F382821
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 171 | 279 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_11039618|Ga0070658_110396181 |
| Length | 139 |
| Sequence | MKLFDVSFSYNSIPTGITMETERLCLTCNKPLKGRTDKKFCDDYCRNNYNNQLKSNTINLVRNINNALGKNRRVLENFFHGGEETVKTTKDKLLEKGFQFKYFTNTYTNKKGNVYFFCYDIGYLPLENGWYLLVKKKEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 81 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 118 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 119 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 120 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 123 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 124 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 125 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 126 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 127 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 128 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 129 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 130 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 131 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 132 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 133 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 134 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 141 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 153 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 154 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 158 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 159 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 162 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 163 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 167 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 170 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 171 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.79 |
| Nodule | 0 |
| Rhizoplane | 1.43 |
| Rhizosphere | 93.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000562 | 3300002459 | Bacteria | 10103 |
| 2 | rootH1_10237580 | 3300003323 | Bacteria | 5278 |
| 3 | rootH1_10318249 | 3300003323 | Unclassified | 1534 |
| 4 | JGI25160J50197_1000193 | 3300003354 | Bacteria | 51332 |
| 5 | Ga0065714_10109739 | 3300005288 | Bacteria | 1495 |
| 6 | Ga0065714_10242803 | 3300005288 | Bacteria | 791 |
| 7 | Ga0065704_10163164 | 3300005289 | Bacteria | 1340 |
| 8 | Ga0065707_10115102 | 3300005295 | Bacteria | 2277 |
| 9 | Ga0070658_11039618 | 3300005327 | Bacteria | 712 |
| 10 | Ga0070658_11938297 | 3300005327 | Unclassified | 509 |
| 11 | Ga0070676_10040063 | 3300005328 | Bacteria | 2712 |
| 12 | Ga0070683_100876590 | 3300005329 | Bacteria | 861 |
| 13 | Ga0070690_100144500 | 3300005330 | Unclassified | 1617 |
| 14 | Ga0070690_100699535 | 3300005330 | Bacteria | 778 |
| 15 | Ga0070670_100008003 | 3300005331 | Bacteria | 8989 |
| 16 | Ga0070670_100316082 | 3300005331 | Bacteria | 1368 |
| 17 | Ga0068869_100028724 | 3300005334 | Bacteria | 3890 |
| 18 | Ga0070666_10343402 | 3300005335 | Bacteria | 1067 |
| 19 | Ga0070680_100138019 | 3300005336 | Bacteria | 2044 |
| 20 | Ga0070682_100211575 | 3300005337 | Bacteria | 1374 |
| 21 | Ga0070682_100362188 | 3300005337 | Bacteria | 1085 |
| 22 | Ga0068868_100328835 | 3300005338 | Bacteria | 1304 |
| 23 | Ga0068868_100811612 | 3300005338 | Unclassified | 845 |
| 24 | Ga0070689_100116560 | 3300005340 | Bacteria | 2130 |
| 25 | Ga0070689_101746787 | 3300005340 | Bacteria | 567 |
| 26 | Ga0070661_100913217 | 3300005344 | Bacteria | 725 |
| 27 | Ga0070661_101123057 | 3300005344 | Bacteria | 655 |
| 28 | Ga0070668_100205860 | 3300005347 | Bacteria | 1617 |
| 29 | Ga0070669_100008323 | 3300005353 | Bacteria | 7405 |
| 30 | Ga0070669_100457145 | 3300005353 | Bacteria | 1053 |
| 31 | Ga0070669_100857612 | 3300005353 | Bacteria | 774 |
| 32 | Ga0070675_100006453 | 3300005354 | Bacteria | 9003 |
| 33 | Ga0070675_101099194 | 3300005354 | Bacteria | 731 |
| 34 | Ga0070671_100724976 | 3300005355 | Unclassified | 863 |
| 35 | Ga0070671_101374626 | 3300005355 | Unclassified | 623 |
| 36 | Ga0070674_101241338 | 3300005356 | Bacteria | 663 |
| 37 | Ga0070673_101441471 | 3300005364 | Bacteria | 649 |
| 38 | Ga0070688_100156764 | 3300005365 | Bacteria | 1561 |
| 39 | Ga0070667_100377468 | 3300005367 | Bacteria | 1287 |
| 40 | Ga0070700_100124248 | 3300005441 | Bacteria | 1733 |
| 41 | Ga0070700_100166654 | 3300005441 | Bacteria | 1522 |
| 42 | Ga0070663_100043593 | 3300005455 | Bacteria | 3158 |
| 43 | Ga0070662_100024107 | 3300005457 | Bacteria | 4187 |
| 44 | Ga0070681_10181430 | 3300005458 | Bacteria | 2027 |
| 45 | Ga0070681_10663560 | 3300005458 | Unclassified | 958 |
| 46 | Ga0068867_100033953 | 3300005459 | Bacteria | 3697 |
| 47 | Ga0068867_100526944 | 3300005459 | Bacteria | 1020 |
| 48 | Ga0068867_101010826 | 3300005459 | Bacteria | 754 |
| 49 | Ga0070685_10637559 | 3300005466 | Bacteria | 771 |
| 50 | Ga0070679_100000516 | 3300005530 | Bacteria | 32885 |
| 51 | Ga0070679_100056862 | 3300005530 | Bacteria | 3898 |
| 52 | Ga0070679_100429339 | 3300005530 | Bacteria | 1266 |
