860_1000309513 131
167 3300005844 Ga0068862_100182049 Ga0068862_1001820492 131
168 3300006173 Ga0070716_100445956 Ga0070716_1004459562 131
169 3300009098 Ga0105245_10216041 Ga0105245_102160414 131
170 3300009176 Ga0105242_10645903 Ga0105242_106459032 131
171 3300009553 Ga0105249_10037180 Ga0105249_100371803 131
172 3300009553 Ga0105249_11090151 Ga0105249_110901512 131
173 3300010375 Ga0105239_10083578 Ga0105239_100835782 131
174 3300013297 Ga0157378_11035354 Ga0157378_110353541 131
175 3300013306 Ga0163162_10361885 Ga0163162_103618853 131
176 3300013308 Ga0157375_12734145 Ga0157375_127341452 131
177 3300014497 Ga0182008_10079880 Ga0182008_100798802 131
178 3300014968 Ga0157379_10317885 Ga0157379_103178854 131
179 3300014968 Ga0157379_11238424 Ga0157379_112384242 131
180 3300025885 Ga0207653_10117690 Ga0207653_101176902 131
181 3300025910 Ga0207684_10011891 Ga0207684_100118916 131
182 3300025910 Ga0207684_10624437 Ga0207684_106244372 131
183 3300025917 Ga0207660_10089341 Ga0207660_100893412 131
184 3300025922 Ga0207646_10002379 Ga0207646_1000237921 131
185 3300025922 Ga0207646_10423622 Ga0207646_104236222 131
186 3300025934 Ga0207686_10215854 Ga0207686_102158542 131
187 3300025939 Ga0207665_11401919 Ga0207665_114019192 131
188 3300026023 Ga0207677_10242043 Ga0207677_102420434 131
189 3300028380 Ga0268265_10394543 Ga0268265_103945432 131
190 3300035116 Ga0373945_0227463 Ga0373945_0227463_319_726 131
191 3300035170 Ga0373943_0114243 Ga0373943_0114243_170_577 131
192 3300035725 Ga0373947_0277405 Ga0373947_0277405_196_603 131
193 3300037068 Ga0373925_0993697 Ga0373925_0993697_255_662 131
194 3300045051 Ga0451576_0627618 Ga0451576_0627618_657_1091 131
195 3300046516 Ga0495628_0888076 Ga0495628_0888076_82_489 131
196 3300046681 Ga0495647_0073899 Ga0495647_0073899_324_731 131
197 3300046683 Ga0495658_0258828 Ga0495658_0258828_14_421 131
198 3300048903 Ga0496100_0781277 Ga0496100_0781277_114_551 131
199 3300048905 Ga0496102_0098114 Ga0496102_0098114_1908_2315 131
200 3300048905 Ga0496102_0221837 Ga0496102_0221837_1195_1602 131
201 3300048905 Ga0496102_0378646 Ga0496102_0378646_100_507 131
202 3300048906 Ga0496103_0157481 Ga0496103_0157481_201_608 131
203 3300048908 Ga0496105_0640127 Ga0496105_0640127_333_740 131
204 3300048908 Ga0496105_0977316 Ga0496105_0977316_176_583 131
205 3300048909 Ga0496106_0409198 Ga0496106_0409198_490_885 131
206 3300048911 Ga0496108_0819056 Ga0496108_0819056_28_435 131
207 3300048914 Ga0496111_0148576 Ga0496111_0148576_463_870 131
208 3300048915 Ga0496112_0003631 Ga0496112_0003631_6579_6986 131
209 3300048917 Ga0496114_0561193 Ga0496114_0561193_371_778 131
210 3300050512 nmdc:mga0n895_225972_c1 nmdc:mga0n895_225972_c1_1358_1765 131
211 3300050514 nmdc:mga08x19_172453_c1 nmdc:mga08x19_172453_c1_945_1352 131
212 3300053077 Ga0495601_0231453 Ga0495601_0231453_347_754 131
213 3300005445 Ga0070708_100001093 Ga0070708_1000010933 133
214 3300005536 Ga0070697_100201997 Ga0070697_1002019972 133
215 3300005618 Ga0068864_100480019 Ga0068864_1004800192 133
216 3300005843 Ga0068860_100301901 Ga0068860_1003019013 133
217 3300009098 Ga0105245_10192470 Ga0105245_101924702 133
218 3300014968 Ga0157379_10004420 Ga0157379_100044203 133
219 3300025910 Ga0207684_10017925 Ga0207684_100179254 133
220 3300025922 Ga0207646_11375519 Ga0207646_113755191 133
221 3300042435 Ga0439434_0036818 Ga0439434_0036818_1069_1476 133
222 3300042436 Ga0439435_0137580 Ga0439435_0137580_26_460 133
223 3300042876 Ga0451577_0054316 Ga0451577_0054316_1569_1985 133
224 3300044712 Ga0453684_0299026 Ga0453684_0299026_1039_1455 133
225 3300045051 Ga0451576_0320328 Ga0451576_0320328_135_554 133
226 3300048912 Ga0496109_1628336 Ga0496109_1628336_85_489 133
227 3300049585 Ga0501069_0152663 Ga0501069_0152663_718_1134 133
228 3300005440 Ga0070705_100077824 Ga0070705_1000778243 134
229 3300005444 Ga0070694_100416471 Ga0070694_1004164712 134
230 3300005445 Ga0070708_100005467 Ga0070708_1000054679 134
231 3300005445 Ga0070708_100474012 Ga0070708_1004740122 134
232 3300005458 Ga0070681_10218382 Ga0070681_102183822 134
233 3300005471 Ga0070698_101817102 Ga0070698_1018171021 134
234 3300005518 Ga0070699_100266802 Ga0070699_1002668022 134
235 3300005536 Ga0070697_100151940 Ga0070697_1001519402 134
