F382664

General Info

Members Datasets Scaffolds Average Seq Length
278 156 556 160

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0247924|Ga0501040_0247924_65_592
Length 175
Sequence VRVTRDLPPEENDDTEPPERPSGHVSTTSVGALVGFGLTGLVLGWLLRPASIRLNGSAPTVGWLPVLALLLVAAILAAVAWSTYRDLHRRNLHLEPHKAVNRLVLAKASALVGALVAGGYFGYALSWWGVSEAALATQRLVQSLVAGVAGVLIVAGSLLLERACRVRGGDDSDIG

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
77 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
78 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
79 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
140 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
141 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
142 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 2643221561 Nocardioides sp. Root151 Isolate Unclassified
149 2643221576 Nocardioides sp. Root614 Isolate Unclassified
150 2643221590 Nocardioides sp. Root682 Isolate Unclassified
151 2643221615 Nocardioides sp. Root224 Isolate Unclassified
152 2643221617 Nocardioides sp. Root79 Isolate Unclassified
153 2643221620 Nocardioides sp. Root240 Isolate Unclassified
154 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
155 2643221696 Nocardioides sp. Root140 Isolate Unclassified
156 2738541305 Nocardioides sp. CF167 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0.72
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.71
Nodule 0
Rhizoplane 3.96
Rhizosphere 72.66
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0247924 3300049576 Bacteria 1270
2 LJQas_1003344 3300000549 Bacteria 2158
3 rootH1_10232593 3300003323 Bacteria 1245
4 Ga0070683_100073020 3300005329 Bacteria 3204
5 Ga0070670_100284932 3300005331 Bacteria 1443
6 Ga0070680_100086473 3300005336 Bacteria 2591
7 Ga0070675_100516710 3300005354 Bacteria 1077
8 Ga0070673_100266619 3300005364 Bacteria 1498
9 Ga0070688_100091129 3300005365 Bacteria 1992
10 Ga0070659_100221805 3300005366 Bacteria 1560
11 Ga0070667_100312812 3300005367 Bacteria 1416
12 Ga0070667_100458721 3300005367 Bacteria 1165
13 Ga0070714_100090312 3300005435 Bacteria 2682
14 Ga0070700_100074691 3300005441 Bacteria 2173
15 Ga0070663_100059495 3300005455 Bacteria 2746
16 Ga0070678_100941051 3300005456 Bacteria 792
17 Ga0070678_101168818 3300005456 Bacteria 712
18 Ga0070684_100278557 3300005535 Bacteria 1532
19 Ga0068853_100754540 3300005539 Bacteria 930
20 Ga0070686_100577445 3300005544 Bacteria 883
21 Ga0068852_100817340 3300005616 Bacteria 947
22 Ga0068870_10169376 3300005840 Bacteria 1302
23 Ga0068863_100796610 3300005841 Bacteria 942
24 Ga0068860_100000365 3300005843 Bacteria 59835
25 Ga0068862_101501623 3300005844 Unclassified 679
26 Ga0075365_10028031 3300006038 Bacteria 3589
27 Ga0075365_10028411 3300006038 Bacteria 3567
28 Ga0075365_10060582 3300006038 Bacteria 2525