| 53 | Ga0070684_100304732 | 3300005535 | Bacteria | 1462 |
| 54 | Ga0070684_102105366 | 3300005535 | Bacteria | 532 |
| 55 | Ga0068853_100223648 | 3300005539 | Bacteria | 1720 |
| 56 | Ga0068853_100248258 | 3300005539 | Bacteria | 1632 |
| 57 | Ga0068853_100823500 | 3300005539 | Unclassified | 889 |
| 58 | Ga0068853_101323917 | 3300005539 | Bacteria | 696 |
| 59 | Ga0070672_100136808 | 3300005543 | Bacteria | 2018 |
| 60 | Ga0070672_100166134 | 3300005543 | Bacteria | 1833 |
| 61 | Ga0070672_101645005 | 3300005543 | Unclassified | 576 |
| 62 | Ga0070665_100226722 | 3300005548 | Bacteria | 1869 |
| 63 | Ga0070704_100220737 | 3300005549 | Bacteria | 1541 |
| 64 | Ga0068855_100233439 | 3300005563 | Bacteria | 2058 |
| 65 | Ga0068855_100587966 | 3300005563 | Bacteria | 1202 |
| 66 | Ga0068857_100086455 | 3300005577 | Bacteria | 2804 |
| 67 | Ga0068857_100249124 | 3300005577 | Bacteria | 1628 |
| 68 | Ga0068857_101368930 | 3300005577 | Unclassified | 688 |
| 69 | Ga0068854_100119185 | 3300005578 | Bacteria | 2001 |
| 70 | Ga0068854_100363362 | 3300005578 | Bacteria | 1188 |
| 71 | Ga0068856_100007984 | 3300005614 | Bacteria | 10334 |
| 72 | Ga0068852_100004411 | 3300005616 | Bacteria | 9946 |
| 73 | Ga0068852_100078968 | 3300005616 | Bacteria | 2913 |
| 74 | Ga0068852_100580426 | 3300005616 | Bacteria | 1124 |
| 75 | Ga0068852_101467631 | 3300005616 | Bacteria | 704 |
| 76 | Ga0068852_101860032 | 3300005616 | Bacteria | 624 |
| 77 | Ga0068859_100049953 | 3300005617 | Bacteria | 4201 |
| 78 | Ga0068859_100058625 | 3300005617 | Bacteria | 3878 |
| 79 | Ga0068859_100788620 | 3300005617 | Bacteria | 1038 |
| 80 | Ga0068864_100005829 | 3300005618 | Bacteria | 10102 |
| 81 | Ga0068864_100191516 | 3300005618 | Bacteria | 1875 |
| 82 | Ga0068864_101394209 | 3300005618 | Bacteria | 702 |
| 83 | Ga0068861_100004644 | 3300005719 | Bacteria | 9218 |
| 84 | Ga0068861_101469833 | 3300005719 | Bacteria | 668 |
| 85 | Ga0068851_10059444 | 3300005834 | Bacteria | 1955 |
| 86 | Ga0068851_10901263 | 3300005834 | Bacteria | 554 |
| 87 | Ga0068870_10026880 | 3300005840 | Bacteria | 2873 |
| 88 | Ga0068863_100455483 | 3300005841 | Unclassified | 1256 |
| 89 | Ga0068860_100206160 | 3300005843 | Unclassified | 1906 |
| 90 | Ga0068860_101960519 | 3300005843 | Bacteria | 607 |
| 91 | Ga0068862_100018041 | 3300005844 | Bacteria | 5877 |
| 92 | Ga0068862_100356374 | 3300005844 | Bacteria | 1359 |
| 93 | Ga0068862_100832937 | 3300005844 | Bacteria | 903 |
| 94 | Ga0070715_10276984 | 3300006163 | Unclassified | 888 |
| 95 | Ga0075366_10003077 | 3300006195 | Bacteria | 8706 |
| 96 | Ga0097621_100843389 | 3300006237 | Bacteria | 851 |
| 97 | Ga0097621_100914797 | 3300006237 | Unclassified | 818 |
| 98 | Ga0068871_100003998 | 3300006358 | Bacteria | 10202 |
| 99 | Ga0068871_100427917 | 3300006358 | Unclassified | 1183 |
| 100 | Ga0068871_101648701 | 3300006358 | Bacteria | 608 |
| 101 | Ga0075430_101476078 | 3300006846 | Bacteria | 559 |
| 102 | Ga0068865_100080037 | 3300006881 | Bacteria | 2342 |
| 103 | Ga0068865_100874346 | 3300006881 | Bacteria | 780 |
| 104 | Ga0097620_100049951 | 3300006931 | Bacteria | 4201 |
| 105 | Ga0097620_100058628 | 3300006931 | Bacteria | 3878 |
| 106 | Ga0097620_100788542 | 3300006931 | Bacteria | 1038 |
| 107 | Ga0105240_10155814 | 3300009093 | Bacteria | 2717 |
| 108 | Ga0111539_10007083 | 3300009094 | Bacteria | 14371 |
| 109 | Ga0111539_10853849 | 3300009094 | Bacteria | 1059 |
| 110 | Ga0105241_10013489 | 3300009174 | Bacteria | 5989 |
| 111 | Ga0105241_10277134 | 3300009174 | Bacteria | 1431 |
| 112 | Ga0105242_11413099 | 3300009176 | Bacteria | 724 |
| 113 | Ga0105237_10032378 | 3300009545 | Bacteria | 5293 |
| 114 | Ga0105237_10317308 | 3300009545 | Unclassified | 1562 |
| 115 | Ga0105249_10000434 | 3300009553 | Bacteria | 39679 |
| 116 | Ga0105249_10013174 | 3300009553 | Bacteria | 7296 |
| 117 | Ga0105249_10014805 | 3300009553 | Bacteria | 6895 |
| 118 | Ga0105249_10379442 | 3300009553 | Bacteria | 1439 |
| 119 | Ga0105249_10509540 | 3300009553 | Bacteria | 1249 |
| 120 | Ga0105246_10161670 | 3300011119 | Bacteria | 1706 |
| 121 | Ga0105246_10941563 | 3300011119 | Bacteria | 778 |
| 122 | Ga0157373_10315208 | 3300013100 | Unclassified | 1112 |
| 123 | Ga0157371_10346450 | 3300013102 | Bacteria | 1081 |
| 124 | Ga0157371_10388184 | 3300013102 | Unclassified | 1020 |
| 125 | Ga0157370_10472800 | 3300013104 | Bacteria | 1152 |
| 126 | Ga0157370_11111306 | 3300013104 | Bacteria | 714 |
| 127 | Ga0157370_11423167 | 3300013104 | Bacteria | 624 |
| 128 | Ga0157369_10081721 | 3300013105 | Bacteria | 3458 |
| 129 | Ga0157369_10522154 | 3300013105 | Bacteria | 1228 |
| 130 | Ga0157369_10706020 | 3300013105 | Unclassified | 1038 |
| 131 | Ga0157378_10006062 | 3300013297 | Bacteria | 10593 |
| 132 | Ga0157378_10925981 | 3300013297 | Bacteria | 903 |
| 133 | Ga0157378_11135573 | 3300013297 | Bacteria | 819 |
| 134 | Ga0157378_12610748 | 3300013297 | Bacteria | 557 |
| 135 | Ga0163162_10093348 | 3300013306 | Bacteria | 3094 |
| 136 | Ga0163162_10357750 | 3300013306 | Unclassified | 1593 |
