F382594

General Info

Members Datasets Scaffolds Average Seq Length
278 147 556 268

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0076416|Ga0495598_0076416_129_1034
Length 301
Sequence MPLPTKTASNPATRRLYSLDMSRRNRCDPLVLLREVEYARPSSVEEAIQLLGAHEGARALAGGQTLVNVMKARAASPDVLVDLNRLEELRAITVSGDTLQLGAMATYTQMMASSEVDVSRPILAEVAAQIADVQVRNRGTIGGNICSNDPTNHLPPLLVAVGASMTIRSEAGERTVPAEEFFLGVYMTVVGEGELLTSVSVPAAANAADGFASVTIGRDGTCIANAAASLAGGSPRIALGCVDAVPVLLTPNGTDEESIRKSVADAALDPPSDVHAPAEYRRHLAETCAVRAVAQAAERGR

Samples

Sample ID Description Type Environment
1 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
87 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
90 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 7.55
Rhizosphere 92.09
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495598_0076416 3300046537 Unclassified 1066
2 JGI25407J50210_10004521 3300003373 Bacteria 3383
3 Ga0070683_100054972 3300005329 Bacteria 3693
4 Ga0070691_10018347 3300005341 Bacteria 3226
5 Ga0070668_100116021 3300005347 Bacteria 2135
6 Ga0070675_100151640 3300005354 Bacteria 1988
7 Ga0070675_100156872 3300005354 Bacteria 1955
8 Ga0070674_100018526 3300005356 Bacteria 4403
9 Ga0070713_100011521 3300005436 Bacteria 6442
10 Ga0070701_10091443 3300005438 Bacteria 1668
11 Ga0070705_100201581 3300005440 Bacteria 1364
12 Ga0070700_100021410 3300005441 Bacteria 3758
13 Ga0070694_100068285 3300005444 Bacteria 2442
14 Ga0070708_100162449 3300005445 Bacteria 2082
15 Ga0070678_100179922 3300005456 Bacteria 1730
16 Ga0070678_100206824 3300005456 Bacteria 1624
17 Ga0070662_100054553 3300005457 Bacteria 2896
18 Ga0068867_100064164 3300005459 Bacteria 2730
19 Ga0070706_100115387 3300005467 Bacteria 2501
20 Ga0070706_100250437 3300005467 Bacteria 1654
21 Ga0070698_100006187 3300005471 Bacteria 13032
22 Ga0070698_100468074 3300005471 Bacteria 1197
23 Ga0070699_100075490 3300005518 Bacteria 2933
24 Ga0070699_100089213 3300005518 Bacteria 2694
25 Ga0070699_100159152 3300005518 Bacteria 1998
26 Ga0070684_100588029 3300005535 Unclassified 1034
27 Ga0070686_100065234 3300005544 Bacteria 2364
28 Ga0070695_100270536 3300005545 Bacteria 1244
29 Ga0070696_100104406 3300005546 Bacteria 2035
30 Ga0070665_100384649 3300005548 Bacteria 1411
31 Ga0068854_100007597 3300005578 Bacteria 6932
32 Ga0068864_100364337 3300005618 Bacteria 1367
33 Ga0068866_10202157 3300005718 Bacteria 1188
34 Ga0068861_100078338 3300005719 Bacteria 2580
35 Ga0068862_100188638 3300005844 Bacteria 1854
36 Ga0081455_10004916 3300005937 Bacteria 14805
37 Ga0081455_10066766 3300005937 Bacteria 3002
38 Ga0081538_10000543 3300005981 Bacteria 41569
39 Ga0081538_10001467 3300005981 Bacteria 24195
40 Ga0081538_10029602 3300005981 Bacteria 3737
41 Ga0075365_10137636 3300006038 Archaea 1693
42 Ga0070712_100158099 3300006175 Bacteria 1748
43 Ga0070712_100181866 3300006175 Bacteria 1639
44 Ga0075428_100085212 3300006844 Bacteria 3446
45 Ga0075433_10138958 3300006852 Bacteria 2159
46 Ga0075433_10165176 3300006852 Bacteria 1970
47 Ga0075434_100071296 3300006871 Bacteria 3466
48 Ga0075429_100009981 3300006880 Bacteria 8229