29 Ga0075365_10083986 3300006038 Bacteria 2160
30 Ga0075365_10092301 3300006038 Bacteria 2064
31 Ga0075365_10115280 3300006038 Bacteria 1849
32 Ga0075365_10126912 3300006038 Bacteria 1763
33 Ga0075365_10150430 3300006038 Bacteria 1619
34 Ga0075365_10183489 3300006038 Bacteria 1463
35 Ga0075365_10191599 3300006038 Bacteria 1431
36 Ga0075365_10209286 3300006038 Bacteria 1367
37 Ga0075365_10217154 3300006038 Bacteria 1341
38 Ga0075365_10267452 3300006038 Bacteria 1202
39 Ga0075365_10273495 3300006038 Bacteria 1188
40 Ga0075365_10520181 3300006038 Bacteria 841
41 Ga0075365_10543049 3300006038 Unclassified 822
42 Ga0075368_10002319 3300006042 Bacteria 6178
43 Ga0075368_10042050 3300006042 Bacteria 1797
44 Ga0075364_10170697 3300006051 Bacteria 1470
45 Ga0075364_10479176 3300006051 Bacteria 850
46 Ga0075364_10823116 3300006051 Bacteria 633
47 Ga0075367_10025829 3300006178 Bacteria 3324
48 Ga0075367_10123659 3300006178 Bacteria 1596
49 Ga0075367_10157995 3300006178 Bacteria 1409
50 Ga0097621_100601494 3300006237 Bacteria 1005
51 Ga0075370_10161800 3300006353 Bacteria 1314
52 Ga0075370_10164526 3300006353 Bacteria 1303
53 Ga0068865_100763034 3300006881 Bacteria 832
54 Ga0105245_10232075 3300009098 Bacteria 1785
55 Ga0105243_10073744 3300009148 Bacteria 2766
56 Ga0105243_10634403 3300009148 Bacteria 1033
57 Ga0105238_11273550 3300009551 Bacteria 761
58 Ga0105246_10136085 3300011119 Bacteria 1842
59 Ga0163162_11007748 3300013306 Bacteria 942
60 Ga0157372_10128203 3300013307 Bacteria 2918
61 Ga0157372_10857956 3300013307 Bacteria 1054
62 Ga0157375_10156471 3300013308 Bacteria 2418
63 Ga0157375_10227469 3300013308 Bacteria 2024
64 Ga0157380_10036686 3300014326 Bacteria 3794
65 Ga0157377_10201592 3300014745 Bacteria 1263
66 Ga0157376_10669060 3300014969 Bacteria 1040
67 Ga0163161_10084042 3300017792 Bacteria 2347
68 Ga0197907_11241296 3300020069 Bacteria 715
69 Ga0206354_11163214 3300020081 Bacteria 2040
70 Ga0207643_10183609 3300025908 Bacteria 1267
71 Ga0207660_10307871 3300025917 Bacteria 1262
72 Ga0207662_10103938 3300025918 Bacteria 1763
73 Ga0207650_10093900 3300025925 Bacteria 2297
74 Ga0207650_10766718 3300025925 Bacteria 817
75 Ga0207687_10388865 3300025927 Bacteria 1145
76 Ga0207709_10196507 3300025935 Bacteria 1437
77 Ga0207709_10654812 3300025935 Bacteria 837
78 Ga0207669_10292635 3300025937 Bacteria 1234
79 Ga0207704_10282646 3300025938 Bacteria 1262
80 Ga0207691_10098799 3300025940 Bacteria 2607
81 Ga0207661_10111380 3300025944 Bacteria 2316
82 Ga0207712_10149774 3300025961 Bacteria 1801
83 Ga0207658_11143522 3300025986 Bacteria 711
84 Ga0207678_10560327 3300026067 Bacteria 1000
85 Ga0207708_10004849 3300026075 Bacteria 9913
86 Ga0207648_10090629 3300026089 Bacteria 2672
87 Ga0207675_100029849 3300026118 Bacteria 5077
88 Ga0207675_100368994 3300026118 Bacteria 1409