| 137 | Ga0163162_10409817 | 3300013306 | Unclassified | 1488 |
| 138 | Ga0163162_11347956 | 3300013306 | Bacteria | 811 |
| 139 | Ga0157372_10030554 | 3300013307 | Bacteria | 5893 |
| 140 | Ga0157372_10474584 | 3300013307 | Bacteria | 1458 |
| 141 | Ga0157372_10827964 | 3300013307 | Bacteria | 1075 |
| 142 | Ga0157372_11435104 | 3300013307 | Unclassified | 795 |
| 143 | Ga0157372_12147558 | 3300013307 | Unclassified | 642 |
| 144 | Ga0157375_10024522 | 3300013308 | Bacteria | 5584 |
| 145 | Ga0157375_10247011 | 3300013308 | Bacteria | 1945 |
| 146 | Ga0157375_10666148 | 3300013308 | Bacteria | 1196 |
| 147 | Ga0157375_13153458 | 3300013308 | Bacteria | 550 |
| 148 | Ga0163163_10295496 | 3300014325 | Bacteria | 1672 |
| 149 | Ga0163163_10334387 | 3300014325 | Unclassified | 1569 |
| 150 | Ga0163163_10441221 | 3300014325 | Bacteria | 1361 |
| 151 | Ga0163163_11915623 | 3300014325 | Bacteria | 653 |
| 152 | Ga0157380_10091460 | 3300014326 | Bacteria | 2512 |
| 153 | Ga0157380_10839899 | 3300014326 | Unclassified | 939 |
| 154 | Ga0157380_11019689 | 3300014326 | Bacteria | 862 |
| 155 | Ga0157380_11672698 | 3300014326 | Bacteria | 693 |
| 156 | Ga0157377_10197193 | 3300014745 | Unclassified | 1276 |
| 157 | Ga0157379_11439613 | 3300014968 | Unclassified | 669 |
| 158 | Ga0157379_11859432 | 3300014968 | Unclassified | 593 |
| 159 | Ga0157376_10329875 | 3300014969 | Unclassified | 1454 |
| 160 | Ga0163161_10095240 | 3300017792 | Unclassified | 2208 |
| 161 | Ga0163161_10428563 | 3300017792 | Bacteria | 1065 |
| 162 | Ga0213876_10420459 | 3300021384 | Unclassified | 711 |
| 163 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 164 | Ga0207705_10015882 | 3300025909 | Bacteria | 5406 |
| 165 | Ga0207705_10804811 | 3300025909 | Bacteria | 729 |
| 166 | Ga0207654_10034782 | 3300025911 | Bacteria | 2801 |
| 167 | Ga0207707_10255016 | 3300025912 | Bacteria | 1523 |
| 168 | Ga0207695_11471211 | 3300025913 | Bacteria | 561 |
| 169 | Ga0207660_10117135 | 3300025917 | Bacteria | 2013 |
| 170 | Ga0207652_10000778 | 3300025921 | Bacteria | 30494 |
| 171 | Ga0207681_10739001 | 3300025923 | Bacteria | 820 |
| 172 | Ga0207681_11606710 | 3300025923 | Bacteria | 544 |
| 173 | Ga0207650_10209376 | 3300025925 | Bacteria | 1565 |
| 174 | Ga0207644_10227274 | 3300025931 | Bacteria | 1482 |
| 175 | Ga0207644_11699704 | 3300025931 | Unclassified | 529 |
| 176 | Ga0207704_11658287 | 3300025938 | Bacteria | 549 |
| 177 | Ga0207691_10617732 | 3300025940 | Bacteria | 917 |
| 178 | Ga0207691_10979868 | 3300025940 | Unclassified | 706 |
| 179 | Ga0207667_10027905 | 3300025949 | Bacteria | 6136 |
| 180 | Ga0207712_10010896 | 3300025961 | Bacteria | 5787 |
| 181 | Ga0207712_10085644 | 3300025961 | Unclassified | 2307 |
| 182 | Ga0207640_10197349 | 3300025981 | Bacteria | 1522 |
| 183 | Ga0207640_11106335 | 3300025981 | Unclassified | 701 |
| 184 | Ga0207640_11395958 | 3300025981 | Bacteria | 627 |
| 185 | Ga0207658_10140370 | 3300025986 | Bacteria | 1954 |
| 186 | Ga0207658_11291720 | 3300025986 | Bacteria | 667 |
| 187 | Ga0207677_10381137 | 3300026023 | Bacteria | 1190 |
| 188 | Ga0207639_10917055 | 3300026041 | Bacteria | 819 |
| 189 | Ga0207639_10945536 | 3300026041 | Bacteria | 806 |
| 190 | Ga0207639_11101639 | 3300026041 | Bacteria | 745 |
| 191 | Ga0207678_10071057 | 3300026067 | Bacteria | 2984 |
| 192 | Ga0207678_10388660 | 3300026067 | Unclassified | 1207 |
| 193 | Ga0207708_10462475 | 3300026075 | Bacteria | 1058 |
| 194 | Ga0207708_10726594 | 3300026075 | Bacteria | 851 |
| 195 | Ga0207702_10360002 | 3300026078 | Bacteria | 1394 |
| 196 | Ga0207641_11709461 | 3300026088 | Bacteria | 631 |
| 197 | Ga0207648_10111430 | 3300026089 | Unclassified | 2402 |
| 198 | Ga0207676_10015007 | 3300026095 | Bacteria | 5584 |
| 199 | Ga0207676_10264320 | 3300026095 | Bacteria | 1555 |
| 200 | Ga0207674_10135517 | 3300026116 | Bacteria | 2424 |
| 201 | Ga0207674_10144591 | 3300026116 | Bacteria | 2337 |
| 202 | Ga0207674_11114780 | 3300026116 | Unclassified | 758 |
| 203 | Ga0207674_11593307 | 3300026116 | Bacteria | 622 |
| 204 | Ga0207675_101658582 | 3300026118 | Bacteria | 659 |
| 205 | Ga0207698_10028338 | 3300026142 | Bacteria | 3992 |
| 206 | Ga0207698_10139623 | 3300026142 | Unclassified | 2085 |
| 207 | Ga0207698_10876385 | 3300026142 | Bacteria | 904 |
| 208 | Ga0207428_11305454 | 3300027907 | Bacteria | 503 |
| 209 | Ga0268266_10188574 | 3300028379 | Bacteria | 1882 |
| 210 | Ga0268265_10579433 | 3300028380 | Bacteria | 1069 |
| 211 | Ga0268265_11791890 | 3300028380 | Bacteria | 620 |
| 212 | Ga0268265_12525206 | 3300028380 | Unclassified | 520 |
| 213 | Ga0268264_10176282 | 3300028381 | Bacteria | 1938 |
| 214 | Ga0268264_10604251 | 3300028381 | Unclassified | 1081 |
| 215 | Ga0307509_10077584 | 3300031507 | Bacteria | 3445 |
| 216 | Ga0307516_10275047 | 3300031730 | Bacteria | 1368 |
| 217 | Ga0307406_11027096 | 3300031901 | Unclassified | 708 |
| 218 | Ga0307414_10777088 | 3300032004 | Bacteria | 872 |
| 219 | Ga0307415_100344075 | 3300032126 | Unclassified | 1253 |