49 Ga0068865_100084169 3300006881 Bacteria 2291
50 Ga0075436_100187259 3300006914 Bacteria 1464
51 Ga0075435_100003442 3300007076 Bacteria 10737
52 Ga0075435_100047644 3300007076 Bacteria 3441
53 Ga0075435_100079759 3300007076 Bacteria 2687
54 Ga0111539_10467218 3300009094 Bacteria 1469
55 Ga0111539_10627432 3300009094 Bacteria 1252
56 Ga0114129_10015064 3300009147 Bacteria 11007
57 Ga0114129_10021886 3300009147 Bacteria 9074
58 Ga0114129_10024865 3300009147 Bacteria 8492
59 Ga0114129_10061083 3300009147 Bacteria 5267
60 Ga0105243_10706373 3300009148 Bacteria 983
61 Ga0105241_10596228 3300009174 Unclassified 997
62 Ga0105242_10509852 3300009176 Bacteria 1146
63 Ga0105239_10476651 3300010375 Bacteria 1417
64 Ga0105246_10240599 3300011119 Bacteria 1430
65 Ga0157319_1002234 3300012497 Bacteria 1093
66 Ga0157371_10103917 3300013102 Bacteria 2016
67 Ga0157378_10028437 3300013297 Bacteria 4933
68 Ga0163162_10041103 3300013306 Bacteria 4625
69 Ga0163163_10345855 3300014325 Bacteria 1543
70 Ga0157380_10157940 3300014326 Bacteria 1967
71 Ga0157380_10548418 3300014326 Bacteria 1134
72 Ga0207699_10047877 3300025906 Bacteria 2509
73 Ga0207684_10215864 3300025910 Bacteria 1655
74 Ga0207684_10251430 3300025910 Bacteria 1525
75 Ga0207707_10071443 3300025912 Bacteria 3025
76 Ga0207693_10088733 3300025915 Bacteria 2423
77 Ga0207700_10000006 3300025928 Bacteria 348187
78 Ga0207706_10046055 3300025933 Bacteria 3862
79 Ga0207669_10067867 3300025937 Bacteria 2224
80 Ga0207704_10236693 3300025938 Bacteria 1361
81 Ga0207665_10065390 3300025939 Bacteria 2473
82 Ga0207691_10205256 3300025940 Bacteria 1714
83 Ga0207711_10210897 3300025941 Bacteria 1774
84 Ga0207661_10064617 3300025944 Bacteria 2967
85 Ga0207712_10081778 3300025961 Bacteria 2353
86 Ga0207640_10305428 3300025981 Bacteria 1260
87 Ga0207677_10510505 3300026023 Bacteria 1041
88 Ga0207708_10038691 3300026075 Bacteria 3633
89 Ga0207708_10077981 3300026075 Bacteria 2543
90 Ga0207676_10331345 3300026095 Bacteria 1401
91 Ga0207675_100056619 3300026118 Bacteria 3657
92 Ga0207683_10089186 3300026121 Bacteria 2744
93 Ga0268266_10610808 3300028379 Unclassified 1048
94 Ga0268265_10148517 3300028380 Bacteria 1974
95 Ga0307408_100233539 3300031548 Bacteria 1508
96 Ga0307407_10023503 3300031903 Bacteria 3217
97 Ga0307409_100114701 3300031995 Bacteria 2267
98 Ga0307409_100242110 3300031995 Bacteria 1643
99 Ga0307409_100265255 3300031995 Bacteria 1578
100 Ga0307416_100043869 3300032002 Bacteria 3506
101 Ga0307416_100064835 3300032002 Bacteria 2999
102 Ga0307411_10268056 3300032005 Bacteria 1352
103 Ga0307415_100017048 3300032126 Bacteria 4347
104 Ga0395899_0011566 3300037312 Bacteria 6757
105 Ga0395899_0021394 3300037312 Unclassified 4906
106 Ga0395900_0001842 3300037418 Bacteria 24164
107 Ga0395900_0001894 3300037418 Bacteria 23794
108 Ga0395900_0006127 3300037418 Bacteria 12546
109 Ga0395900_0010278 3300037418 Bacteria 9573
110 Ga0395900_0058983 3300037418 Bacteria 3951
111 Ga0395900_0243090 3300037418 Bacteria 1805
112 Ga0395900_0292013 3300037418 Bacteria 1619
113 Ga0395900_1126508 3300037418 Unclassified 701
114 Ga0395898_0002125 3300037466 Bacteria 24469