89 Ga0207683_10045648 3300026121 Bacteria 3832
90 Ga0207683_10549620 3300026121 Bacteria 1068
91 Ga0268265_11055716 3300028380 Bacteria 805
92 Ga0268265_11252361 3300028380 Unclassified 741
93 Ga0268264_10000249 3300028381 Bacteria 101309
94 Ga0268264_10408313 3300028381 Bacteria 1307
95 Ga0307408_100670551 3300031548 Bacteria 929
96 Ga0307405_10080895 3300031731 Bacteria 2122
97 Ga0307405_10111533 3300031731 Bacteria 1854
98 Ga0307405_10192555 3300031731 Bacteria 1474
99 Ga0307413_10564418 3300031824 Bacteria 926
100 Ga0307410_10051642 3300031852 Bacteria 2772
101 Ga0307410_10113484 3300031852 Bacteria 1964
102 Ga0307410_10956284 3300031852 Bacteria 737
103 Ga0307406_10028045 3300031901 Bacteria 3399
104 Ga0307406_10106308 3300031901 Bacteria 1922
105 Ga0307407_10008927 3300031903 Bacteria 4634
106 Ga0307412_11073146 3300031911 Bacteria 715
107 Ga0307409_100007990 3300031995 Bacteria 6376
108 Ga0307409_100028778 3300031995 Bacteria 3965
109 Ga0307409_100255995 3300031995 Bacteria 1603
110 Ga0307409_101289258 3300031995 Bacteria 755
111 Ga0307409_101390701 3300031995 Bacteria 728
112 Ga0307416_100064935 3300032002 Bacteria 2997
113 Ga0307416_100151372 3300032002 Bacteria 2128
114 Ga0307416_100499821 3300032002 Bacteria 1280
115 Ga0307414_10038907 3300032004 Bacteria 3199
116 Ga0307411_10135629 3300032005 Bacteria 1806
117 Ga0307411_10143048 3300032005 Bacteria 1766
118 Ga0307411_10245274 3300032005 Bacteria 1405
119 Ga0307415_100008246 3300032126 Bacteria 5766
120 Ga0307415_100122172 3300032126 Bacteria 1955
121 Ga0307415_100135756 3300032126 Bacteria 1870
122 Ga0395899_0022737 3300037312 Bacteria 4750
123 Ga0451793_1377064 3300041452 Bacteria 2014
124 Ga0451804_0058499 3300041463 Bacteria 809
125 Ga0451837_1527663 3300041494 Bacteria 722
126 Ga0451839_1330970 3300041496 Bacteria 726
127 Ga0439449_0366450 3300042007 Unclassified 546
128 Ga0466969_0021919 3300044656 Bacteria 3302
129 Ga0466965_0162864 3300044683 Bacteria 1170
130 Ga0466966_0003051 3300044684 Bacteria 11049
131 Ga0466966_0016012 3300044684 Bacteria 4957
132 Ga0466961_0144690 3300044693 Bacteria 1487
133 Ga0466961_0146996 3300044693 Bacteria 1473
134 Ga0466963_0001511 3300044694 Bacteria 12579
135 Ga0466963_0074199 3300044694 Bacteria 2294
136 Ga0466963_0109871 3300044694 Bacteria 1892
137 Ga0466971_0045928 3300044719 Bacteria 1962
138 Ga0466970_0045916 3300044765 Bacteria 2326
139 Ga0466957_0041466 3300044842 Bacteria 2784
140 Ga0466960_0002792 3300044901 Bacteria 6610
141 Ga0466960_0008294 3300044901 Bacteria 4250
142 Ga0466960_0008868 3300044901 Bacteria 4131
143 Ga0466960_0040395 3300044901 Bacteria 2206
144 Ga0466960_0249491 3300044901 Bacteria 985
145 Ga0466959_0333064 3300045049 Bacteria 1036
146 Ga0466959_0448719 3300045049 Unclassified 874
147 Ga0466959_0643891 3300045049 Bacteria 712