| 220 | Ga0436365_0985326 | 3300039437 | Unclassified | 1006 |
| 221 | Ga0436365_1117886 | 3300039437 | Bacteria | 1303 |
| 222 | Ga0439439_0056048 | 3300041406 | Unclassified | 1041 |
| 223 | Ga0439461_0050551 | 3300041410 | Unclassified | 921 |
| 224 | Ga0451800_0388003 | 3300041459 | Bacteria | 607 |
| 225 | Ga0451807_1509945 | 3300041486 | Unclassified | 637 |
| 226 | Ga0451851_1063005 | 3300041507 | Unclassified | 743 |
| 227 | Ga0439431_0103439 | 3300041997 | Unclassified | 784 |
| 228 | Ga0439442_049424 | 3300042002 | Bacteria | 887 |
| 229 | Ga0439432_024415 | 3300042006 | Bacteria | 1987 |
| 230 | Ga0439449_0123290 | 3300042007 | Unclassified | 962 |
| 231 | Ga0439457_027220 | 3300042014 | Bacteria | 1266 |
| 232 | Ga0439462_0077551 | 3300042015 | Unclassified | 906 |
| 233 | Ga0450922_018757 | 3300042124 | Bacteria | 704 |
| 234 | Ga0450897_007154 | 3300042128 | Bacteria | 1013 |
| 235 | Ga0439446_0305011 | 3300042156 | Bacteria | 560 |
| 236 | Ga0439434_0035358 | 3300042435 | Bacteria | 1527 |
| 237 | Ga0450893_0027645 | 3300042532 | Bacteria | 1001 |
| 238 | Ga0453683_0416871 | 3300044673 | Bacteria | 866 |
| 239 | Ga0453684_2054895 | 3300044712 | Unclassified | 574 |
| 240 | Ga0495621_0172631 | 3300046539 | Bacteria | 860 |
| 241 | Ga0495625_0035400 | 3300046660 | Bacteria | 3681 |
| 242 | Ga0495669_0629131 | 3300046684 | Unclassified | 522 |
| 243 | Ga0495672_0288920 | 3300047320 | Bacteria | 781 |
| 244 | Ga0496105_1182980 | 3300048908 | Bacteria | 564 |
| 245 | Ga0496110_1113450 | 3300048913 | Bacteria | 698 |
| 246 | Ga0501034_0011665 | 3300049571 | Bacteria | 9095 |
| 247 | Ga0501036_0014298 | 3300049572 | Bacteria | 6605 |
| 248 | Ga0501037_0030794 | 3300049573 | Bacteria | 3963 |
| 249 | Ga0501039_0063102 | 3300049575 | Bacteria | 2871 |
| 250 | Ga0501043_0003382 | 3300049579 | Bacteria | 13136 |
| 251 | Ga0501047_0113373 | 3300049581 | Bacteria | 2593 |
| 252 | Ga0501048_0135671 | 3300049582 | Bacteria | 1739 |
| 253 | Ga0501067_0086062 | 3300049583 | Bacteria | 1744 |
| 254 | Ga0501073_0080122 | 3300049589 | Bacteria | 2272 |
| 255 | Ga0501073_0486799 | 3300049589 | Unclassified | 853 |
| 256 | Ga0501074_0001989 | 3300049590 | Bacteria | 14073 |
| 257 | Ga0501201_015186 | 3300049651 | Bacteria | 782 |
| 258 | Ga0501202_010285 | 3300049652 | Bacteria | 1733 |
| 259 | Ga0501227_132270 | 3300049665 | Unclassified | 680 |
| 260 | Ga0501235_050344 | 3300049669 | Unclassified | 964 |
| 261 | Ga0501236_089083 | 3300049670 | Unclassified | 590 |
| 262 | Ga0501238_051291 | 3300049671 | Unclassified | 619 |
| 263 | Ga0501225_0031532 | 3300049705 | Bacteria | 1458 |
| 264 | Ga0501080_0092401 | 3300049742 | Bacteria | 2810 |
| 265 | Ga0501080_0386263 | 3300049742 | Unclassified | 1261 |
| 266 | Ga0501080_1150799 | 3300049742 | Unclassified | 668 |
| 267 | Ga0501083_0023096 | 3300049744 | Bacteria | 4316 |
| 268 | Ga0501273_046224 | 3300049770 | Unclassified | 656 |
| 269 | Ga0501280_086829 | 3300049776 | Unclassified | 584 |
| 270 | Ga0501035_0508056 | 3300049822 | Bacteria | 991 |
| 271 | Ga0501044_0095824 | 3300049823 | Bacteria | 2990 |
| 272 | Ga0501044_0552978 | 3300049823 | Unclassified | 1048 |
| 273 | Ga0501045_0301446 | 3300049824 | Bacteria | 1193 |
| 274 | Ga0501212_041875 | 3300049851 | Bacteria | 759 |
| 275 | nmdc:mga0qj67_934437_c1 | 3300050509 | Bacteria | 682 |
| 276 | nmdc:mga08y16_870651_c1 | 3300050511 | Bacteria | 889 |
| 277 | Ga0500594_0030356 | 3300053118 | Bacteria | 1419 |
| 278 | Ga0500604_0184122 | 3300053151 | Unclassified | 716 |
| 279 | Ga0501084_0090971 | 3300054114 | Bacteria | 2562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005289 | Ga0065704_10163164 | Ga0065704_101631643 | 102 |
| 2 | 3300005295 | Ga0065707_10115102 | Ga0065707_101151023 | 102 |
| 3 | 3300005328 | Ga0070676_10040063 | Ga0070676_100400632 | 102 |
| 4 | 3300005330 | Ga0070690_100699535 | Ga0070690_1006995352 | 102 |
| 5 | 3300005331 | Ga0070670_100316082 | Ga0070670_1003160821 | 102 |
| 6 | 3300005334 | Ga0068869_100028724 | Ga0068869_1000287243 | 102 |
| 7 | 3300005340 | Ga0070689_100116560 | Ga0070689_1001165604 | 102 |
| 8 | 3300005344 | Ga0070661_101123057 | Ga0070661_1011230572 | 102 |
| 9 | 3300005347 | Ga0070668_100205860 | Ga0070668_1002058602 | 102 |
| 10 | 3300005353 | Ga0070669_100008323 | Ga0070669_1000083237 | 102 |
| 11 | 3300005354 | Ga0070675_100006453 | Ga0070675_1000064532 | 102 |
| 12 | 3300005356 | Ga0070674_101241338 | Ga0070674_1012413382 | 102 |
| 13 | 3300005364 | Ga0070673_101441471 | Ga0070673_1014414712 | 102 |
| 14 | 3300005365 | Ga0070688_100156764 | Ga0070688_1001567643 | 102 |
| 15 | 3300005441 | Ga0070700_100124248 | Ga0070700_1001242482 | 102 |
| 16 | 3300005441 | Ga0070700_100166654 | Ga0070700_1001666542 | 102 |
| 17 | 3300005457 | Ga0070662_100024107 | Ga0070662_1000241075 | 102 |
| 18 | 3300005459 | Ga0068867_100033953 | Ga0068867_1000339533 | 102 |
| 19 | 3300005466 | Ga0070685_10637559 | Ga0070685_106375592 | 102 |
| 20 | 3300005543 | Ga0070672_100166134 | Ga0070672_1001661342 | 102 |
| 21 | 3300005549 | Ga0070704_100220737 | Ga0070704_1002207372 | 102 |