236 3300005549 Ga0070704_100484635 Ga0070704_1004846351 134
237 3300005718 Ga0068866_10319435 Ga0068866_103194352 134
238 3300006931 Ga0097620_100516035 Ga0097620_1005160352 134
239 3300009094 Ga0111539_10182364 Ga0111539_101823643 134
240 3300009148 Ga0105243_10235969 Ga0105243_102359692 134
241 3300009148 Ga0105243_10573913 Ga0105243_105739132 134
242 3300009553 Ga0105249_10303157 Ga0105249_103031572 134
243 3300017792 Ga0163161_10107090 Ga0163161_101070902 134
244 3300025910 Ga0207684_10008158 Ga0207684_100081584 134
245 3300025910 Ga0207684_10010499 Ga0207684_100104998 134
246 3300025935 Ga0207709_10853472 Ga0207709_108534722 134
247 3300025961 Ga0207712_10831898 Ga0207712_108318982 134
248 3300048903 Ga0496100_0326210 Ga0496100_0326210_637_1068 134
249 3300048905 Ga0496102_0442632 Ga0496102_0442632_281_712 134
250 3300048907 Ga0496104_0351667 Ga0496104_0351667_392_823 134
251 3300048910 Ga0496107_0401690 Ga0496107_0401690_32_463 134
252 3300048911 Ga0496108_0044041 Ga0496108_0044041_3090_3521 134
253 3300048912 Ga0496109_0375880 Ga0496109_0375880_625_1056 134
254 3300048912 Ga0496109_0533690 Ga0496109_0533690_654_1070 134
255 3300048913 Ga0496110_0236016 Ga0496110_0236016_1023_1454 134
256 3300048914 Ga0496111_0122010 Ga0496111_0122010_540_971 134
257 3300048917 Ga0496114_0219341 Ga0496114_0219341_600_1031 134
258 3300049568 Ga0501031_0535776 Ga0501031_0535776_94_498 134
259 3300049572 Ga0501036_0417934 Ga0501036_0417934_539_943 134
260 3300049572 Ga0501036_0680561 Ga0501036_0680561_371_781 134
261 3300049575 Ga0501039_0140229 Ga0501039_0140229_1281_1685 134
262 3300049576 Ga0501040_0140197 Ga0501040_0140197_1074_1478 134
263 3300049578 Ga0501042_0153281 Ga0501042_0153281_1144_1548 134
264 3300049579 Ga0501043_0202405 Ga0501043_0202405_661_1065 134
265 3300049580 Ga0501046_0574231 Ga0501046_0574231_124_528 134
266 3300049584 Ga0501068_0164598 Ga0501068_0164598_187_609 134
267 3300049586 Ga0501070_0323600 Ga0501070_0323600_10_414 134
268 3300049587 Ga0501071_0244974 Ga0501071_0244974_430_834 134
269 3300049588 Ga0501072_0206470 Ga0501072_0206470_747_1151 134
270 3300049591 Ga0501075_0033088 Ga0501075_0033088_2131_2535 134
271 3300049741 Ga0501079_0125245 Ga0501079_0125245_581_985 134
272 3300049822 Ga0501035_1396619 Ga0501035_1396619_52_462 134
273 3300050511 nmdc:mga08y16_124856_c1 nmdc:mga08y16_124856_c1_1606_2022 134
274 3300050512 nmdc:mga0n895_254230_c1 nmdc:mga0n895_254230_c1_826_1272 134
275 3300054114 Ga0501084_0058164 Ga0501084_0058164_993_1397 134
276 3300060353 Ga0501082_0050506 Ga0501082_0050506_3017_3421 134
277 3300061734 Ga0530510_0330144 Ga0530510_0330144_226_630 134
278 3300003320 rootH2_10297192 rootH2_102971922 135
279 3300003323 rootH1_10133276 rootH1_101332764 135

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z5s-assembly1.cif.gz_W rc-lh1(14)-w complex from rhodopseudomonas palustris 0.6019 33 128
6z5s-assembly1.cif.gz_W rc-lh1(14)-w complex from rhodopseudomonas palustris 0.5491 33 128
4mhw-assembly1.cif.gz_A crystal structure of thit with small molecule bat-25 0.5154 60 134
7y8a-assembly1.cif.gz_L cryo-em structure of cryptophyte photosystem i 0.4819 13 130
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.4693 29 131
ID Description Score Start End Superfamily
af_A0A1D6H4R6_249_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5524 29 132 1.20.1250.20
af_A0A0R0I9X1_239_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5433 29 133 1.20.1250.20
af_Q54DM2_248_409_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5386 29 127 1.20.1250.20
af_Q9UT92_325_480_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5354 29 133 1.20.1250.20
4mhwA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5154 60 134 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A535PDC2-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.9666 31 135 GO:0016020
AF-A0A535PDC2-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.9488 31 135 GO:0016020
AF-A0A535VUC3-F1-model_v4 Yip1 domain-containing protein 0.8571 12 135 GO:0016020
AF-A0A536GDT4-F1-model_v4 Uncharacterized protein 0.8561 4 135 GO:0016020
AF-A0A1F8LP10-F1-model_v4 Yip1 domain-containing protein 0.8516 1 134 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.97 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map