148 Ga0466958_0444592 3300045836 Bacteria 839
149 Ga0466967_0041875 3300045976 Bacteria 3953
150 Ga0466967_0303656 3300045976 Bacteria 1536
151 Ga0466967_0488281 3300045976 Bacteria 1207
152 Ga0466967_0572152 3300045976 Bacteria 1113
153 Ga0466967_0590536 3300045976 Bacteria 1095
154 Ga0466967_1818507 3300045976 Bacteria 606
155 Ga0495664_0459424 3300046477 Bacteria 762
156 Ga0495634_0231416 3300046642 Bacteria 1137
157 Ga0495647_0369813 3300046681 Bacteria 655
158 Ga0496101_0056423 3300048904 Bacteria 2840
159 Ga0496101_1189192 3300048904 Bacteria 598
160 Ga0496108_0731876 3300048911 Bacteria 856
161 Ga0496109_0154276 3300048912 Bacteria 2151
162 Ga0496109_0590713 3300048912 Bacteria 1046
163 Ga0496111_0706302 3300048914 Bacteria 733
164 Ga0496114_0105683 3300048917 Bacteria 2408
165 Ga0496114_0686109 3300048917 Bacteria 899
166 Ga0496114_1093527 3300048917 Bacteria 682
167 Ga0496124_0271137 3300048927 Bacteria 1243
168 Ga0501031_0222570 3300049568 Bacteria 1229
169 Ga0501031_0226567 3300049568 Bacteria 1217
170 Ga0501031_0696498 3300049568 Bacteria 652
171 Ga0501031_0700316 3300049568 Bacteria 650
172 Ga0501032_0023409 3300049569 Bacteria 4267
173 Ga0501033_0049910 3300049570 Bacteria 3105
174 Ga0501033_0236241 3300049570 Bacteria 1297
175 Ga0501034_0413713 3300049571 Bacteria 1270
176 Ga0501036_0001438 3300049572 Bacteria 18306
177 Ga0501037_0005184 3300049573 Bacteria 9480
178 Ga0501038_0003565 3300049574 Bacteria 14482
179 Ga0501038_0361371 3300049574 Bacteria 1129
180 Ga0501038_1016116 3300049574 Bacteria 608
181 Ga0501039_0006069 3300049575 Bacteria 9169
182 Ga0501039_0029625 3300049575 Bacteria 4216
183 Ga0501039_0327859 3300049575 Bacteria 1203
184 Ga0501039_0931251 3300049575 Bacteria 676
185 Ga0501040_0097566 3300049576 Bacteria 2048
186 Ga0501040_0135643 3300049576 Bacteria 1733
187 Ga0501040_0481343 3300049576 Bacteria 894
188 Ga0501042_0007823 3300049578 Bacteria 7026
189 Ga0501042_0317274 3300049578 Bacteria 1126
190 Ga0501042_1139962 3300049578 Bacteria 568
191 Ga0501043_0005018 3300049579 Bacteria 10714
192 Ga0501043_0627296 3300049579 Bacteria 791
193 Ga0501046_0000399 3300049580 Bacteria 43497
194 Ga0501046_0001508 3300049580 Bacteria 22200
195 Ga0501046_0460366 3300049580 Bacteria 914
196 Ga0501047_0004295 3300049581 Bacteria 13411
197 Ga0501047_0995929 3300049581 Bacteria 651
198 Ga0501048_0008479 3300049582 Bacteria 7772
199 Ga0501048_0785958 3300049582 Bacteria 684
200 Ga0501067_0120623 3300049583 Bacteria 1459
201 Ga0501067_0495572 3300049583 Bacteria 683
202 Ga0501069_0400222 3300049585 Bacteria 812
203 Ga0501070_0122156 3300049586 Bacteria 2152
204 Ga0501070_0443888 3300049586 Bacteria 1046
205 Ga0501071_0469837 3300049587 Bacteria 963
206 Ga0501071_0502188 3300049587 Bacteria 930
207 Ga0501072_0344760 3300049588 Bacteria 1183