| 22 | 3300005577 | Ga0068857_100086455 | Ga0068857_1000864552 | 102 |
| 23 | 3300005617 | Ga0068859_100058625 | Ga0068859_1000586254 | 102 |
| 24 | 3300005719 | Ga0068861_100004644 | Ga0068861_1000046444 | 102 |
| 25 | 3300005840 | Ga0068870_10026880 | Ga0068870_100268802 | 102 |
| 26 | 3300005844 | Ga0068862_100018041 | Ga0068862_1000180415 | 102 |
| 27 | 3300006881 | Ga0068865_100080037 | Ga0068865_1000800373 | 102 |
| 28 | 3300006931 | Ga0097620_100058628 | Ga0097620_1000586283 | 102 |
| 29 | 3300009094 | Ga0111539_10007083 | Ga0111539_1000708313 | 102 |
| 30 | 3300009553 | Ga0105249_10013174 | Ga0105249_100131743 | 102 |
| 31 | 3300011119 | Ga0105246_10161670 | Ga0105246_101616702 | 102 |
| 32 | 3300013297 | Ga0157378_12610748 | Ga0157378_126107481 | 102 |
| 33 | 3300013306 | Ga0163162_10093348 | Ga0163162_100933483 | 102 |
| 34 | 3300013308 | Ga0157375_10024522 | Ga0157375_100245223 | 102 |
| 35 | 3300014326 | Ga0157380_10091460 | Ga0157380_100914602 | 102 |
| 36 | 3300026075 | Ga0207708_10462475 | Ga0207708_104624752 | 102 |
| 37 | 3300049651 | Ga0501201_015186 | Ga0501201_015186_420_746 | 103 |
| 38 | 3300039437 | Ga0436365_0985326 | Ga0436365_0985326_576_947 | 104 |
| 39 | 3300005841 | Ga0068863_100455483 | Ga0068863_1004554832 | 107 |
| 40 | 3300006195 | Ga0075366_10003077 | Ga0075366_100030772 | 107 |
| 41 | 3300026088 | Ga0207641_11709461 | Ga0207641_117094611 | 107 |
| 42 | 3300003323 | rootH1_10237580 | rootH1_102375805 | 113 |
| 43 | 3300049589 | Ga0501073_0486799 | Ga0501073_0486799_97_465 | 114 |
| 44 | 3300009553 | Ga0105249_10014805 | Ga0105249_100148052 | 115 |
| 45 | 3300025961 | Ga0207712_10010896 | Ga0207712_100108962 | 115 |
| 46 | 3300014969 | Ga0157376_10329875 | Ga0157376_103298751 | 117 |
| 47 | 3300031901 | Ga0307406_11027096 | Ga0307406_110270961 | 117 |
| 48 | 3300049652 | Ga0501202_010285 | Ga0501202_010285_1041_1436 | 117 |
| 49 | 3300049665 | Ga0501227_132270 | Ga0501227_132270_34_429 | 117 |
| 50 | 3300049669 | Ga0501235_050344 | Ga0501235_050344_52_447 | 117 |
| 51 | 3300049670 | Ga0501236_089083 | Ga0501236_089083_29_424 | 117 |
| 52 | 3300049671 | Ga0501238_051291 | Ga0501238_051291_72_467 | 117 |
| 53 | 3300049705 | Ga0501225_0031532 | Ga0501225_0031532_473_868 | 117 |
| 54 | 3300049770 | Ga0501273_046224 | Ga0501273_046224_57_452 | 117 |
| 55 | 3300049776 | Ga0501280_086829 | Ga0501280_086829_33_428 | 117 |
| 56 | 3300049851 | Ga0501212_041875 | Ga0501212_041875_303_698 | 117 |
| 57 | 3300005344 | Ga0070661_100913217 | Ga0070661_1009132171 | 120 |
| 58 | 3300005530 | Ga0070679_100056862 | Ga0070679_1000568625 | 120 |
| 59 | 3300005616 | Ga0068852_101860032 | Ga0068852_1018600321 | 120 |
| 60 | 3300013297 | Ga0157378_10925981 | Ga0157378_109259812 | 120 |
| 61 | 3300026142 | Ga0207698_10876385 | Ga0207698_108763851 | 120 |
| 62 | 3300044712 | Ga0453684_2054895 | Ga0453684_2054895_156_533 | 120 |
| 63 | 3300003354 | JGI25160J50197_1000193 | JGI25160J50197_100019337 | 121 |
| 64 | 3300005335 | Ga0070666_10343402 | Ga0070666_103434022 | 121 |
| 65 | 3300005337 | Ga0070682_100211575 | Ga0070682_1002115751 | 121 |
| 66 | 3300005340 | Ga0070689_101746787 | Ga0070689_1017467871 | 121 |
| 67 | 3300005355 | Ga0070671_101374626 | Ga0070671_1013746261 | 121 |
| 68 | 3300005455 | Ga0070663_100043593 | Ga0070663_1000435933 | 121 |
| 69 | 3300005535 | Ga0070684_100304732 | Ga0070684_1003047322 | 121 |
| 70 | 3300005535 | Ga0070684_102105366 | Ga0070684_1021053661 | 121 |
| 71 | 3300005539 | Ga0068853_100823500 | Ga0068853_1008235002 | 121 |
| 72 | 3300005539 | Ga0068853_101323917 | Ga0068853_1013239172 | 121 |
| 73 | 3300005578 | Ga0068854_100119185 | Ga0068854_1001191853 | 121 |
| 74 | 3300005616 | Ga0068852_101467631 | Ga0068852_1014676312 | 121 |
| 75 | 3300005618 | Ga0068864_101394209 | Ga0068864_1013942091 | 121 |
| 76 | 3300005834 | Ga0068851_10901263 | Ga0068851_109012631 | 121 |
| 77 | 3300006237 | Ga0097621_100843389 | Ga0097621_1008433891 | 121 |
| 78 | 3300013102 | Ga0157371_10388184 | Ga0157371_103881841 | 121 |
| 79 | 3300013104 | Ga0157370_10472800 | Ga0157370_104728001 | 121 |
| 80 | 3300013104 | Ga0157370_11111306 | Ga0157370_111113062 | 121 |
| 81 | 3300013104 | Ga0157370_11423167 | Ga0157370_114231672 | 121 |
| 82 | 3300013105 | Ga0157369_10081721 | Ga0157369_100817213 | 121 |
| 83 | 3300013105 | Ga0157369_10706020 | Ga0157369_107060202 | 121 |
| 84 | 3300013307 | Ga0157372_10030554 | Ga0157372_100305542 | 121 |
| 85 | 3300013307 | Ga0157372_10474584 | Ga0157372_104745843 | 121 |
| 86 | 3300013307 | Ga0157372_10827964 | Ga0157372_108279641 | 121 |
| 87 | 3300013307 | Ga0157372_12147558 | Ga0157372_121475581 | 121 |
| 88 | 3300013308 | Ga0157375_13153458 | Ga0157375_131534582 | 121 |
| 89 | 3300021384 | Ga0213876_10420459 | Ga0213876_104204591 | 121 |
| 90 | 3300025302 | Ga0207426_1000026 | Ga0207426_1000026222 | 121 |
| 91 | 3300025931 | Ga0207644_10227274 | Ga0207644_102272742 | 121 |
| 92 | 3300025940 | Ga0207691_10617732 | Ga0207691_106177322 | 121 |
| 93 | 3300025981 | Ga0207640_10197349 | Ga0207640_101973492 | 121 |