115 Ga0395898_0003441 3300037466 Bacteria 17697
116 Ga0395898_0009238 3300037466 Bacteria 10370
117 Ga0395898_0017650 3300037466 Bacteria 7285
118 Ga0395898_0029919 3300037466 Bacteria 5451
119 Ga0395898_0273056 3300037466 Bacteria 1612
120 Ga0395898_0488751 3300037466 Bacteria 1171
121 Ga0395905_0000656 3300037471 Bacteria 46034
122 Ga0395905_0012357 3300037471 Bacteria 8220
123 Ga0395905_0118526 3300037471 Bacteria 2488
124 Ga0395905_0236046 3300037471 Bacteria 1709
125 Ga0395901_0002743 3300038443 Bacteria 17767
126 Ga0395901_0007145 3300038443 Bacteria 11271
127 Ga0395901_0009904 3300038443 Bacteria 9661
128 Ga0395901_0023183 3300038443 Bacteria 6363
129 Ga0395901_0033028 3300038443 Bacteria 5340
130 Ga0395901_0216573 3300038443 Unclassified 2003
131 Ga0395901_0228625 3300038443 Bacteria 1943
132 Ga0439464_0066926 3300042439 Bacteria 1058
133 Ga0439460_0025536 3300042461 Bacteria 1646
134 Ga0466964_0006977 3300044706 Bacteria 4221
135 Ga0495656_0012823 3300046615 Bacteria 3104
136 Ga0495659_0116219 3300046664 Bacteria 1049
137 Ga0496101_0017249 3300048904 Bacteria 4895
138 Ga0496102_0008668 3300048905 Bacteria 8730
139 Ga0496102_0527271 3300048905 Bacteria 1104
140 Ga0496103_0007663 3300048906 Bacteria 6423
141 Ga0496104_0003851 3300048907 Bacteria 12984
142 Ga0496105_0000448 3300048908 Bacteria 27186
143 Ga0496108_0015852 3300048911 Bacteria 6144
144 Ga0496108_0063398 3300048911 Bacteria 3112
145 Ga0496109_0009639 3300048912 Bacteria 8238
146 Ga0496109_0068094 3300048912 Bacteria 3262
147 Ga0496110_0000810 3300048913 Bacteria 21899
148 Ga0496110_0015042 3300048913 Bacteria 6434
149 Ga0496111_0000260 3300048914 Bacteria 25737
150 Ga0496111_0165351 3300048914 Bacteria 1643
151 Ga0496112_0000204 3300048915 Bacteria 38947
152 Ga0496112_0018225 3300048915 Bacteria 6609
153 Ga0496112_0044723 3300048915 Bacteria 4339
154 Ga0496112_0449121 3300048915 Bacteria 1227
155 Ga0496113_0006384 3300048916 Bacteria 7465
156 Ga0496113_0011472 3300048916 Bacteria 5914
157 Ga0496115_0057513 3300048918 Bacteria 3128
158 Ga0501031_0004353 3300049568 Bacteria 9161
159 Ga0501031_0015583 3300049568 Bacteria 4935
160 Ga0501031_0019264 3300049568 Bacteria 4443
161 Ga0501032_0068347 3300049569 Bacteria 2372
162 Ga0501032_0102969 3300049569 Bacteria 1892
163 Ga0501032_0224094 3300049569 Bacteria 1223
164 Ga0501033_0063187 3300049570 Bacteria 2725
165 Ga0501033_0158764 3300049570 Bacteria 1628
166 Ga0501033_0299804 3300049570 Archaea 1132
167 Ga0501034_0607234 3300049571 Unclassified 999
168 Ga0501036_0005334 3300049572 Bacteria 10403
169 Ga0501036_0077071 3300049572 Bacteria 2820
170 Ga0501037_0049562 3300049573 Bacteria 3075
171 Ga0501037_0074837 3300049573 Bacteria 2460
172 Ga0501038_0017002 3300049574 Bacteria 6582
173 Ga0501038_0032394 3300049574 Bacteria 4612
174 Ga0501038_0048243 3300049574 Bacteria 3686
175 Ga0501039_0004379 3300049575 Bacteria 10646
176 Ga0501039_0138495 3300049575 Bacteria 1911
177 Ga0501040_0015873 3300049576 Bacteria 4978
178 Ga0501040_0026804 3300049576 Bacteria 3876
179 Ga0501040_0040891 3300049576 Bacteria 3156