208 Ga0501072_0363144 3300049588 Bacteria 1149
209 Ga0501072_0422343 3300049588 Bacteria 1057
210 Ga0501072_0442307 3300049588 Bacteria 1030
211 Ga0501073_0395143 3300049589 Bacteria 955
212 Ga0501074_0434946 3300049590 Bacteria 930
213 Ga0501074_0552788 3300049590 Bacteria 815
214 Ga0501074_0569037 3300049590 Bacteria 802
215 Ga0501075_0460414 3300049591 Bacteria 970
216 Ga0501075_0493024 3300049591 Bacteria 935
217 Ga0501075_0503517 3300049591 Bacteria 924
218 Ga0501075_0675373 3300049591 Bacteria 787
219 Ga0501075_1445201 3300049591 Bacteria 521
220 Ga0501076_1603976 3300049592 Bacteria 534
221 Ga0501079_0273405 3300049741 Bacteria 1321
222 Ga0501079_0750179 3300049741 Bacteria 768
223 Ga0501080_1749856 3300049742 Bacteria 523
224 Ga0501081_0800969 3300049743 Bacteria 709
225 Ga0501083_0329410 3300049744 Bacteria 993
226 Ga0501035_0002293 3300049822 Bacteria 18896
227 Ga0501035_1062348 3300049822 Bacteria 634
228 Ga0501044_0004136 3300049823 Bacteria 16288
229 Ga0501045_0047485 3300049824 Bacteria 3128
230 Ga0501045_0235740 3300049824 Bacteria 1362
231 Ga0501045_0309934 3300049824 Bacteria 1175
232 Ga0501045_0381074 3300049824 Bacteria 1050
233 Ga0501045_0397358 3300049824 Bacteria 1026
234 Ga0501212_057115 3300049851 Unclassified 670
235 nmdc:mga03n38_104349_c1 3300050490 Bacteria 1371
236 nmdc:mga03n38_43694_c1 3300050490 Bacteria 1965
237 nmdc:mga00v17_358156_c1 3300050491 Bacteria 948
238 nmdc:mga00v17_36667_c1 3300050491 Bacteria 2924
239 nmdc:mga00v17_411781_c1 3300050491 Bacteria 878
240 nmdc:mga0yw44_112376_c1 3300050492 Bacteria 1747
241 nmdc:mga0yw44_148706_c1 3300050492 Bacteria 1527
242 nmdc:mga0yw44_18958_c1 3300050492 Bacteria 3783
243 nmdc:mga0yw44_20757_c1 3300050492 Bacteria 3652
244 nmdc:mga0yw44_207658_c1 3300050492 Bacteria 1295
245 nmdc:mga0yw44_37800_c1 3300050492 Bacteria 2853
246 nmdc:mga0yw44_60845_c1 3300050492 Bacteria 2315
247 nmdc:mga0yw44_623197_c1 3300050492 Unclassified 733
248 nmdc:mga0yw44_63782_c1 3300050492 Bacteria 2266
249 nmdc:mga0yw44_87258_c1 3300050492 Bacteria 1966
250 nmdc:mga0yw44_91317_c1 3300050492 Unclassified 908
251 nmdc:mga06z11_1009440_c1 3300050494 Bacteria 507
252 nmdc:mga06z11_48453_c1 3300050494 Bacteria 2163
253 nmdc:mga06z11_70077_c1 3300050494 Bacteria 1853
254 nmdc:mga04h51_16629_c1 3300050495 Bacteria 2138
255 nmdc:mga07m45_260100_c1 3300050496 Bacteria 1010
256 nmdc:mga07m45_67285_c1 3300050496 Bacteria 2036
257 Ga0495601_0019193 3300053077 Bacteria 4167
258 Ga0500644_0000201 3300053088 Bacteria 36319
259 Ga0500554_037522 3300053102 Bacteria 1470
260 Ga0500556_0003070 3300053104 Bacteria 5003
261 Ga0500573_0041385 3300053140 Bacteria 2660
262 Ga0501084_0263931 3300054114 Bacteria 1454
263 Ga0501084_0379271 3300054114 Bacteria 1195
264 Ga0501084_0644196 3300054114 Bacteria 895
265 Ga0590077_050078 3300059426 Bacteria 937
