F382821

General Info

Members Datasets Scaffolds Average Seq Length
279 171 279 123

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11039618|Ga0070658_110396181
Length 139
Sequence MKLFDVSFSYNSIPTGITMETERLCLTCNKPLKGRTDKKFCDDYCRNNYNNQLKSNTINLVRNINNALGKNRRVLENFFHGGEETVKTTKDKLLEKGFQFKYFTNTYTNKKGNVYFFCYDIGYLPLENGWYLLVKKKEE

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
119 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
120 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
123 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
124 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
125 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
130 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
157 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
162 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 1.43
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000562 3300002459 Bacteria 10103
2 rootH1_10237580 3300003323 Bacteria 5278
3 rootH1_10318249 3300003323 Unclassified 1534
4 JGI25160J50197_1000193 3300003354 Bacteria 51332
5 Ga0065714_10109739 3300005288 Bacteria 1495
6 Ga0065714_10242803 3300005288 Bacteria 791
7 Ga0065704_10163164 3300005289 Bacteria 1340
8 Ga0065707_10115102 3300005295 Bacteria 2277
9 Ga0070658_11039618 3300005327 Bacteria 712
10 Ga0070658_11938297 3300005327 Unclassified 509
11 Ga0070676_10040063 3300005328 Bacteria 2712
12 Ga0070683_100876590 3300005329 Bacteria 861
13 Ga0070690_100144500 3300005330 Unclassified 1617
14 Ga0070690_100699535 3300005330 Bacteria 778
15 Ga0070670_100008003 3300005331 Bacteria 8989
16 Ga0070670_100316082 3300005331 Bacteria 1368
17 Ga0068869_100028724 3300005334 Bacteria 3890
18 Ga0070666_10343402 3300005335 Bacteria 1067
19 Ga0070680_100138019 3300005336 Bacteria 2044
20 Ga0070682_100211575 3300005337 Bacteria 1374
21 Ga0070682_100362188 3300005337 Bacteria 1085
22 Ga0068868_100328835 3300005338 Bacteria 1304
23 Ga0068868_100811612 3300005338 Unclassified 845
24 Ga0070689_100116560 3300005340 Bacteria 2130
25 Ga0070689_101746787 3300005340 Bacteria 567
26 Ga0070661_100913217 3300005344 Bacteria 725
27 Ga0070661_101123057 3300005344 Bacteria 655
28 Ga0070668_100205860 3300005347 Bacteria 1617
29 Ga0070669_100008323 3300005353 Bacteria 7405
30 Ga0070669_100457145 3300005353 Bacteria 1053
31 Ga0070669_100857612 3300005353 Bacteria 774
32 Ga0070675_100006453 3300005354 Bacteria 9003
33 Ga0070675_101099194 3300005354 Bacteria 731
34 Ga0070671_100724976 3300005355 Unclassified 863
35 Ga0070671_101374626 3300005355 Unclassified 623
36 Ga0070674_101241338 3300005356 Bacteria 663
37 Ga0070673_101441471 3300005364 Bacteria 649
38 Ga0070688_100156764 3300005365 Bacteria 1561
39 Ga0070667_100377468 3300005367 Bacteria 1287
40 Ga0070700_100124248 3300005441 Bacteria 1733
41 Ga0070700_100166654 3300005441 Bacteria 1522
42 Ga0070663_100043593 3300005455 Bacteria 3158
43 Ga0070662_100024107 3300005457 Bacteria 4187
44 Ga0070681_10181430 3300005458 Bacteria 2027
45 Ga0070681_10663560 3300005458 Unclassified 958
46 Ga0068867_100033953 3300005459 Bacteria 3697
47 Ga0068867_100526944 3300005459 Bacteria 1020
48 Ga0068867_101010826 3300005459 Bacteria 754
49 Ga0070685_10637559 3300005466 Bacteria 771
50 Ga0070679_100000516 3300005530 Bacteria 32885
51 Ga0070679_100056862 3300005530 Bacteria 3898
52 Ga0070679_100429339 3300005530 Bacteria 1266
53 Ga0070684_100304732 3300005535 Bacteria 1462
54 Ga0070684_102105366 3300005535 Bacteria 532
55 Ga0068853_100223648 3300005539 Bacteria 1720
56 Ga0068853_100248258 3300005539 Bacteria 1632
57 Ga0068853_100823500 3300005539 Unclassified 889
58 Ga0068853_101323917 3300005539 Bacteria 696
59 Ga0070672_100136808 3300005543 Bacteria 2018
60 Ga0070672_100166134 3300005543 Bacteria 1833
61 Ga0070672_101645005 3300005543 Unclassified 576
62 Ga0070665_100226722 3300005548 Bacteria 1869
63 Ga0070704_100220737 3300005549 Bacteria 1541
64 Ga0068855_100233439 3300005563 Bacteria 2058
65 Ga0068855_100587966 3300005563 Bacteria 1202
66 Ga0068857_100086455 3300005577 Bacteria 2804
67 Ga0068857_100249124 3300005577 Bacteria 1628
68 Ga0068857_101368930 3300005577 Unclassified 688
69 Ga0068854_100119185 3300005578 Bacteria 2001
70 Ga0068854_100363362 3300005578 Bacteria 1188
71 Ga0068856_100007984 3300005614 Bacteria 10334
72 Ga0068852_100004411 3300005616 Bacteria 9946
73 Ga0068852_100078968 3300005616 Bacteria 2913
74 Ga0068852_100580426 3300005616 Bacteria 1124
75 Ga0068852_101467631 3300005616 Bacteria 704
76 Ga0068852_101860032 3300005616 Bacteria 624
77 Ga0068859_100049953 3300005617 Bacteria 4201
78 Ga0068859_100058625 3300005617 Bacteria 3878
79 Ga0068859_100788620 3300005617 Bacteria 1038
80 Ga0068864_100005829 3300005618 Bacteria 10102
81 Ga0068864_100191516 3300005618 Bacteria 1875
82 Ga0068864_101394209 3300005618 Bacteria 702
83 Ga0068861_100004644 3300005719 Bacteria 9218
84 Ga0068861_101469833 3300005719 Bacteria 668
85 Ga0068851_10059444 3300005834 Bacteria 1955
86 Ga0068851_10901263 3300005834 Bacteria 554
87 Ga0068870_10026880 3300005840 Bacteria 2873
88 Ga0068863_100455483 3300005841 Unclassified 1256
89 Ga0068860_100206160 3300005843 Unclassified 1906
90 Ga0068860_101960519 3300005843 Bacteria 607
91 Ga0068862_100018041 3300005844 Bacteria 5877
92 Ga0068862_100356374 3300005844 Bacteria 1359
93 Ga0068862_100832937 3300005844 Bacteria 903
94 Ga0070715_10276984 3300006163 Unclassified 888
95 Ga0075366_10003077 3300006195 Bacteria 8706
96 Ga0097621_100843389 3300006237 Bacteria 851
97 Ga0097621_100914797 3300006237 Unclassified 818
98 Ga0068871_100003998 3300006358 Bacteria 10202
99 Ga0068871_100427917 3300006358 Unclassified 1183
100 Ga0068871_101648701 3300006358 Bacteria 608
101 Ga0075430_101476078 3300006846 Bacteria 559
102 Ga0068865_100080037 3300006881 Bacteria 2342
103 Ga0068865_100874346 3300006881 Bacteria 780
104 Ga0097620_100049951 3300006931 Bacteria 4201
105 Ga0097620_100058628 3300006931 Bacteria 3878
106 Ga0097620_100788542 3300006931 Bacteria 1038
107 Ga0105240_10155814 3300009093 Bacteria 2717
108 Ga0111539_10007083 3300009094 Bacteria 14371
109 Ga0111539_10853849 3300009094 Bacteria 1059
110 Ga0105241_10013489 3300009174 Bacteria 5989
111 Ga0105241_10277134 3300009174 Bacteria 1431
112 Ga0105242_11413099 3300009176 Bacteria 724
113 Ga0105237_10032378 3300009545 Bacteria 5293
114 Ga0105237_10317308 3300009545 Unclassified 1562
115 Ga0105249_10000434 3300009553 Bacteria 39679
116 Ga0105249_10013174 3300009553 Bacteria 7296
117 Ga0105249_10014805 3300009553 Bacteria 6895
118 Ga0105249_10379442 3300009553 Bacteria 1439
119 Ga0105249_10509540 3300009553 Bacteria 1249
120 Ga0105246_10161670 3300011119 Bacteria 1706
121 Ga0105246_10941563 3300011119 Bacteria 778
122 Ga0157373_10315208 3300013100 Unclassified 1112
123 Ga0157371_10346450 3300013102 Bacteria 1081
124 Ga0157371_10388184 3300013102 Unclassified 1020
125 Ga0157370_10472800 3300013104 Bacteria 1152
126 Ga0157370_11111306 3300013104 Bacteria 714
127 Ga0157370_11423167 3300013104 Bacteria 624
128 Ga0157369_10081721 3300013105 Bacteria 3458
129 Ga0157369_10522154 3300013105 Bacteria 1228
130 Ga0157369_10706020 3300013105 Unclassified 1038
131 Ga0157378_10006062 3300013297 Bacteria 10593
132 Ga0157378_10925981 3300013297 Bacteria 903
133 Ga0157378_11135573 3300013297 Bacteria 819
134 Ga0157378_12610748 3300013297 Bacteria 557
135 Ga0163162_10093348 3300013306 Bacteria 3094
136 Ga0163162_10357750 3300013306 Unclassified 1593
137 Ga0163162_10409817 3300013306 Unclassified 1488
138 Ga0163162_11347956 3300013306 Bacteria 811
139 Ga0157372_10030554 3300013307 Bacteria 5893
140 Ga0157372_10474584 3300013307 Bacteria 1458
141 Ga0157372_10827964 3300013307 Bacteria 1075
142 Ga0157372_11435104 3300013307 Unclassified 795
143 Ga0157372_12147558 3300013307 Unclassified 642
144 Ga0157375_10024522 3300013308 Bacteria 5584
145 Ga0157375_10247011 3300013308 Bacteria 1945
146 Ga0157375_10666148 3300013308 Bacteria 1196
147 Ga0157375_13153458 3300013308 Bacteria 550
148 Ga0163163_10295496 3300014325 Bacteria 1672
149 Ga0163163_10334387 3300014325 Unclassified 1569
150 Ga0163163_10441221 3300014325 Bacteria 1361