180 Ga0501040_0137745 3300049576 Bacteria 1718
181 Ga0501041_0006983 3300049577 Bacteria 6624
182 Ga0501041_0011825 3300049577 Bacteria 5165
183 Ga0501041_0041327 3300049577 Bacteria 2800
184 Ga0501041_0276141 3300049577 Bacteria 1057
185 Ga0501042_0005297 3300049578 Bacteria 8293
186 Ga0501042_0006113 3300049578 Bacteria 7801
187 Ga0501042_0010108 3300049578 Bacteria 6311
188 Ga0501042_0084117 3300049578 Bacteria 2281
189 Ga0501042_0093927 3300049578 Bacteria 2154
190 Ga0501042_0114693 3300049578 Bacteria 1940
191 Ga0501043_0028936 3300049579 Bacteria 4349
192 Ga0501046_0004344 3300049580 Bacteria 12906
193 Ga0501046_0024438 3300049580 Bacteria 4957
194 Ga0501046_0025178 3300049580 Bacteria 4873
195 Ga0501048_0005087 3300049582 Bacteria 10015
196 Ga0501048_0013887 3300049582 Bacteria 5972
197 Ga0501048_0043449 3300049582 Bacteria 3216
198 Ga0501048_0055576 3300049582 Bacteria 2809
199 Ga0501068_0020989 3300049584 Bacteria 3811
200 Ga0501068_0091059 3300049584 Bacteria 1882
201 Ga0501068_0151144 3300049584 Bacteria 1459
202 Ga0501069_0012048 3300049585 Bacteria 4591
203 Ga0501070_0294660 3300049586 Bacteria 1322
204 Ga0501071_0004188 3300049587 Bacteria 9128
205 Ga0501071_0005348 3300049587 Bacteria 8246
206 Ga0501071_0024232 3300049587 Bacteria 4242
207 Ga0501071_0033896 3300049587 Bacteria 3630
208 Ga0501071_0259746 3300049587 Bacteria 1312
209 Ga0501072_0001600 3300049588 Bacteria 16921
210 Ga0501072_0061415 3300049588 Bacteria 2964
211 Ga0501072_0125921 3300049588 Bacteria 2041
212 Ga0501072_0149569 3300049588 Bacteria 1862
213 Ga0501073_0006291 3300049589 Bacteria 8847
214 Ga0501074_0010984 3300049590 Bacteria 6575
215 Ga0501074_0029758 3300049590 Bacteria 3956
216 Ga0501074_0055133 3300049590 Bacteria 2865
217 Ga0501074_0241151 3300049590 Bacteria 1286
218 Ga0501075_0016558 3300049591 Bacteria 5313
219 Ga0501075_0038806 3300049591 Bacteria 3561
220 Ga0501075_0041368 3300049591 Bacteria 3453
221 Ga0501075_0178060 3300049591 Bacteria 1622
222 Ga0501075_0276176 3300049591 Bacteria 1280
223 Ga0501076_0008385 3300049592 Bacteria 7574
224 Ga0501076_0008690 3300049592 Bacteria 7459
225 Ga0501076_0028060 3300049592 Bacteria 4367
226 Ga0501077_0022167 3300049593 Bacteria 4022
227 Ga0501077_0042013 3300049593 Bacteria 2909
228 Ga0501079_0012955 3300049741 Bacteria 6360
229 Ga0501079_0018691 3300049741 Bacteria 5295
230 Ga0501079_0155502 3300049741 Bacteria 1782
231 Ga0501079_0394042 3300049741 Bacteria 1086
232 Ga0501080_0016631 3300049742 Bacteria 6795
233 Ga0501080_0019880 3300049742 Bacteria 6219
234 Ga0501080_0250668 3300049742 Bacteria 1614
235 Ga0501080_0412688 3300049742 Bacteria 1214
236 Ga0501081_0015646 3300049743 Bacteria 5006
237 Ga0501081_0037906 3300049743 Bacteria 3290
238 Ga0501081_0047279 3300049743 Bacteria 2961
239 Ga0501081_0233787 3300049743 Bacteria 1339
240 Ga0501083_0037588 3300049744 Bacteria 3296
241 Ga0501083_0085929 3300049744 Bacteria 2081
242 Ga0501035_0036430 3300049822 Bacteria 4458
243 Ga0501035_0184662 3300049822 Bacteria 1795
244 Ga0501044_0063139 3300049823 Bacteria 3785
245 Ga0501045_0005589 3300049824 Bacteria 8701
246 Ga0501045_0005767 3300049824 Bacteria 8567
247 Ga0501045_0021755 3300049824 Bacteria 4590
248 Ga0501045_0080350 3300049824 Bacteria 2404
249 nmdc:mga05p37_245708_c1 3300050507 Bacteria 2149
250 nmdc:mga05p37_254731_c1 3300050507 Bacteria 2104
251 nmdc:mga05p37_396063_c1 3300050507 Bacteria 1613
252 nmdc:mga05p37_52864_c1 3300050507 Bacteria 4995
253 nmdc:mga05p37_58557_c1 3300050507 Bacteria 4745
254 nmdc:mga09592_93404_c1 3300050508 Bacteria 2573
255 nmdc:mga0qj67_167198_c1 3300050509 Bacteria 1786
256 nmdc:mga06r32_57914_c1 3300050510 Bacteria 3723
257 nmdc:mga08y16_119856_c1 3300050511 Bacteria 2738
258 nmdc:mga0n895_13340_c1 3300050512 Bacteria 7410
259 nmdc:mga0rr50_152467_c1 3300050513 Bacteria 1869
260 nmdc:mga0rr50_5691_c1 3300050513 Bacteria 7466
261 nmdc:mga08x19_92701_c1 3300050514 Bacteria 1996
262 nmdc:mga0a205_49149_c1 3300050515 Bacteria 4071
263 Ga0501084_0007970 3300054114 Bacteria 8720
264 Ga0501084_0048274 3300054114 Bacteria 3563
265 Ga0501084_0071331 3300054114 Bacteria 2908
266 Ga0501084_0168070 3300054114 Bacteria 1851
267 Ga0501084_0230950 3300054114 Bacteria 1562
268 Ga0590071_010127 3300059421 Bacteria 2208
269 Ga0590075_009360 3300059424 Bacteria 2347
270 Ga0501082_0023140 3300060353 Bacteria 5358
271 Ga0501082_0038264 3300060353 Bacteria 4138
272 Ga0501082_0058643 3300060353 Bacteria 3317
273 Ga0501082_0074964 3300060353 Bacteria 2914
274 Ga0530510_0007839 3300061734 Bacteria 7447
275 Ga0530510_0019835 3300061734 Bacteria 4778
276 Ga0530510_0065768 3300061734 Bacteria 2627
277 Ga0530510_0085758 3300061734 Bacteria 2294
278 Ga0530510_0208840 3300061734 Bacteria 1451
279 Ga0495598_0076416
280 JGI25407J50210_10004521
281 Ga0070683_100054972
282 Ga0070691_10018347
283 Ga0070668_100116021
284 Ga0070675_100151640
285 Ga0070675_100156872
286 Ga0070674_100018526
287 Ga0070713_100011521
288 Ga0070701_10091443
289 Ga0070705_100201581
290 Ga0070700_100021410
291 Ga0070694_100068285
292 Ga0070708_100162449
293 Ga0070678_100179922
294 Ga0070678_100206824
295 Ga0070662_100054553
296 Ga0068867_100064164
297 Ga0070706_100115387
298 Ga0070706_100250437
299 Ga0070698_100006187
300 Ga0070698_100468074
301 Ga0070699_100075490
302 Ga0070699_100089213
303 Ga0070699_100159152
304 Ga0070684_100588029
305 Ga0070686_100065234
306 Ga0070695_100270536
307 Ga0070696_100104406
308 Ga0070665_100384649
309 Ga0068854_100007597
310 Ga0068864_100364337
311 Ga0068866_10202157
312 Ga0068861_100078338
313 Ga0068862_100188638
314 Ga0081455_10004916
315 Ga0081455_10066766
316 Ga0081538_10000543
317 Ga0081538_10001467
318 Ga0081538_10029602
319 Ga0075365_10137636
320 Ga0070712_100158099
321 Ga0070712_100181866
322 Ga0075428_100085212
323 Ga0075433_10138958
324 Ga0075433_10165176
325 Ga0075434_100071296
326 Ga0075429_100009981
327 Ga0068865_100084169
328 Ga0075436_100187259
329 Ga0075435_100003442
330 Ga0075435_100047644
331 Ga0075435_100079759
332 Ga0111539_10467218
333 Ga0111539_10627432
334 Ga0114129_10015064
335 Ga0114129_10021886
336 Ga0114129_10024865
337 Ga0114129_10061083
338 Ga0105243_10706373
339 Ga0105241_10596228
340 Ga0105242_10509852
341 Ga0105239_10476651
342 Ga0105246_10240599
343 Ga0157319_1002234
344 Ga0157371_10103917
345 Ga0157378_10028437
346 Ga0163162_10041103
347 Ga0163163_10345855
348 Ga0157380_10157940
349 Ga0157380_10548418
350 Ga0207699_10047877
351 Ga0207684_10215864
352 Ga0207684_10251430
353 Ga0207707_10071443
354 Ga0207693_10088733
355 Ga0207700_10000006
356 Ga0207706_10046055
357 Ga0207669_10067867
358 Ga0207704_10236693
359 Ga0207665_10065390
360 Ga0207691_10205256
361 Ga0207711_10210897
362 Ga0207661_10064617
363 Ga0207712_10081778
364 Ga0207640_10305428
365 Ga0207677_10510505
366 Ga0207708_10038691
367 Ga0207708_10077981
368 Ga0207676_10331345
369 Ga0207675_100056619
370 Ga0207683_10089186
371 Ga0268266_10610808
372 Ga0268265_10148517
373 Ga0307408_100233539
374 Ga0307407_10023503
375 Ga0307409_100114701
376 Ga0307409_100242110
377 Ga0307409_100265255
378 Ga0307416_100043869
379 Ga0307416_100064835
380 Ga0307411_10268056
381 Ga0307415_100017048
382 Ga0395899_0011566
383 Ga0395899_0021394
384 Ga0395900_0001842
385 Ga0395900_0001894
386 Ga0395900_0006127
387 Ga0395900_0010278
388 Ga0395900_0058983
389 Ga0395900_0243090
390 Ga0395900_0292013
391 Ga0395900_1126508
392 Ga0395898_0002125
393 Ga0395898_0003441
394 Ga0395898_0009238
395 Ga0395898_0017650
396 Ga0395898_0029919
397 Ga0395898_0273056
398 Ga0395898_0488751
399 Ga0395905_0000656
400 Ga0395905_0012357
401 Ga0395905_0118526
402 Ga0395905_0236046
403 Ga0395901_0002743
404 Ga0395901_0007145
405 Ga0395901_0009904
406 Ga0395901_0023183
407 Ga0395901_0033028
408 Ga0395901_0216573
409 Ga0395901_0228625
410 Ga0439464_0066926
411 Ga0439460_0025536
412 Ga0466964_0006977
413 Ga0495656_0012823
414 Ga0495659_0116219
415 Ga0496101_0017249
416 Ga0496102_0008668
417 Ga0496102_0527271
418 Ga0496103_0007663
419 Ga0496104_0003851
420 Ga0496105_0000448
421 Ga0496108_0015852
422 Ga0496108_0063398
423 Ga0496109_0009639
424 Ga0496109_0068094
425 Ga0496110_0000810
426 Ga0496110_0015042
427 Ga0496111_0000260
428 Ga0496111_0165351
429 Ga0496112_0000204
430 Ga0496112_0018225
431 Ga0496112_0044723
432 Ga0496112_0449121
433 Ga0496113_0006384
434 Ga0496113_0011472
435 Ga0496115_0057513
436 Ga0501031_0004353
437 Ga0501031_0015583
438 Ga0501031_0019264
439 Ga0501032_0068347
440 Ga0501032_0102969
441 Ga0501032_0224094
442 Ga0501033_0063187
443 Ga0501033_0158764
444 Ga0501033_0299804
445 Ga0501034_0607234
446 Ga0501036_0005334
447 Ga0501036_0077071
448 Ga0501037_0049562
449 Ga0501037_0074837
450 Ga0501038_0017002
451 Ga0501038_0032394
452 Ga0501038_0048243
453 Ga0501039_0004379
454 Ga0501039_0138495
455 Ga0501040_0015873
456 Ga0501040_0026804
457 Ga0501040_0040891
458 Ga0501040_0137745
459 Ga0501041_0006983
460 Ga0501041_0011825
461 Ga0501041_0041327
462 Ga0501041_0276141
463 Ga0501042_0005297
464 Ga0501042_0006113
465 Ga0501042_0010108
466 Ga0501042_0084117
467 Ga0501042_0093927
468 Ga0501042_0114693
469 Ga0501043_0028936
470 Ga0501046_0004344
471 Ga0501046_0024438
472 Ga0501046_0025178
473 Ga0501048_0005087
474 Ga0501048_0013887
475 Ga0501048_0043449
476 Ga0501048_0055576
477 Ga0501068_0020989
478 Ga0501068_0091059
479 Ga0501068_0151144
480 Ga0501069_0012048
481 Ga0501070_0294660
482 Ga0501071_0004188
483 Ga0501071_0005348
484 Ga0501071_0024232
485 Ga0501071_0033896
486 Ga0501071_0259746
487 Ga0501072_0001600
488 Ga0501072_0061415
489 Ga0501072_0125921
490 Ga0501072_0149569
491 Ga0501073_0006291
492 Ga0501074_0010984
493 Ga0501074_0029758
494 Ga0501074_0055133
495 Ga0501074_0241151
496 Ga0501075_0016558
497 Ga0501075_0038806
498 Ga0501075_0041368
499 Ga0501075_0178060
500 Ga0501075_0276176
501 Ga0501076_0008385
502 Ga0501076_0008690
503 Ga0501076_0028060
504 Ga0501077_0022167
505 Ga0501077_0042013
506 Ga0501079_0012955
507 Ga0501079_0018691
508 Ga0501079_0155502
509 Ga0501079_0394042
510 Ga0501080_0016631
511 Ga0501080_0019880
512 Ga0501080_0250668
513 Ga0501080_0412688
514 Ga0501081_0015646
515 Ga0501081_0037906
516 Ga0501081_0047279
517 Ga0501081_0233787
518 Ga0501083_0037588
519 Ga0501083_0085929
520 Ga0501035_0036430
521 Ga0501035_0184662
522 Ga0501044_0063139
523 Ga0501045_0005589
524 Ga0501045_0005767
525 Ga0501045_0021755
526 Ga0501045_0080350
527 nmdc:mga05p37_245708_c1
528 nmdc:mga05p37_254731_c1
529 nmdc:mga05p37_396063_c1
530 nmdc:mga05p37_52864_c1
531 nmdc:mga05p37_58557_c1
532 nmdc:mga09592_93404_c1
533 nmdc:mga0qj67_167198_c1
534 nmdc:mga06r32_57914_c1
535 nmdc:mga08y16_119856_c1
536 nmdc:mga0n895_13340_c1
537 nmdc:mga0rr50_152467_c1
538 nmdc:mga0rr50_5691_c1
539 nmdc:mga08x19_92701_c1
540 nmdc:mga0a205_49149_c1
541 Ga0501084_0007970
542 Ga0501084_0048274
543 Ga0501084_0071331
544 Ga0501084_0168070
545 Ga0501084_0230950
546 Ga0590071_010127
547 Ga0590075_009360
548 Ga0501082_0023140
549 Ga0501082_0038264
550 Ga0501082_0058643
551 Ga0501082_0074964
552 Ga0530510_0007839
553 Ga0530510_0019835
554 Ga0530510_0065768
555 Ga0530510_0085758
556 Ga0530510_0208840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

34

204

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9029 1 265
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8967 1 265
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.8933 1 265
7dqx-assembly1.cif.gz_E crystal structure of xanthine dehydrogenase family protein 0.8917 1 265
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.8901 1 266
ID Description Score Start End Superfamily
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.945 71 172 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9438 58 173 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9438 59 172 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9376 59 172 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9356 59 172 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A7V8XMH3-F1-model_v4 FAD binding domain-containing protein 0.9323 1 217 GO:0016491
GO:0071949
AF-A0A534V807-F1-model_v4 4-hydroxybenzoyl-CoA reductase 0.9313 6 173 GO:0016491
GO:0071949
AF-A0A535V6W6-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.931 71 213 GO:0016491
GO:0071949
AF-A0A7W7VCQ0-F1-model_v4 CO/xanthine dehydrogenase FAD-binding subunit 0.9308 6 266 GO:0016491
GO:0071949
AF-T0YYT9-F1-model_v4 Molybdopterin dehydrogenase FAD-binding protein 0.9284 80 265 GO:0016491
GO:0071949

Map