266 Ga0501082_0404335 3300060353 Bacteria 1192
267 Ga0466962_0020522 3300061719 Bacteria 3175
268 Ga0530510_0147775 3300061734 Bacteria 1734
269 Ga0530510_0441493 3300061734 Bacteria 983
270 2643824770 2643221561 Bacteria 4984412
271 2643892777 2643221576 Bacteria 5214352
272 2643962226 2643221590 Bacteria 5214697
273 2644093190 2643221615 Bacteria 5487866
274 2644100037 2643221617 Bacteria 5139111
275 2644117643 2643221620 Bacteria 5134593
276 2644322801 2643221657 Bacteria 5490246
277 2644536021 2643221696 Bacteria 5431823
278 2738871104 2738541305 Bacteria 4910150
279 Ga0501040_0247924
280 LJQas_1003344
281 rootH1_10232593
282 Ga0070683_100073020
283 Ga0070670_100284932
284 Ga0070680_100086473
285 Ga0070675_100516710
286 Ga0070673_100266619
287 Ga0070688_100091129
288 Ga0070659_100221805
289 Ga0070667_100312812
290 Ga0070667_100458721
291 Ga0070714_100090312
292 Ga0070700_100074691
293 Ga0070663_100059495
294 Ga0070678_100941051
295 Ga0070678_101168818
296 Ga0070684_100278557
297 Ga0068853_100754540
298 Ga0070686_100577445
299 Ga0068852_100817340
300 Ga0068870_10169376
301 Ga0068863_100796610
302 Ga0068860_100000365
303 Ga0068862_101501623
304 Ga0075365_10028031
305 Ga0075365_10028411
306 Ga0075365_10060582
307 Ga0075365_10083986
308 Ga0075365_10092301
309 Ga0075365_10115280
310 Ga0075365_10126912
311 Ga0075365_10150430
312 Ga0075365_10183489
313 Ga0075365_10191599
314 Ga0075365_10209286
315 Ga0075365_10217154
316 Ga0075365_10267452
317 Ga0075365_10273495
318 Ga0075365_10520181
319 Ga0075365_10543049
320 Ga0075368_10002319
321 Ga0075368_10042050
322 Ga0075364_10170697
323 Ga0075364_10479176
324 Ga0075364_10823116
325 Ga0075367_10025829
326 Ga0075367_10123659
327 Ga0075367_10157995
328 Ga0097621_100601494
329 Ga0075370_10161800
330 Ga0075370_10164526
331 Ga0068865_100763034
332 Ga0105245_10232075
333 Ga0105243_10073744
334 Ga0105243_10634403
335 Ga0105238_11273550
336 Ga0105246_10136085
337 Ga0163162_11007748
338 Ga0157372_10128203
339 Ga0157372_10857956
340 Ga0157375_10156471
341 Ga0157375_10227469
342 Ga0157380_10036686
343 Ga0157377_10201592
344 Ga0157376_10669060
345 Ga0163161_10084042
346 Ga0197907_11241296
347 Ga0206354_11163214
348 Ga0207643_10183609
349 Ga0207660_10307871
350 Ga0207662_10103938
351 Ga0207650_10093900
352 Ga0207650_10766718
353 Ga0207687_10388865
354 Ga0207709_10196507
355 Ga0207709_10654812
356 Ga0207669_10292635
357 Ga0207704_10282646
358 Ga0207691_10098799
359 Ga0207661_10111380
360 Ga0207712_10149774
361 Ga0207658_11143522
362 Ga0207678_10560327
363 Ga0207708_10004849
364 Ga0207648_10090629
365 Ga0207675_100029849
366 Ga0207675_100368994
367 Ga0207683_10045648
368 Ga0207683_10549620
369 Ga0268265_11055716
370 Ga0268265_11252361
371 Ga0268264_10000249
372 Ga0268264_10408313
373 Ga0307408_100670551
374 Ga0307405_10080895