| 94 | 3300025981 | Ga0207640_11106335 | Ga0207640_111063351 | 121 |
| 95 | 3300026041 | Ga0207639_10945536 | Ga0207639_109455361 | 121 |
| 96 | 3300026041 | Ga0207639_11101639 | Ga0207639_111016392 | 121 |
| 97 | 3300026067 | Ga0207678_10071057 | Ga0207678_100710573 | 121 |
| 98 | 3300026067 | Ga0207678_10388660 | Ga0207678_103886601 | 121 |
| 99 | 3300026075 | Ga0207708_10726594 | Ga0207708_107265941 | 121 |
| 100 | 3300039437 | Ga0436365_1117886 | Ga0436365_1117886_487_852 | 121 |
| 101 | 3300041459 | Ga0451800_0388003 | Ga0451800_0388003_53_421 | 121 |
| 102 | 3300041486 | Ga0451807_1509945 | Ga0451807_1509945_107_478 | 121 |
| 103 | 3300046684 | Ga0495669_0629131 | Ga0495669_0629131_128_499 | 121 |
| 104 | 3300049742 | Ga0501080_0386263 | Ga0501080_0386263_22_390 | 121 |
| 105 | 3300049823 | Ga0501044_0552978 | Ga0501044_0552978_150_518 | 121 |
| 106 | 3300005843 | Ga0068860_101960519 | Ga0068860_1019605191 | 122 |
| 107 | 3300003323 | rootH1_10318249 | rootH1_103182493 | 123 |
| 108 | 3300005288 | Ga0065714_10109739 | Ga0065714_101097391 | 123 |
| 109 | 3300005288 | Ga0065714_10242803 | Ga0065714_102428032 | 123 |
| 110 | 3300005327 | Ga0070658_11039618 | Ga0070658_110396181 | 123 |
| 111 | 3300005327 | Ga0070658_11938297 | Ga0070658_119382971 | 123 |
| 112 | 3300005329 | Ga0070683_100876590 | Ga0070683_1008765901 | 123 |
| 113 | 3300005336 | Ga0070680_100138019 | Ga0070680_1001380191 | 123 |
| 114 | 3300005337 | Ga0070682_100362188 | Ga0070682_1003621882 | 123 |
| 115 | 3300005338 | Ga0068868_100328835 | Ga0068868_1003288352 | 123 |
| 116 | 3300005338 | Ga0068868_100811612 | Ga0068868_1008116122 | 123 |
| 117 | 3300005353 | Ga0070669_100857612 | Ga0070669_1008576121 | 123 |
| 118 | 3300005458 | Ga0070681_10181430 | Ga0070681_101814304 | 123 |
| 119 | 3300005458 | Ga0070681_10663560 | Ga0070681_106635601 | 123 |
| 120 | 3300005459 | Ga0068867_101010826 | Ga0068867_1010108261 | 123 |
| 121 | 3300005530 | Ga0070679_100000516 | Ga0070679_10000051619 | 123 |
| 122 | 3300005530 | Ga0070679_100429339 | Ga0070679_1004293392 | 123 |
| 123 | 3300005539 | Ga0068853_100223648 | Ga0068853_1002236482 | 123 |
| 124 | 3300005539 | Ga0068853_100248258 | Ga0068853_1002482582 | 123 |
| 125 | 3300005543 | Ga0070672_101645005 | Ga0070672_1016450051 | 123 |
| 126 | 3300005548 | Ga0070665_100226722 | Ga0070665_1002267222 | 123 |
| 127 | 3300005563 | Ga0068855_100233439 | Ga0068855_1002334394 | 123 |
| 128 | 3300005563 | Ga0068855_100587966 | Ga0068855_1005879661 | 123 |
| 129 | 3300005577 | Ga0068857_101368930 | Ga0068857_1013689301 | 123 |
| 130 | 3300005578 | Ga0068854_100363362 | Ga0068854_1003633622 | 123 |
| 131 | 3300005614 | Ga0068856_100007984 | Ga0068856_10000798417 | 123 |
| 132 | 3300005616 | Ga0068852_100004411 | Ga0068852_1000044118 | 123 |
| 133 | 3300005616 | Ga0068852_100078968 | Ga0068852_1000789683 | 123 |
| 134 | 3300005616 | Ga0068852_100580426 | Ga0068852_1005804261 | 123 |
| 135 | 3300005618 | Ga0068864_100191516 | Ga0068864_1001915163 | 123 |
| 136 | 3300005834 | Ga0068851_10059444 | Ga0068851_100594443 | 123 |
| 137 | 3300005843 | Ga0068860_100206160 | Ga0068860_1002061602 | 123 |
| 138 | 3300005844 | Ga0068862_100356374 | Ga0068862_1003563743 | 123 |
| 139 | 3300006358 | Ga0068871_100427917 | Ga0068871_1004279172 | 123 |
| 140 | 3300006358 | Ga0068871_101648701 | Ga0068871_1016487011 | 123 |
| 141 | 3300009174 | Ga0105241_10013489 | Ga0105241_1001348911 | 123 |
| 142 | 3300009174 | Ga0105241_10277134 | Ga0105241_102771343 | 123 |
| 143 | 3300009545 | Ga0105237_10032378 | Ga0105237_100323786 | 123 |
| 144 | 3300009545 | Ga0105237_10317308 | Ga0105237_103173081 | 123 |
| 145 | 3300009553 | Ga0105249_10509540 | Ga0105249_105095402 | 123 |
| 146 | 3300011119 | Ga0105246_10941563 | Ga0105246_109415631 | 123 |
| 147 | 3300013100 | Ga0157373_10315208 | Ga0157373_103152082 | 123 |
| 148 | 3300013102 | Ga0157371_10346450 | Ga0157371_103464502 | 123 |
| 149 | 3300013105 | Ga0157369_10522154 | Ga0157369_105221542 | 123 |
| 150 | 3300013297 | Ga0157378_11135573 | Ga0157378_111355732 | 123 |
| 151 | 3300013306 | Ga0163162_10357750 | Ga0163162_103577503 | 123 |
| 152 | 3300013306 | Ga0163162_11347956 | Ga0163162_113479561 | 123 |
| 153 | 3300013307 | Ga0157372_11435104 | Ga0157372_114351042 | 123 |
| 154 | 3300013308 | Ga0157375_10666148 | Ga0157375_106661482 | 123 |
| 155 | 3300014325 | Ga0163163_10334387 | Ga0163163_103343872 | 123 |
| 156 | 3300014325 | Ga0163163_10441221 | Ga0163163_104412212 | 123 |
| 157 | 3300014325 | Ga0163163_11915623 | Ga0163163_119156231 | 123 |
| 158 | 3300014326 | Ga0157380_10839899 | Ga0157380_108398992 | 123 |
| 159 | 3300014326 | Ga0157380_11019689 | Ga0157380_110196892 | 123 |
| 160 | 3300014968 | Ga0157379_11439613 | Ga0157379_114396131 | 123 |
| 161 | 3300017792 | Ga0163161_10428563 | Ga0163161_104285632 | 123 |
| 162 | 3300025909 | Ga0207705_10015882 | Ga0207705_100158823 | 123 |
| 163 | 3300025909 | Ga0207705_10804811 | Ga0207705_108048111 | 123 |
| 164 | 3300025911 | Ga0207654_10034782 | Ga0207654_100347824 | 123 |