151 Ga0163163_11915623 3300014325 Bacteria 653
152 Ga0157380_10091460 3300014326 Bacteria 2512
153 Ga0157380_10839899 3300014326 Unclassified 939
154 Ga0157380_11019689 3300014326 Bacteria 862
155 Ga0157380_11672698 3300014326 Bacteria 693
156 Ga0157377_10197193 3300014745 Unclassified 1276
157 Ga0157379_11439613 3300014968 Unclassified 669
158 Ga0157379_11859432 3300014968 Unclassified 593
159 Ga0157376_10329875 3300014969 Unclassified 1454
160 Ga0163161_10095240 3300017792 Unclassified 2208
161 Ga0163161_10428563 3300017792 Bacteria 1065
162 Ga0213876_10420459 3300021384 Unclassified 711
163 Ga0207426_1000026 3300025302 Bacteria 515228
164 Ga0207705_10015882 3300025909 Bacteria 5406
165 Ga0207705_10804811 3300025909 Bacteria 729
166 Ga0207654_10034782 3300025911 Bacteria 2801
167 Ga0207707_10255016 3300025912 Bacteria 1523
168 Ga0207695_11471211 3300025913 Bacteria 561
169 Ga0207660_10117135 3300025917 Bacteria 2013
170 Ga0207652_10000778 3300025921 Bacteria 30494
171 Ga0207681_10739001 3300025923 Bacteria 820
172 Ga0207681_11606710 3300025923 Bacteria 544
173 Ga0207650_10209376 3300025925 Bacteria 1565
174 Ga0207644_10227274 3300025931 Bacteria 1482
175 Ga0207644_11699704 3300025931 Unclassified 529
176 Ga0207704_11658287 3300025938 Bacteria 549
177 Ga0207691_10617732 3300025940 Bacteria 917
178 Ga0207691_10979868 3300025940 Unclassified 706
179 Ga0207667_10027905 3300025949 Bacteria 6136
180 Ga0207712_10010896 3300025961 Bacteria 5787
181 Ga0207712_10085644 3300025961 Unclassified 2307
182 Ga0207640_10197349 3300025981 Bacteria 1522
183 Ga0207640_11106335 3300025981 Unclassified 701
184 Ga0207640_11395958 3300025981 Bacteria 627
185 Ga0207658_10140370 3300025986 Bacteria 1954
186 Ga0207658_11291720 3300025986 Bacteria 667
187 Ga0207677_10381137 3300026023 Bacteria 1190
188 Ga0207639_10917055 3300026041 Bacteria 819
189 Ga0207639_10945536 3300026041 Bacteria 806
190 Ga0207639_11101639 3300026041 Bacteria 745
191 Ga0207678_10071057 3300026067 Bacteria 2984
192 Ga0207678_10388660 3300026067 Unclassified 1207
193 Ga0207708_10462475 3300026075 Bacteria 1058
194 Ga0207708_10726594 3300026075 Bacteria 851
195 Ga0207702_10360002 3300026078 Bacteria 1394
196 Ga0207641_11709461 3300026088 Bacteria 631
197 Ga0207648_10111430 3300026089 Unclassified 2402
198 Ga0207676_10015007 3300026095 Bacteria 5584
199 Ga0207676_10264320 3300026095 Bacteria 1555
200 Ga0207674_10135517 3300026116 Bacteria 2424
201 Ga0207674_10144591 3300026116 Bacteria 2337
202 Ga0207674_11114780 3300026116 Unclassified 758
203 Ga0207674_11593307 3300026116 Bacteria 622
204 Ga0207675_101658582 3300026118 Bacteria 659
205 Ga0207698_10028338 3300026142 Bacteria 3992
206 Ga0207698_10139623 3300026142 Unclassified 2085
207 Ga0207698_10876385 3300026142 Bacteria 904
208 Ga0207428_11305454 3300027907 Bacteria 503
209 Ga0268266_10188574 3300028379 Bacteria 1882
210 Ga0268265_10579433 3300028380 Bacteria 1069
211 Ga0268265_11791890 3300028380 Bacteria 620
212 Ga0268265_12525206 3300028380 Unclassified 520
213 Ga0268264_10176282 3300028381 Bacteria 1938
214 Ga0268264_10604251 3300028381 Unclassified 1081
215 Ga0307509_10077584 3300031507 Bacteria 3445
216 Ga0307516_10275047 3300031730 Bacteria 1368
217 Ga0307406_11027096 3300031901 Unclassified 708
218 Ga0307414_10777088 3300032004 Bacteria 872
219 Ga0307415_100344075 3300032126 Unclassified 1253
220 Ga0436365_0985326 3300039437 Unclassified 1006
221 Ga0436365_1117886 3300039437 Bacteria 1303
222 Ga0439439_0056048 3300041406 Unclassified 1041
223 Ga0439461_0050551 3300041410 Unclassified 921
224 Ga0451800_0388003 3300041459 Bacteria 607
225 Ga0451807_1509945 3300041486 Unclassified 637
226 Ga0451851_1063005 3300041507 Unclassified 743
227 Ga0439431_0103439 3300041997 Unclassified 784
228 Ga0439442_049424 3300042002 Bacteria 887
229 Ga0439432_024415 3300042006 Bacteria 1987
230 Ga0439449_0123290 3300042007 Unclassified 962
231 Ga0439457_027220 3300042014 Bacteria 1266
232 Ga0439462_0077551 3300042015 Unclassified 906
233 Ga0450922_018757 3300042124 Bacteria 704
234 Ga0450897_007154 3300042128 Bacteria 1013
235 Ga0439446_0305011 3300042156 Bacteria 560
236 Ga0439434_0035358 3300042435 Bacteria 1527
237 Ga0450893_0027645 3300042532 Bacteria 1001
238 Ga0453683_0416871 3300044673 Bacteria 866
239 Ga0453684_2054895 3300044712 Unclassified 574
240 Ga0495621_0172631 3300046539 Bacteria 860
241 Ga0495625_0035400 3300046660 Bacteria 3681
242 Ga0495669_0629131 3300046684 Unclassified 522
243 Ga0495672_0288920 3300047320 Bacteria 781
244 Ga0496105_1182980 3300048908 Bacteria 564
245 Ga0496110_1113450 3300048913 Bacteria 698
246 Ga0501034_0011665 3300049571 Bacteria 9095
247 Ga0501036_0014298 3300049572 Bacteria 6605
248 Ga0501037_0030794 3300049573 Bacteria 3963
249 Ga0501039_0063102 3300049575 Bacteria 2871
250 Ga0501043_0003382 3300049579 Bacteria 13136
251 Ga0501047_0113373 3300049581 Bacteria 2593
252 Ga0501048_0135671 3300049582 Bacteria 1739
253 Ga0501067_0086062 3300049583 Bacteria 1744
254 Ga0501073_0080122 3300049589 Bacteria 2272
255 Ga0501073_0486799 3300049589 Unclassified 853
256 Ga0501074_0001989 3300049590 Bacteria 14073
257 Ga0501201_015186 3300049651 Bacteria 782
258 Ga0501202_010285 3300049652 Bacteria 1733
259 Ga0501227_132270 3300049665 Unclassified 680
260 Ga0501235_050344 3300049669 Unclassified 964
261 Ga0501236_089083 3300049670 Unclassified 590
262 Ga0501238_051291 3300049671 Unclassified 619
263 Ga0501225_0031532 3300049705 Bacteria 1458
264 Ga0501080_0092401 3300049742 Bacteria 2810
265 Ga0501080_0386263 3300049742 Unclassified 1261
266 Ga0501080_1150799 3300049742 Unclassified 668
267 Ga0501083_0023096 3300049744 Bacteria 4316
268 Ga0501273_046224 3300049770 Unclassified 656
269 Ga0501280_086829 3300049776 Unclassified 584
270 Ga0501035_0508056 3300049822 Bacteria 991
271 Ga0501044_0095824 3300049823 Bacteria 2990
272 Ga0501044_0552978 3300049823 Unclassified 1048
273 Ga0501045_0301446 3300049824 Bacteria 1193
274 Ga0501212_041875 3300049851 Bacteria 759
275 nmdc:mga0qj67_934437_c1 3300050509 Bacteria 682
276 nmdc:mga08y16_870651_c1 3300050511 Bacteria 889
277 Ga0500594_0030356 3300053118 Bacteria 1419
278 Ga0500604_0184122 3300053151 Unclassified 716
279 Ga0501084_0090971 3300054114 Bacteria 2562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10163164 Ga0065704_101631643 102
2 3300005295 Ga0065707_10115102 Ga0065707_101151023 102
3 3300005328 Ga0070676_10040063 Ga0070676_100400632 102
4 3300005330 Ga0070690_100699535 Ga0070690_1006995352 102
5 3300005331 Ga0070670_100316082 Ga0070670_1003160821 102
6 3300005334 Ga0068869_100028724 Ga0068869_1000287243 102
7 3300005340 Ga0070689_100116560 Ga0070689_1001165604 102
8 3300005344 Ga0070661_101123057 Ga0070661_1011230572 102
9 3300005347 Ga0070668_100205860 Ga0070668_1002058602 102
10 3300005353 Ga0070669_100008323 Ga0070669_1000083237 102
11 3300005354 Ga0070675_100006453 Ga0070675_1000064532 102
12 3300005356 Ga0070674_101241338 Ga0070674_1012413382 102
13 3300005364 Ga0070673_101441471 Ga0070673_1014414712 102
14 3300005365 Ga0070688_100156764 Ga0070688_1001567643 102
15 3300005441 Ga0070700_100124248 Ga0070700_1001242482 102
16 3300005441 Ga0070700_100166654 Ga0070700_1001666542 102
17 3300005457 Ga0070662_100024107 Ga0070662_1000241075 102
18 3300005459 Ga0068867_100033953 Ga0068867_1000339533 102
19 3300005466 Ga0070685_10637559 Ga0070685_106375592 102
20 3300005543 Ga0070672_100166134 Ga0070672_1001661342 102
21 3300005549 Ga0070704_100220737 Ga0070704_1002207372 102
22 3300005577 Ga0068857_100086455 Ga0068857_1000864552 102
23 3300005617 Ga0068859_100058625 Ga0068859_1000586254 102
24 3300005719 Ga0068861_100004644 Ga0068861_1000046444 102
25 3300005840 Ga0068870_10026880 Ga0068870_100268802 102
26 3300005844 Ga0068862_100018041 Ga0068862_1000180415 102
27 3300006881 Ga0068865_100080037 Ga0068865_1000800373 102
28 3300006931 Ga0097620_100058628 Ga0097620_1000586283 102
29 3300009094 Ga0111539_10007083 Ga0111539_1000708313 102
30 3300009553 Ga0105249_10013174 Ga0105249_100131743 102
31 3300011119 Ga0105246_10161670 Ga0105246_101616702 102
32 3300013297 Ga0157378_12610748 Ga0157378_126107481 102
33 3300013306 Ga0163162_10093348 Ga0163162_100933483 102
34 3300013308 Ga0157375_10024522 Ga0157375_100245223 102
35 3300014326 Ga0157380_10091460 Ga0157380_100914602 102
36 3300026075 Ga0207708_10462475 Ga0207708_104624752 102
37 3300049651 Ga0501201_015186 Ga0501201_015186_420_746 103
38 3300039437 Ga0436365_0985326 Ga0436365_0985326_576_947 104
39 3300005841 Ga0068863_100455483 Ga0068863_1004554832 107
40 3300006195 Ga0075366_10003077 Ga0075366_100030772 107
41 3300026088 Ga0207641_11709461 Ga0207641_117094611 107
42 3300003323 rootH1_10237580 rootH1_102375805 113
43 3300049589 Ga0501073_0486799 Ga0501073_0486799_97_465 114
44 3300009553 Ga0105249_10014805 Ga0105249_100148052 115
45 3300025961 Ga0207712_10010896 Ga0207712_100108962 115
46 3300014969 Ga0157376_10329875 Ga0157376_103298751 117
47 3300031901 Ga0307406_11027096 Ga0307406_110270961 117
48 3300049652 Ga0501202_010285 Ga0501202_010285_1041_1436 117
49 3300049665 Ga0501227_132270 Ga0501227_132270_34_429 117
50 3300049669 Ga0501235_050344 Ga0501235_050344_52_447 117
51 3300049670 Ga0501236_089083 Ga0501236_089083_29_424 117
52 3300049671 Ga0501238_051291 Ga0501238_051291_72_467 117
53 3300049705 Ga0501225_0031532 Ga0501225_0031532_473_868 117
54 3300049770 Ga0501273_046224 Ga0501273_046224_57_452 117
55 3300049776 Ga0501280_086829 Ga0501280_086829_33_428 117
56 3300049851 Ga0501212_041875 Ga0501212_041875_303_698 117
57 3300005344 Ga0070661_100913217 Ga0070661_1009132171 120
58 3300005530 Ga0070679_100056862 Ga0070679_1000568625 120
59 3300005616 Ga0068852_101860032 Ga0068852_1018600321 120
60 3300013297 Ga0157378_10925981 Ga0157378_109259812 120
61 3300026142 Ga0207698_10876385 Ga0207698_108763851 120
62 3300044712 Ga0453684_2054895 Ga0453684_2054895_156_533 120
63 3300003354 JGI25160J50197_1000193 JGI25160J50197_100019337 121
64 3300005335 Ga0070666_10343402 Ga0070666_103434022 121
65 3300005337 Ga0070682_100211575 Ga0070682_1002115751 121
66 3300005340 Ga0070689_101746787 Ga0070689_1017467871 121
67 3300005355 Ga0070671_101374626 Ga0070671_1013746261 121
68 3300005455 Ga0070663_100043593 Ga0070663_1000435933 121
69 3300005535 Ga0070684_100304732 Ga0070684_1003047322 121
70 3300005535 Ga0070684_102105366 Ga0070684_1021053661 121
71 3300005539 Ga0068853_100823500 Ga0068853_1008235002 121
72 3300005539 Ga0068853_101323917 Ga0068853_1013239172 121
73 3300005578 Ga0068854_100119185 Ga0068854_1001191853 121
74 3300005616 Ga0068852_101467631 Ga0068852_1014676312 121
75 3300005618 Ga0068864_101394209 Ga0068864_1013942091 121
76 3300005834 Ga0068851_10901263 Ga0068851_109012631 121
77 3300006237 Ga0097621_100843389 Ga0097621_1008433891 121
78 3300013102 Ga0157371_10388184 Ga0157371_103881841 121
79 3300013104 Ga0157370_10472800 Ga0157370_104728001 121
80 3300013104 Ga0157370_11111306 Ga0157370_111113062 121
81 3300013104 Ga0157370_11423167 Ga0157370_114231672 121
82 3300013105 Ga0157369_10081721 Ga0157369_100817213 121
83 3300013105 Ga0157369_10706020 Ga0157369_107060202 121
84 3300013307 Ga0157372_10030554 Ga0157372_100305542 121
85 3300013307 Ga0157372_10474584 Ga0157372_104745843 121
86 3300013307 Ga0157372_10827964 Ga0157372_108279641 121
87 3300013307 Ga0157372_12147558 Ga0157372_121475581 121
88 3300013308 Ga0157375_13153458 Ga0157375_131534582 121
89 3300021384 Ga0213876_10420459 Ga0213876_104204591 121
90 3300025302 Ga0207426_1000026 Ga0207426_1000026222 121
91 3300025931 Ga0207644_10227274 Ga0207644_102272742 121
92 3300025940 Ga0207691_10617732 Ga0207691_106177322 121
93 3300025981 Ga0207640_10197349 Ga0207640_101973492 121
94 3300025981 Ga0207640_11106335 Ga0207640_111063351 121
95 3300026041 Ga0207639_10945536 Ga0207639_109455361 121
96 3300026041 Ga0207639_11101639 Ga0207639_111016392 121
97 3300026067 Ga0207678_10071057 Ga0207678_100710573 121
98 3300026067 Ga0207678_10388660 Ga0207678_103886601 121
99 3300026075 Ga0207708_10726594 Ga0207708_107265941 121
100 3300039437 Ga0436365_1117886 Ga0436365_1117886_487_852 121
101 3300041459 Ga0451800_0388003 Ga0451800_0388003_53_421 121
102 3300041486 Ga0451807_1509945 Ga0451807_1509945_107_478 121
103 3300046684 Ga0495669_0629131 Ga0495669_0629131_128_499 121
104 3300049742 Ga0501080_0386263 Ga0501080_0386263_22_390 121
105 3300049823 Ga0501044_0552978 Ga0501044_0552978_150_518 121
106 3300005843 Ga0068860_101960519 Ga0068860_1019605191 122
107 3300003323 rootH1_10318249 rootH1_103182493 123
108 3300005288 Ga0065714_10109739 Ga0065714_101097391 123
109 3300005288 Ga0065714_10242803 Ga0065714_102428032 123
110 3300005327 Ga0070658_11039618 Ga0070658_110396181 123
111 3300005327 Ga0070658_11938297 Ga0070658_119382971 123
112 3300005329 Ga0070683_100876590 Ga0070683_1008765901 123
113 3300005336 Ga0070680_100138019 Ga0070680_1001380191 123
114 3300005337 Ga0070682_100362188 Ga0070682_1003621882 123
115 3300005338 Ga0068868_100328835 Ga0068868_1003288352 123
116 3300005338 Ga0068868_100811612 Ga0068868_1008116122 123
117 3300005353 Ga0070669_100857612 Ga0070669_1008576121 123
118 3300005458 Ga0070681_10181430 Ga0070681_101814304 123
119 3300005458 Ga0070681_10663560 Ga0070681_106635601 123
120 3300005459 Ga0068867_101010826 Ga0068867_1010108261 123
121 3300005530 Ga0070679_100000516 Ga0070679_10000051619 123
122 3300005530 Ga0070679_100429339 Ga0070679_1004293392 123
123 3300005539 Ga0068853_100223648 Ga0068853_1002236482 123
124 3300005539 Ga0068853_100248258 Ga0068853_1002482582 123
125 3300005543 Ga0070672_101645005 Ga0070672_1016450051 123
126 3300005548 Ga0070665_100226722 Ga0070665_1002267222 123
127 3300005563 Ga0068855_100233439 Ga0068855_1002334394 123
128 3300005563 Ga0068855_100587966 Ga0068855_1005879661 123
129 3300005577 Ga0068857_101368930 Ga0068857_1013689301 123
130 3300005578 Ga0068854_100363362 Ga0068854_1003633622 123
131 3300005614 Ga0068856_100007984 Ga0068856_10000798417 123
132 3300005616 Ga0068852_100004411 Ga0068852_1000044118 123
133 3300005616 Ga0068852_100078968 Ga0068852_1000789683 123
134 3300005616 Ga0068852_100580426 Ga0068852_1005804261 123
135 3300005618 Ga0068864_100191516 Ga0068864_1001915163 123
136 3300005834 Ga0068851_10059444 Ga0068851_100594443 123
137 3300005843 Ga0068860_100206160 Ga0068860_1002061602 123
138 3300005844 Ga0068862_100356374 Ga0068862_1003563743 123
139 3300006358 Ga0068871_100427917 Ga0068871_1004279172 123
140 3300006358 Ga0068871_101648701 Ga0068871_1016487011 123
141 3300009174 Ga0105241_10013489 Ga0105241_1001348911 123
142 3300009174 Ga0105241_10277134 Ga0105241_102771343 123
143 3300009545 Ga0105237_10032378 Ga0105237_100323786 123
144 3300009545 Ga0105237_10317308 Ga0105237_103173081 123
145 3300009553 Ga0105249_10509540 Ga0105249_105095402 123
146 3300011119 Ga0105246_10941563 Ga0105246_109415631 123
147 3300013100 Ga0157373_10315208 Ga0157373_103152082 123
148 3300013102 Ga0157371_10346450 Ga0157371_103464502 123
149 3300013105 Ga0157369_10522154 Ga0157369_105221542 123
150 3300013297 Ga0157378_11135573 Ga0157378_111355732 123
151 3300013306 Ga0163162_10357750 Ga0163162_103577503 123
152 3300013306 Ga0163162_11347956 Ga0163162_113479561 123
153 3300013307 Ga0157372_11435104 Ga0157372_114351042 123
154 3300013308 Ga0157375_10666148 Ga0157375_106661482 123
155 3300014325 Ga0163163_10334387 Ga0163163_103343872 123
156 3300014325 Ga0163163_10441221 Ga0163163_104412212 123
157 3300014325 Ga0163163_11915623 Ga0163163_119156231 123
158 3300014326 Ga0157380_10839899 Ga0157380_108398992 123
159 3300014326 Ga0157380_11019689 Ga0157380_110196892 123
160 3300014968 Ga0157379_11439613 Ga0157379_114396131 123
161 3300017792 Ga0163161_10428563 Ga0163161_104285632 123
162 3300025909 Ga0207705_10015882 Ga0207705_100158823 123
163 3300025909 Ga0207705_10804811 Ga0207705_108048111 123
164 3300025911 Ga0207654_10034782 Ga0207654_100347824 123
165 3300025912 Ga0207707_10255016 Ga0207707_102550163 123
166 3300025917 Ga0207660_10117135 Ga0207660_101171352 123
167 3300025921 Ga0207652_10000778 Ga0207652_1000077817 123
168 3300025923 Ga0207681_10739001 Ga0207681_107390011 123
169 3300025923 Ga0207681_11606710 Ga0207681_116067101 123
170 3300025938 Ga0207704_11658287 Ga0207704_116582871 123
171 3300025940 Ga0207691_10979868 Ga0207691_109798682 123
172 3300025949 Ga0207667_10027905 Ga0207667_100279052 123
173 3300025981 Ga0207640_11395958 Ga0207640_113959581 123
174 3300025986 Ga0207658_11291720 Ga0207658_112917201 123
175 3300026023 Ga0207677_10381137 Ga0207677_103811372 123
176 3300026041 Ga0207639_10917055 Ga0207639_109170551 123
177 3300026078 Ga0207702_10360002 Ga0207702_103600022 123
178 3300026095 Ga0207676_10264320 Ga0207676_102643202 123
179 3300026116 Ga0207674_10135517 Ga0207674_101355173 123
180 3300026116 Ga0207674_11114780 Ga0207674_111147801 123
181 3300026142 Ga0207698_10028338 Ga0207698_100283385 123
182 3300026142 Ga0207698_10139623 Ga0207698_101396232 123
183 3300028379 Ga0268266_10188574 Ga0268266_101885742 123
184 3300028380 Ga0268265_10579433 Ga0268265_105794332 123
185 3300028380 Ga0268265_11791890 Ga0268265_117918902 123
186 3300028381 Ga0268264_10176282 Ga0268264_101762823 123
187 3300031507 Ga0307509_10077584 Ga0307509_100775843 123
188 3300032126 Ga0307415_100344075 Ga0307415_1003440751 123
189 3300046660 Ga0495625_0035400 Ga0495625_0035400_1123_1530 123
190 3300047320 Ga0495672_0288920 Ga0495672_0288920_101_508 123
191 3300049575 Ga0501039_0063102 Ga0501039_0063102_1181_1555 123
192 3300053118 Ga0500594_0030356 Ga0500594_0030356_883_1290 123
193 3300053151 Ga0500604_0184122 Ga0500604_0184122_233_640 123
194 3300002459 JGI24751J29686_10000562 JGI24751J29686_100005627 125
195 3300005330 Ga0070690_100144500 Ga0070690_1001445002 125
196 3300005331 Ga0070670_100008003 Ga0070670_1000080032 125
197 3300005353 Ga0070669_100457145 Ga0070669_1004571452 125
198 3300005354 Ga0070675_101099194 Ga0070675_1010991942 125
199 3300005355 Ga0070671_100724976 Ga0070671_1007249761 125
200 3300005367 Ga0070667_100377468 Ga0070667_1003774681 125
201 3300005459 Ga0068867_100526944 Ga0068867_1005269443 125
202 3300005543 Ga0070672_100136808 Ga0070672_1001368085 125
203 3300005577 Ga0068857_100249124 Ga0068857_1002491242 125
204 3300005617 Ga0068859_100049953 Ga0068859_1000499532 125
205 3300005617 Ga0068859_100788620 Ga0068859_1007886202 125
206 3300005618 Ga0068864_100005829 Ga0068864_1000058298 125
207 3300005719 Ga0068861_101469833 Ga0068861_1014698331 125
208 3300005844 Ga0068862_100832937 Ga0068862_1008329371 125
209 3300006163 Ga0070715_10276984 Ga0070715_102769842 125
210 3300006237 Ga0097621_100914797 Ga0097621_1009147972 125
211 3300006358 Ga0068871_100003998 Ga0068871_1000039989 125
212 3300006846 Ga0075430_101476078 Ga0075430_1014760781 125
213 3300006881 Ga0068865_100874346 Ga0068865_1008743462 125
214 3300006931 Ga0097620_100049951 Ga0097620_1000499512 125
215 3300006931 Ga0097620_100788542 Ga0097620_1007885422 125
216 3300009093 Ga0105240_10155814 Ga0105240_101558143 125
217 3300009094 Ga0111539_10853849 Ga0111539_108538492 125
218 3300009176 Ga0105242_11413099 Ga0105242_114130992 125
219 3300009553 Ga0105249_10000434 Ga0105249_100004348 125
220 3300009553 Ga0105249_10379442 Ga0105249_103794422 125
221 3300013297 Ga0157378_10006062 Ga0157378_100060624 125
222 3300013306 Ga0163162_10409817 Ga0163162_104098171 125
223 3300013308 Ga0157375_10247011 Ga0157375_102470114 125
224 3300014325 Ga0163163_10295496 Ga0163163_102954961 125
225 3300014326 Ga0157380_11672698 Ga0157380_116726981 125
226 3300014745 Ga0157377_10197193 Ga0157377_101971932 125
227 3300014968 Ga0157379_11859432 Ga0157379_118594321 125
228 3300017792 Ga0163161_10095240 Ga0163161_100952403 125
229 3300025913 Ga0207695_11471211 Ga0207695_114712111 125
230 3300025925 Ga0207650_10209376 Ga0207650_102093761 125
231 3300025931 Ga0207644_11699704 Ga0207644_116997041 125
232 3300025961 Ga0207712_10085644 Ga0207712_100856443 125
233 3300025986 Ga0207658_10140370 Ga0207658_101403703 125
234 3300026089 Ga0207648_10111430 Ga0207648_101114303 125
235 3300026095 Ga0207676_10015007 Ga0207676_100150075 125
236 3300026116 Ga0207674_10144591 Ga0207674_101445912 125
237 3300026116 Ga0207674_11593307 Ga0207674_115933071 125
238 3300026118 Ga0207675_101658582 Ga0207675_1016585821 125
239 3300027907 Ga0207428_11305454 Ga0207428_113054541 125
240 3300028380 Ga0268265_12525206 Ga0268265_125252061 125
241 3300028381 Ga0268264_10604251 Ga0268264_106042512 125
242 3300031730 Ga0307516_10275047 Ga0307516_102750471 125
243 3300032004 Ga0307414_10777088 Ga0307414_107770881 125
244 3300041406 Ga0439439_0056048 Ga0439439_0056048_229_609 125
245 3300041410 Ga0439461_0050551 Ga0439461_0050551_484_864 125
246 3300041507 Ga0451851_1063005 Ga0451851_1063005_45_422 125
247 3300041997 Ga0439431_0103439 Ga0439431_0103439_302_682 125
248 3300042002 Ga0439442_049424 Ga0439442_049424_245_625 125
249 3300042006 Ga0439432_024415 Ga0439432_024415_622_1002 125
250 3300042007 Ga0439449_0123290 Ga0439449_0123290_151_531 125
251 3300042014 Ga0439457_027220 Ga0439457_027220_320_700 125
252 3300042015 Ga0439462_0077551 Ga0439462_0077551_351_731 125
253 3300042124 Ga0450922_018757 Ga0450922_018757_14_391 125
254 3300042128 Ga0450897_007154 Ga0450897_007154_610_990 125
255 3300042156 Ga0439446_0305011 Ga0439446_0305011_91_471 125
256 3300042435 Ga0439434_0035358 Ga0439434_0035358_10_390 125
257 3300042532 Ga0450893_0027645 Ga0450893_0027645_555_935 125
258 3300044673 Ga0453683_0416871 Ga0453683_0416871_334_720 125
259 3300046539 Ga0495621_0172631 Ga0495621_0172631_460_843 125
260 3300048908 Ga0496105_1182980 Ga0496105_1182980_63_449 125
261 3300048913 Ga0496110_1113450 Ga0496110_1113450_279_665 125
262 3300049571 Ga0501034_0011665 Ga0501034_0011665_574_954 125
263 3300049572 Ga0501036_0014298 Ga0501036_0014298_1295_1675 125
264 3300049573 Ga0501037_0030794 Ga0501037_0030794_3554_3934 125
265 3300049579 Ga0501043_0003382 Ga0501043_0003382_12573_12953 125
266 3300049581 Ga0501047_0113373 Ga0501047_0113373_471_851 125
267 3300049582 Ga0501048_0135671 Ga0501048_0135671_684_1064 125
268 3300049583 Ga0501067_0086062 Ga0501067_0086062_116_496 125
269 3300049589 Ga0501073_0080122 Ga0501073_0080122_839_1219 125
270 3300049590 Ga0501074_0001989 Ga0501074_0001989_1378_1758 125
271 3300049742 Ga0501080_0092401 Ga0501080_0092401_543_923 125
272 3300049742 Ga0501080_1150799 Ga0501080_1150799_51_431 125
273 3300049744 Ga0501083_0023096 Ga0501083_0023096_1424_1804 125
274 3300049822 Ga0501035_0508056 Ga0501035_0508056_548_928 125
275 3300049823 Ga0501044_0095824 Ga0501044_0095824_1182_1562 125
276 3300049824 Ga0501045_0301446 Ga0501045_0301446_566_946 125
277 3300050509 nmdc:mga0qj67_934437_c1 nmdc:mga0qj67_934437_c1_185_562 125
278 3300050511 nmdc:mga08y16_870651_c1 nmdc:mga08y16_870651_c1_242_619 125
279 3300054114 Ga0501084_0090971 Ga0501084_0090971_1887_2267 125

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hda-assembly1.cif.gz_C crystal structure of the bs69 coiled coil-mynd domains bound to an ebna2 pxlxp motif 0.693 4 41
8dt6-assembly1.cif.gz_C crystal structure of dna polymerase iii beta subunit from elizabethkingia anophelis 0.6627 99 125
1qhu-assembly1.cif.gz_A mammalian blood serum haemopexin deglycosylated and in complex with its ligand haem 0.6447 89 118
6pph-assembly1.cif.gz_k kaposi's sarcoma-associated herpesvirus (kshv), c1 penton vertex register, catc-binding structure 0.6396 99 125
6w2e-assembly1.cif.gz_v structures of capsid and capsid-associated tegument complex inside the epstein-barr virus 0.636 100 125
ID Description Score Start End Superfamily
af_O14139_284_342_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.78 87 102 2.40.50.40
af_A0A2R8Q3B4_533_592_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7401 87 102 2.40.50.40
af_Q499S5_294_485_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7222 88 113 2.110.10.10
1hxnA00 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7163 88 115 2.110.10.10
3dmdA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain 0.6696 46 82 1.20.120.140
ID Description Score Start End GO Terms
AF-S7VB66-F1-model_v4 Uncharacterized protein 0.9682 40 125
AF-A0A4Q1CFQ5-F1-model_v4 Uncharacterized protein 0.9673 40 122
AF-A0A410G7K8-F1-model_v4 Uncharacterized protein 0.9633 43 123
AF-M7X493-F1-model_v4 Uncharacterized protein 0.9584 47 125
AF-J1FF33-F1-model_v4 Uncharacterized protein 0.954 49 123

Feature Viewer

pLDDT pTM Quality
88.14 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map