375 Ga0307405_10111533
376 Ga0307405_10192555
377 Ga0307413_10564418
378 Ga0307410_10051642
379 Ga0307410_10113484
380 Ga0307410_10956284
381 Ga0307406_10028045
382 Ga0307406_10106308
383 Ga0307407_10008927
384 Ga0307412_11073146
385 Ga0307409_100007990
386 Ga0307409_100028778
387 Ga0307409_100255995
388 Ga0307409_101289258
389 Ga0307409_101390701
390 Ga0307416_100064935
391 Ga0307416_100151372
392 Ga0307416_100499821
393 Ga0307414_10038907
394 Ga0307411_10135629
395 Ga0307411_10143048
396 Ga0307411_10245274
397 Ga0307415_100008246
398 Ga0307415_100122172
399 Ga0307415_100135756
400 Ga0395899_0022737
401 Ga0451793_1377064
402 Ga0451804_0058499
403 Ga0451837_1527663
404 Ga0451839_1330970
405 Ga0439449_0366450
406 Ga0466969_0021919
407 Ga0466965_0162864
408 Ga0466966_0003051
409 Ga0466966_0016012
410 Ga0466961_0144690
411 Ga0466961_0146996
412 Ga0466963_0001511
413 Ga0466963_0074199
414 Ga0466963_0109871
415 Ga0466971_0045928
416 Ga0466970_0045916
417 Ga0466957_0041466
418 Ga0466960_0002792
419 Ga0466960_0008294
420 Ga0466960_0008868
421 Ga0466960_0040395
422 Ga0466960_0249491
423 Ga0466959_0333064
424 Ga0466959_0448719
425 Ga0466959_0643891
426 Ga0466958_0444592
427 Ga0466967_0041875
428 Ga0466967_0303656
429 Ga0466967_0488281
430 Ga0466967_0572152
431 Ga0466967_0590536
432 Ga0466967_1818507
433 Ga0495664_0459424
434 Ga0495634_0231416
435 Ga0495647_0369813
436 Ga0496101_0056423
437 Ga0496101_1189192
438 Ga0496108_0731876
439 Ga0496109_0154276
440 Ga0496109_0590713
441 Ga0496111_0706302
442 Ga0496114_0105683
443 Ga0496114_0686109
444 Ga0496114_1093527
445 Ga0496124_0271137
446 Ga0501031_0222570
447 Ga0501031_0226567
448 Ga0501031_0696498
449 Ga0501031_0700316
450 Ga0501032_0023409
451 Ga0501033_0049910
452 Ga0501033_0236241
453 Ga0501034_0413713
454 Ga0501036_0001438
455 Ga0501037_0005184
456 Ga0501038_0003565
457 Ga0501038_0361371
458 Ga0501038_1016116
459 Ga0501039_0006069
460 Ga0501039_0029625
461 Ga0501039_0327859
462 Ga0501039_0931251
463 Ga0501040_0097566
464 Ga0501040_0135643
465 Ga0501040_0481343
466 Ga0501042_0007823
467 Ga0501042_0317274
468 Ga0501042_1139962
469 Ga0501043_0005018
470 Ga0501043_0627296
471 Ga0501046_0000399
472 Ga0501046_0001508
473 Ga0501046_0460366
474 Ga0501047_0004295
475 Ga0501047_0995929
476 Ga0501048_0008479
477 Ga0501048_0785958
478 Ga0501067_0120623
479 Ga0501067_0495572
480 Ga0501069_0400222
481 Ga0501070_0122156
482 Ga0501070_0443888
483 Ga0501071_0469837
484 Ga0501071_0502188
485 Ga0501072_0344760
486 Ga0501072_0363144
487 Ga0501072_0422343
488 Ga0501072_0442307
489 Ga0501073_0395143
490 Ga0501074_0434946
491 Ga0501074_0552788
492 Ga0501074_0569037
493 Ga0501075_0460414
494 Ga0501075_0493024
495 Ga0501075_0503517
496 Ga0501075_0675373
497 Ga0501075_1445201
498 Ga0501076_1603976
499 Ga0501079_0273405
500 Ga0501079_0750179
501 Ga0501080_1749856
502 Ga0501081_0800969
503 Ga0501083_0329410
504 Ga0501035_0002293
505 Ga0501035_1062348
506 Ga0501044_0004136
507 Ga0501045_0047485
508 Ga0501045_0235740
509 Ga0501045_0309934
510 Ga0501045_0381074
511 Ga0501045_0397358
512 Ga0501212_057115
513 nmdc:mga03n38_104349_c1
514 nmdc:mga03n38_43694_c1
515 nmdc:mga00v17_358156_c1
516 nmdc:mga00v17_36667_c1
517 nmdc:mga00v17_411781_c1
518 nmdc:mga0yw44_112376_c1
519 nmdc:mga0yw44_148706_c1
520 nmdc:mga0yw44_18958_c1
521 nmdc:mga0yw44_20757_c1
522 nmdc:mga0yw44_207658_c1
523 nmdc:mga0yw44_37800_c1
524 nmdc:mga0yw44_60845_c1
525 nmdc:mga0yw44_623197_c1
526 nmdc:mga0yw44_63782_c1
527 nmdc:mga0yw44_87258_c1
528 nmdc:mga0yw44_91317_c1
529 nmdc:mga06z11_1009440_c1
530 nmdc:mga06z11_48453_c1
531 nmdc:mga06z11_70077_c1
532 nmdc:mga04h51_16629_c1
533 nmdc:mga07m45_260100_c1
534 nmdc:mga07m45_67285_c1
535 Ga0495601_0019193
536 Ga0500644_0000201
537 Ga0500554_037522
538 Ga0500556_0003070
539 Ga0500573_0041385
540 Ga0501084_0263931
541 Ga0501084_0379271
542 Ga0501084_0644196
543 Ga0590077_050078
544 Ga0501082_0404335
545 Ga0466962_0020522
546 Ga0530510_0147775
547 Ga0530510_0441493
548 2643824770
549 2643892777
550 2643962226
551 2644093190
552 2644100037
553 2644117643
554 2644322801
555 2644536021
556 2738871104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11377

DUF3180

Protein of unknown function (DUF3180)

33

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xwn-assembly1.cif.gz_A complex structure of catalytic domain of clostridium cellulovorans exgs and cellotetraose 0.7854 99 142
2rmk-assembly1.cif.gz_B rac1/prk1 complex 0.7429 86 162
2rmk-assembly1.cif.gz_B rac1/prk1 complex 0.7056 86 162
5tj5-assembly1.cif.gz_B atomic model for the membrane-embedded motor of a eukaryotic v-atpase 0.4834 21 149
2j7a-assembly3.cif.gz_N crystal structure of cytochrome c nitrite reductase nrfha complex from desulfovibrio vulgaris 0.4759 52 151
ID Description Score Start End Superfamily
2rmkB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.7429 86 162 1.10.287.160
2rmkB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.7056 86 162 1.10.287.160
af_Q58415_114_232_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.6759 54 156 1.20.58.220
af_C6TA84_19_133_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6251 53 162 1.20.58.70
af_I1J4T0_20_133_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6235 53 162 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A255GP31-F1-model_v4 DUF3180 domain-containing protein 0.9286 15 162 GO:0016020
AF-A0A853AC88-F1-model_v4 deleted 0.9189 13 161
AF-A0A2T5ZYI6-F1-model_v4 deleted 0.9034 2 162
AF-A0A2T0R5J3-F1-model_v4 Uncharacterized protein DUF3180 0.9021 15 161 GO:0016020
AF-A0A505H462-F1-model_v4 DUF3180 family protein 0.9009 15 153 GO:0016020

Map