| 165 | 3300025912 | Ga0207707_10255016 | Ga0207707_102550163 | 123 |
| 166 | 3300025917 | Ga0207660_10117135 | Ga0207660_101171352 | 123 |
| 167 | 3300025921 | Ga0207652_10000778 | Ga0207652_1000077817 | 123 |
| 168 | 3300025923 | Ga0207681_10739001 | Ga0207681_107390011 | 123 |
| 169 | 3300025923 | Ga0207681_11606710 | Ga0207681_116067101 | 123 |
| 170 | 3300025938 | Ga0207704_11658287 | Ga0207704_116582871 | 123 |
| 171 | 3300025940 | Ga0207691_10979868 | Ga0207691_109798682 | 123 |
| 172 | 3300025949 | Ga0207667_10027905 | Ga0207667_100279052 | 123 |
| 173 | 3300025981 | Ga0207640_11395958 | Ga0207640_113959581 | 123 |
| 174 | 3300025986 | Ga0207658_11291720 | Ga0207658_112917201 | 123 |
| 175 | 3300026023 | Ga0207677_10381137 | Ga0207677_103811372 | 123 |
| 176 | 3300026041 | Ga0207639_10917055 | Ga0207639_109170551 | 123 |
| 177 | 3300026078 | Ga0207702_10360002 | Ga0207702_103600022 | 123 |
| 178 | 3300026095 | Ga0207676_10264320 | Ga0207676_102643202 | 123 |
| 179 | 3300026116 | Ga0207674_10135517 | Ga0207674_101355173 | 123 |
| 180 | 3300026116 | Ga0207674_11114780 | Ga0207674_111147801 | 123 |
| 181 | 3300026142 | Ga0207698_10028338 | Ga0207698_100283385 | 123 |
| 182 | 3300026142 | Ga0207698_10139623 | Ga0207698_101396232 | 123 |
| 183 | 3300028379 | Ga0268266_10188574 | Ga0268266_101885742 | 123 |
| 184 | 3300028380 | Ga0268265_10579433 | Ga0268265_105794332 | 123 |
| 185 | 3300028380 | Ga0268265_11791890 | Ga0268265_117918902 | 123 |
| 186 | 3300028381 | Ga0268264_10176282 | Ga0268264_101762823 | 123 |
| 187 | 3300031507 | Ga0307509_10077584 | Ga0307509_100775843 | 123 |
| 188 | 3300032126 | Ga0307415_100344075 | Ga0307415_1003440751 | 123 |
| 189 | 3300046660 | Ga0495625_0035400 | Ga0495625_0035400_1123_1530 | 123 |
| 190 | 3300047320 | Ga0495672_0288920 | Ga0495672_0288920_101_508 | 123 |
| 191 | 3300049575 | Ga0501039_0063102 | Ga0501039_0063102_1181_1555 | 123 |
| 192 | 3300053118 | Ga0500594_0030356 | Ga0500594_0030356_883_1290 | 123 |
| 193 | 3300053151 | Ga0500604_0184122 | Ga0500604_0184122_233_640 | 123 |
| 194 | 3300002459 | JGI24751J29686_10000562 | JGI24751J29686_100005627 | 125 |
| 195 | 3300005330 | Ga0070690_100144500 | Ga0070690_1001445002 | 125 |
| 196 | 3300005331 | Ga0070670_100008003 | Ga0070670_1000080032 | 125 |
| 197 | 3300005353 | Ga0070669_100457145 | Ga0070669_1004571452 | 125 |
| 198 | 3300005354 | Ga0070675_101099194 | Ga0070675_1010991942 | 125 |
| 199 | 3300005355 | Ga0070671_100724976 | Ga0070671_1007249761 | 125 |
| 200 | 3300005367 | Ga0070667_100377468 | Ga0070667_1003774681 | 125 |
| 201 | 3300005459 | Ga0068867_100526944 | Ga0068867_1005269443 | 125 |
| 202 | 3300005543 | Ga0070672_100136808 | Ga0070672_1001368085 | 125 |
| 203 | 3300005577 | Ga0068857_100249124 | Ga0068857_1002491242 | 125 |
| 204 | 3300005617 | Ga0068859_100049953 | Ga0068859_1000499532 | 125 |
| 205 | 3300005617 | Ga0068859_100788620 | Ga0068859_1007886202 | 125 |
| 206 | 3300005618 | Ga0068864_100005829 | Ga0068864_1000058298 | 125 |
| 207 | 3300005719 | Ga0068861_101469833 | Ga0068861_1014698331 | 125 |
| 208 | 3300005844 | Ga0068862_100832937 | Ga0068862_1008329371 | 125 |
| 209 | 3300006163 | Ga0070715_10276984 | Ga0070715_102769842 | 125 |
| 210 | 3300006237 | Ga0097621_100914797 | Ga0097621_1009147972 | 125 |
| 211 | 3300006358 | Ga0068871_100003998 | Ga0068871_1000039989 | 125 |
| 212 | 3300006846 | Ga0075430_101476078 | Ga0075430_1014760781 | 125 |
| 213 | 3300006881 | Ga0068865_100874346 | Ga0068865_1008743462 | 125 |
| 214 | 3300006931 | Ga0097620_100049951 | Ga0097620_1000499512 | 125 |
| 215 | 3300006931 | Ga0097620_100788542 | Ga0097620_1007885422 | 125 |
| 216 | 3300009093 | Ga0105240_10155814 | Ga0105240_101558143 | 125 |
| 217 | 3300009094 | Ga0111539_10853849 | Ga0111539_108538492 | 125 |
| 218 | 3300009176 | Ga0105242_11413099 | Ga0105242_114130992 | 125 |
| 219 | 3300009553 | Ga0105249_10000434 | Ga0105249_100004348 | 125 |
| 220 | 3300009553 | Ga0105249_10379442 | Ga0105249_103794422 | 125 |
| 221 | 3300013297 | Ga0157378_10006062 | Ga0157378_100060624 | 125 |
| 222 | 3300013306 | Ga0163162_10409817 | Ga0163162_104098171 | 125 |
| 223 | 3300013308 | Ga0157375_10247011 | Ga0157375_102470114 | 125 |
| 224 | 3300014325 | Ga0163163_10295496 | Ga0163163_102954961 | 125 |
| 225 | 3300014326 | Ga0157380_11672698 | Ga0157380_116726981 | 125 |
| 226 | 3300014745 | Ga0157377_10197193 | Ga0157377_101971932 | 125 |
| 227 | 3300014968 | Ga0157379_11859432 | Ga0157379_118594321 | 125 |
| 228 | 3300017792 | Ga0163161_10095240 | Ga0163161_100952403 | 125 |
| 229 | 3300025913 | Ga0207695_11471211 | Ga0207695_114712111 | 125 |
| 230 | 3300025925 | Ga0207650_10209376 | Ga0207650_102093761 | 125 |
| 231 | 3300025931 | Ga0207644_11699704 | Ga0207644_116997041 | 125 |
| 232 | 3300025961 | Ga0207712_10085644 | Ga0207712_100856443 | 125 |
| 233 | 3300025986 | Ga0207658_10140370 | Ga0207658_101403703 | 125 |
| 234 | 3300026089 | Ga0207648_10111430 | Ga0207648_101114303 | 125 |
| 235 | 3300026095 | Ga0207676_10015007 | Ga0207676_100150075 | 125 |
| 236 | 3300026116 | Ga0207674_10144591 | Ga0207674_101445912 | 125 |
| 237 | 3300026116 | Ga0207674_11593307 | Ga0207674_115933071 | 125 |
| 238 | 3300026118 | Ga0207675_101658582 | Ga0207675_1016585821 | 125 |
| 239 | 3300027907 | Ga0207428_11305454 | Ga0207428_113054541 | 125 |
| 240 | 3300028380 | Ga0268265_12525206 | Ga0268265_125252061 | 125 |
| 241 | 3300028381 | Ga0268264_10604251 | Ga0268264_106042512 | 125 |
| 242 | 3300031730 | Ga0307516_10275047 | Ga0307516_102750471 | 125 |
| 243 | 3300032004 | Ga0307414_10777088 | Ga0307414_107770881 | 125 |
| 244 | 3300041406 | Ga0439439_0056048 | Ga0439439_0056048_229_609 | 125 |
| 245 | 3300041410 | Ga0439461_0050551 | Ga0439461_0050551_484_864 | 125 |
| 246 | 3300041507 | Ga0451851_1063005 | Ga0451851_1063005_45_422 | 125 |
| 247 | 3300041997 | Ga0439431_0103439 | Ga0439431_0103439_302_682 | 125 |
| 248 | 3300042002 | Ga0439442_049424 | Ga0439442_049424_245_625 | 125 |
| 249 | 3300042006 | Ga0439432_024415 | Ga0439432_024415_622_1002 | 125 |
| 250 | 3300042007 | Ga0439449_0123290 | Ga0439449_0123290_151_531 | 125 |
| 251 | 3300042014 | Ga0439457_027220 | Ga0439457_027220_320_700 | 125 |
| 252 | 3300042015 | Ga0439462_0077551 | Ga0439462_0077551_351_731 | 125 |
| 253 | 3300042124 | Ga0450922_018757 | Ga0450922_018757_14_391 | 125 |
| 254 | 3300042128 | Ga0450897_007154 | Ga0450897_007154_610_990 | 125 |
| 255 | 3300042156 | Ga0439446_0305011 | Ga0439446_0305011_91_471 | 125 |
| 256 | 3300042435 | Ga0439434_0035358 | Ga0439434_0035358_10_390 | 125 |
| 257 | 3300042532 | Ga0450893_0027645 | Ga0450893_0027645_555_935 | 125 |
| 258 | 3300044673 | Ga0453683_0416871 | Ga0453683_0416871_334_720 | 125 |
| 259 | 3300046539 | Ga0495621_0172631 | Ga0495621_0172631_460_843 | 125 |
| 260 | 3300048908 | Ga0496105_1182980 | Ga0496105_1182980_63_449 | 125 |
| 261 | 3300048913 | Ga0496110_1113450 | Ga0496110_1113450_279_665 | 125 |
| 262 | 3300049571 | Ga0501034_0011665 | Ga0501034_0011665_574_954 | 125 |
| 263 | 3300049572 | Ga0501036_0014298 | Ga0501036_0014298_1295_1675 | 125 |
| 264 | 3300049573 | Ga0501037_0030794 | Ga0501037_0030794_3554_3934 | 125 |
| 265 | 3300049579 | Ga0501043_0003382 | Ga0501043_0003382_12573_12953 | 125 |
| 266 | 3300049581 | Ga0501047_0113373 | Ga0501047_0113373_471_851 | 125 |
| 267 | 3300049582 | Ga0501048_0135671 | Ga0501048_0135671_684_1064 | 125 |
| 268 | 3300049583 | Ga0501067_0086062 | Ga0501067_0086062_116_496 | 125 |
| 269 | 3300049589 | Ga0501073_0080122 | Ga0501073_0080122_839_1219 | 125 |
| 270 | 3300049590 | Ga0501074_0001989 | Ga0501074_0001989_1378_1758 | 125 |
| 271 | 3300049742 | Ga0501080_0092401 | Ga0501080_0092401_543_923 | 125 |
| 272 | 3300049742 | Ga0501080_1150799 | Ga0501080_1150799_51_431 | 125 |
| 273 | 3300049744 | Ga0501083_0023096 | Ga0501083_0023096_1424_1804 | 125 |
| 274 | 3300049822 | Ga0501035_0508056 | Ga0501035_0508056_548_928 | 125 |
| 275 | 3300049823 | Ga0501044_0095824 | Ga0501044_0095824_1182_1562 | 125 |
| 276 | 3300049824 | Ga0501045_0301446 | Ga0501045_0301446_566_946 | 125 |
| 277 | 3300050509 | nmdc:mga0qj67_934437_c1 | nmdc:mga0qj67_934437_c1_185_562 | 125 |
| 278 | 3300050511 | nmdc:mga08y16_870651_c1 | nmdc:mga08y16_870651_c1_242_619 | 125 |
| 279 | 3300054114 | Ga0501084_0090971 | Ga0501084_0090971_1887_2267 | 125 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hda-assembly1.cif.gz_C | crystal structure of the bs69 coiled coil-mynd domains bound to an ebna2 pxlxp motif | 0.693 | 4 | 41 |
| 8dt6-assembly1.cif.gz_C | crystal structure of dna polymerase iii beta subunit from elizabethkingia anophelis | 0.6627 | 99 | 125 |
| 1qhu-assembly1.cif.gz_A | mammalian blood serum haemopexin deglycosylated and in complex with its ligand haem | 0.6447 | 89 | 118 |
| 6pph-assembly1.cif.gz_k | kaposi's sarcoma-associated herpesvirus (kshv), c1 penton vertex register, catc-binding structure | 0.6396 | 99 | 125 |
| 6w2e-assembly1.cif.gz_v | structures of capsid and capsid-associated tegument complex inside the epstein-barr virus | 0.636 | 100 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14139_284_342_2.40.50.40 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.78 | 87 | 102 | 2.40.50.40 |
| af_A0A2R8Q3B4_533_592_2.40.50.40 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.7401 | 87 | 102 | 2.40.50.40 |
| af_Q499S5_294_485_2.110.10.10 | Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain | 0.7222 | 88 | 113 | 2.110.10.10 |
| 1hxnA00 | Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain | 0.7163 | 88 | 115 | 2.110.10.10 |
| 3dmdA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain | 0.6696 | 46 | 82 | 1.20.120.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S7VB66-F1-model_v4 | Uncharacterized protein | 0.9682 | 40 | 125 |
|
| AF-A0A4Q1CFQ5-F1-model_v4 | Uncharacterized protein | 0.9673 | 40 | 122 |
|
| AF-A0A410G7K8-F1-model_v4 | Uncharacterized protein | 0.9633 | 43 | 123 |
|
| AF-M7X493-F1-model_v4 | Uncharacterized protein | 0.9584 | 47 | 125 |
|
| AF-J1FF33-F1-model_v4 | Uncharacterized protein | 0.954 | 49 | 123 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar