F382519

General Info

Members Datasets Scaffolds Average Seq Length
278 111 556 134

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0977188|Ga0436364_0977188_1115_1579
Length 154
Sequence MRVLALDYGRARCGCAVSDPTGVLASPIEPVRAPTTRRGLARLRTLVRELDVQRVVVGLPLSLSGRDSAQTAETRAFAARLEQELPVPVELYDERFTTRMAERMGGAADEDSRAAAHMLEGWLASQPGADGEGAPVADGPVAGGSGADEGARGA

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
16 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
19 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
29 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
30 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
31 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
32 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
33 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
34 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
35 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
36 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
37 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
38 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
39 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
42 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
43 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
44 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
45 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
46 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
47 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
65 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
66 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
107 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.4
Rhizosphere 74.1
Stem 0
Stem Tuber 0
Unclassified 14.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0977188 3300037853 Bacteria 1633
2 Ga0070709_10165838 3300005434 Bacteria 1539
3 Ga0070709_10652415 3300005434 Bacteria 815
4 Ga0070714_100019628 3300005435 Bacteria 5511
5 Ga0070714_100307123 3300005435 Unclassified 1480
6 Ga0070714_100373642 3300005435 Bacteria 1343
7 Ga0070714_100424175 3300005435 Bacteria 1260
8 Ga0070714_100577015 3300005435 Bacteria 1078
9 Ga0070714_100655465 3300005435 Bacteria 1011
10 Ga0070714_100706680 3300005435 Bacteria 973
11 Ga0070714_100948604 3300005435 Unclassified 836
12 Ga0070714_101562028 3300005435 Bacteria 645
13 Ga0070713_100024191 3300005436 Bacteria 4728
14 Ga0070713_100036077 3300005436 Bacteria 3987
15 Ga0070713_100147394 3300005436 Bacteria 2090
16 Ga0070713_100646792 3300005436 Bacteria 1007
17 Ga0070713_101025627 3300005436 Bacteria 796
18 Ga0070710_10118263 3300005437 Bacteria 1601
19 Ga0070710_10125748 3300005437 Bacteria 1557
20 Ga0070710_10132688 3300005437 Bacteria 1520
21 Ga0070711_100024715 3300005439 Bacteria 3924
22 Ga0070711_100067039 3300005439 Bacteria 2517
23 Ga0070711_100136990 3300005439 Unclassified 1831
24 Ga0070711_100251939 3300005439 Bacteria 1385
25 Ga0070711_100618139 3300005439 Bacteria 905
26 Ga0070662_100682452 3300005457 Bacteria 868
27 Ga0070697_101192420 3300005536 Bacteria 678
28 Ga0068856_100014721 3300005614 Bacteria 7550
29 Ga0068856_100090255 3300005614 Bacteria 3048
30 Ga0068856_100527516 3300005614 Bacteria 1202
31 Ga0070717_10005220 3300006028 Bacteria 9462
32 Ga0070717_10027212 3300006028 Bacteria 4569
33 Ga0070717_10033158 3300006028 Bacteria 4165
34 Ga0070717_10070544 3300006028 Bacteria 2912
35 Ga0070717_10126603 3300006028 Bacteria 2193
36 Ga0070715_10145680 3300006163 Bacteria 1155
37 Ga0070715_10182135 3300006163 Bacteria 1054
38 Ga0070716_100161912 3300006173 Bacteria 1451
39 Ga0070716_100196239 3300006173 Unclassified 1338
40 Ga0070716_100716275 3300006173 Unclassified 766
41 Ga0070716_101010732 3300006173 Bacteria 658
42 Ga0070712_100046494 3300006175 Bacteria 3001
43 Ga0070712_100061477 3300006175 Bacteria 2653
44 Ga0070712_100129430 3300006175 Unclassified 1911
45 Ga0070712_100157879 3300006175 Bacteria 1749
46 Ga0070712_100445024 3300006175 Bacteria 1078
47 Ga0070712_100574306 3300006175 Unclassified 952
48 Ga0070712_100663514 3300006175 Unclassified 887
49 Ga0105245_10014257 3300009098 Bacteria 6925
50 Ga0213873_10041132 3300021358 Bacteria 1191
51 Ga0213874_10005504 3300021377 Bacteria 2954
52 Ga0213874_10061239 3300021377 Bacteria 1179
53 Ga0213874_10082183 3300021377 Bacteria 1045
54 Ga0213874_10084518 3300021377 Bacteria 1033
55 Ga0213876_10024636 3300021384 Bacteria 3177
56 Ga0213876_10041602 3300021384 Bacteria 2428
57 Ga0213876_10050501 3300021384 Bacteria 2197
58 Ga0213876_10054870 3300021384 Bacteria 2103
59 Ga0213876_10091502 3300021384 Unclassified 1611
60 Ga0213876_10125355 3300021384 Bacteria 1364
61 Ga0213876_10320828 3300021384 Bacteria 824
62 Ga0213875_10005171 3300021388 Bacteria 7056
63 Ga0213875_10123526 3300021388 Bacteria 1210
64 Ga0213875_10288509 3300021388 Unclassified 775
65 Ga0213875_10291050 3300021388 Bacteria 772
66 Ga0207692_10041597 3300025898 Bacteria 2276
67 Ga0207692_10208580 3300025898 Unclassified 1152
68 Ga0207692_10347822 3300025898 Bacteria 913
69 Ga0207685_10219626 3300025905 Bacteria 903
70 Ga0207699_10046765 3300025906 Bacteria 2533
71 Ga0207693_10014421 3300025915 Bacteria 6355
72 Ga0207693_10020028 3300025915 Bacteria 5322
73 Ga0207693_10027645 3300025915 Bacteria 4484
74 Ga0207693_10328786 3300025915 Unclassified 1197
75 Ga0207693_10618685 3300025915 Unclassified 842
76 Ga0207663_10021473 3300025916 Bacteria 3676
77 Ga0207663_10094107 3300025916 Bacteria 1996
78 Ga0207663_10594029 3300025916 Bacteria 869
79 Ga0207663_10710485 3300025916 Bacteria 796
80 Ga0207663_11434770 3300025916 Bacteria 556
81 Ga0207700_10030443 3300025928 Bacteria 3823
82 Ga0207700_10197055 3300025928 Bacteria 1695
83 Ga0207664_10107530 3300025929 Bacteria 2314
84 Ga0207664_10115507 3300025929 Bacteria 2238
85 Ga0207664_10268942 3300025929 Bacteria 1493
86 Ga0207664_11118626 3300025929 Bacteria 704
87 Ga0207665_10057554 3300025939 Bacteria 2626
88 Ga0207665_10065086 3300025939 Bacteria 2478
89 Ga0207665_10232294 3300025939 Bacteria 1356
90 Ga0207702_10006872 3300026078 Bacteria 9754
91 Ga0207702_10105375 3300026078 Bacteria 2497
92 Ga0307416_101887029 3300032002 Bacteria 701
93 Ga0373945_0389995 3300035116 Bacteria 609
94 Ga0373953_0020097 3300035117 Bacteria 2493
95 Ga0373943_0429706 3300035170 Bacteria 765
96 Ga0373955_0132710 3300035172 Bacteria 1455
97 Ga0373924_0022926 3300035410 Bacteria 2444
98 Ga0373935_0744258 3300035692 Bacteria 722
99 Ga0373927_0327789 3300035695 Bacteria 1009
100 Ga0373947_0082102 3300035725 Bacteria 1997
101 Ga0373937_0016888 3300036401 Bacteria 6489
102 Ga0373925_0189430 3300037068 Bacteria 1631
103 Ga0373925_1090753 3300037068 Bacteria 657
104 Ga0395900_0005335 3300037418 Bacteria 13469
105 Ga0395898_0009272 3300037466 Bacteria 10350
106 Ga0436364_0268086 3300037853 Bacteria 914
107 Ga0436364_0461116 3300037853 Bacteria 28046
108 Ga0436364_0496169 3300037853 Bacteria 8175
109 Ga0436364_0645960 3300037853 Bacteria 755
110 Ga0436364_0776648 3300037853 Bacteria 8248
111 Ga0436364_0866147 3300037853 Bacteria 1015
112 Ga0436364_0874241 3300037853 Unclassified 857
113 Ga0436364_0989026 3300037853 Bacteria 987
114 Ga0436364_1093036 3300037853 Bacteria 1426
115 Ga0436364_1138291 3300037853 Bacteria 8534
116 Ga0436364_1164734 3300037853 Bacteria 2271
117 Ga0436364_1180097 3300037853 Bacteria 39008
118 Ga0436364_1273510 3300037853 Bacteria 505
119 Ga0436364_1521721 3300037853 Bacteria 19288
120 Ga0436365_0129641 3300039437 Bacteria 580
121 Ga0436365_0194794 3300039437 Unclassified 920
122 Ga0436365_0267724 3300039437 Bacteria 28607
123 Ga0436365_0333123 3300039437 Bacteria 5328
124 Ga0436365_0337423 3300039437 Bacteria 38026
125 Ga0436365_0338733 3300039437 Bacteria 4783
126 Ga0436365_0438165 3300039437 Bacteria 4893
127 Ga0436365_0563704 3300039437 Bacteria 4377
128 Ga0436365_1222780 3300039437 Bacteria 1378
129 Ga0436365_1301997 3300039437 Bacteria 12608
130 Ga0436365_1320177 3300039437 Bacteria 788
131 Ga0436365_1328469 3300039437 Bacteria 2645
132 Ga0436365_1669477 3300039437 Bacteria 1798
133 Ga0436365_1724099 3300039437 Bacteria 5710
134 Ga0436365_1868378 3300039437 Bacteria 656
135 Ga0436360_0094674 3300039438 Unclassified 829
136 Ga0436360_0907834 3300039438 Bacteria 1760
137 Ga0436361_0720905 3300039447 Bacteria 775
138 Ga0436363_0040179 3300039450 Bacteria 770
139 Ga0436363_0171709 3300039450 Bacteria 2568
140 Ga0436363_0510095 3300039450 Bacteria 855
141 Ga0436363_0694719 3300039450 Bacteria 30010
142 Ga0436363_0847714 3300039450 Bacteria 4347
143 Ga0436363_1151541 3300039450 Bacteria 837
144 Ga0436363_1200151 3300039450 Bacteria 1128
145 Ga0436363_1207990 3300039450 Bacteria 2640
146 Ga0436363_1356490 3300039450 Bacteria 2260
147 Ga0436363_1364053 3300039450 Bacteria 508
148 Ga0436362_0702463 3300039453 Bacteria 4965
149 Ga0436362_0725898 3300039453 Bacteria 1648
150 Ga0436362_0893026 3300039453 Bacteria 1641
151 Ga0451853_2099196 3300041512 Bacteria 536
152 Ga0451853_2703268 3300041512 Bacteria 581
153 Ga0450907_041131 3300042146 Bacteria 791
154 Ga0466969_0076240 3300044656 Bacteria 1606
155 Ga0466969_0168676 3300044656 Unclassified 1004
156 Ga0466965_0852875 3300044683 Bacteria 529
157 Ga0466966_0162290 3300044684 Bacteria 1360
158 Ga0466966_0399286 3300044684 Bacteria 826
159 Ga0466961_0016556 3300044693 Bacteria 4738
160 Ga0466961_0211163 3300044693 Bacteria 1198
161 Ga0466961_0358721 3300044693 Bacteria 887
162 Ga0466963_0006891 3300044694 Bacteria 6760
163 Ga0466963_0032465 3300044694 Bacteria 3381
164 Ga0466963_0077898 3300044694 Bacteria 2240
165 Ga0466963_0151554 3300044694 Bacteria 1610
166 Ga0466963_0207189 3300044694 Bacteria 1372
167 Ga0466963_0746877 3300044694 Bacteria 690
168 Ga0466963_0826238 3300044694 Bacteria 653
169 Ga0466963_0973683 3300044694 Bacteria 597
170 Ga0466971_0003528 3300044719 Bacteria 6687
171 Ga0466968_0029976 3300044735 Bacteria 2252
172 Ga0466968_0035974 3300044735 Unclassified 2074
173 Ga0466968_0362711 3300044735 Bacteria 705
174 Ga0466968_0513638 3300044735 Bacteria 598
175 Ga0466970_0059600 3300044765 Bacteria 2044
176 Ga0466970_0843188 3300044765 Unclassified 538
177 Ga0466957_0116459 3300044842 Bacteria 1700
178 Ga0466957_0170614 3300044842 Bacteria 1417
179 Ga0466957_0342958 3300044842 Unclassified 1012
180 Ga0466959_0001970 3300045049 Bacteria 12928
181 Ga0466959_0047241 3300045049 Bacteria 3166
182 Ga0466959_0523013 3300045049 Unclassified 801
183 Ga0466959_0837555 3300045049 Bacteria 614
184 Ga0466959_1089401 3300045049 Unclassified 531
185 Ga0466959_1119720 3300045049 Bacteria 523
186 Ga0466958_0001424 3300045836 Bacteria 11327
187 Ga0466958_0006131 3300045836 Bacteria 6520
188 Ga0466958_0006834 3300045836 Bacteria 6239
189 Ga0466958_0017130 3300045836 Bacteria 4183
190 Ga0466958_0055239 3300045836 Bacteria 2410
191 Ga0466958_0070421 3300045836 Bacteria 2140
192 Ga0466958_0082102 3300045836 Bacteria 1985
193 Ga0466967_0222716 3300045976 Bacteria 1793
194 Ga0466967_0278355 3300045976 Bacteria 1605
195 Ga0466967_0372378 3300045976 Bacteria 1385
196 Ga0466967_0515082 3300045976 Bacteria 1175
197 Ga0466967_0630575 3300045976 Unclassified 1059
198 Ga0466967_0847322 3300045976 Bacteria 908
199 Ga0466967_1053320 3300045976 Bacteria 810
200 Ga0466967_1103839 3300045976 Bacteria 790
201 Ga0466967_2327842 3300045976 Unclassified 531
202 Ga0466967_2418280 3300045976 Bacteria 520
203 Ga0466967_2582145 3300045976 Bacteria 503
204 Ga0495629_0066658 3300046459 Bacteria 2513
205 Ga0495651_0006925 3300046462 Bacteria 8666
206 Ga0495653_0067108 3300046463 Bacteria 2695
207 Ga0495653_0721952 3300046463 Bacteria 604
208 Ga0495582_0290344 3300046473 Bacteria 939
209 Ga0495639_0646767 3300046475 Bacteria 545
210 Ga0495664_0428226 3300046477 Unclassified 793
211 Ga0495664_0636326 3300046477 Bacteria 633
212 Ga0495608_0001585 3300046511 Bacteria 16255
213 Ga0495608_0117367 3300046511 Unclassified 1708
214 Ga0495608_0165050 3300046511 Bacteria 1407
215 Ga0495608_0493337 3300046511 Unclassified 742
216 Ga0495618_0054272 3300046514 Bacteria 2535
217 Ga0495628_0030587 3300046516 Bacteria 4359
218 Ga0495630_0416878 3300046517 Bacteria 1029
219 Ga0495666_0404817 3300046526 Bacteria 613
220 Ga0495652_0088865 3300046529 Bacteria 2531
221 Ga0495640_0029209 3300046533 Bacteria 3962
222 Ga0495587_0002732 3300046536 Bacteria 11774
223 Ga0495645_0318007 3300046543 Bacteria 1012
224 Ga0495667_0008563 3300046559 Bacteria 6943
225 Ga0495635_0055831 3300046663 Bacteria 2720
226 Ga0495657_0009000 3300046675 Bacteria 7596
227 Ga0495646_0139149 3300046680 Bacteria 1359
228 Ga0495647_0619933 3300046681 Unclassified 508
229 Ga0495658_0644375 3300046683 Bacteria 679
230 Ga0495613_0070780 3300046689 Bacteria 2543
231 Ga0495600_0070777 3300046809 Bacteria 2279
232 Ga0495581_0849091 3300047315 Bacteria 523
233 Ga0495604_0001613 3300047317 Bacteria 18594
234 Ga0495604_0125865 3300047317 Bacteria 1848
235 Ga0495674_0027494 3300047319 Bacteria 5199
236 Ga0495674_0741632 3300047319 Unclassified 768
237 Ga0495674_0827206 3300047319 Bacteria 719
238 Ga0495680_0009131 3300047322 Bacteria 8948
239 Ga0495684_0018521 3300047471 Bacteria 5364
240 Ga0495602_0013734 3300048088 Bacteria 8259
241 Ga0495602_0241613 3300048088 Bacteria 1351
242 Ga0496100_0004567 3300048903 Bacteria 7358
243 Ga0496101_1095744 3300048904 Unclassified 625
244 Ga0496104_0000037 3300048907 Bacteria 178518
245 Ga0496104_0033035 3300048907 Bacteria 4817
246 Ga0496104_0087619 3300048907 Bacteria 2973
247 Ga0496105_0472362 3300048908 Bacteria 988
248 Ga0496106_0557904 3300048909 Bacteria 919
249 Ga0496107_0528156 3300048910 Bacteria 875
250 Ga0496110_0001061 3300048913 Bacteria 19396
251 Ga0496110_0169760 3300048913 Bacteria 1979
252 Ga0496111_0001257 3300048914 Bacteria 14194
253 Ga0496113_0239048 3300048916 Bacteria 1449
254 Ga0496114_1098397 3300048917 Bacteria 680
255 Ga0496115_0487207 3300048918 Bacteria 992
256 Ga0496115_0916792 3300048918 Bacteria 675
257 Ga0501067_0148376 3300049583 Unclassified 1306
258 Ga0501067_0185075 3300049583 Unclassified 1160
259 Ga0501069_0106155 3300049585 Unclassified 1596
260 Ga0501072_0664459 3300049588 Unclassified 820
261 Ga0501074_0459949 3300049590 Unclassified 902
262 nmdc:mga08y16_97926_c1 3300050511 Bacteria 3054
263 nmdc:mga0rr50_1065149_c1 3300050513 Bacteria 688
264 Ga0495601_0045631 3300053077 Bacteria 2757
265 Ga0495601_0641434 3300053077 Bacteria 680
266 Ga0495612_0061746 3300053078 Bacteria 1553
267 Ga0495595_0030929 3300053084 Bacteria 2404
268 Ga0495595_0208140 3300053084 Bacteria 974
269 Ga0495619_0033724 3300053085 Bacteria 3325
270 Ga0495619_1036233 3300053085 Unclassified 548
271 Ga0466962_0007456 3300061719 Bacteria 5249
272 Ga0466962_0069727 3300061719 Unclassified 1679
273 Ga0466962_0237450 3300061719 Bacteria 894
274 Ga0466962_0349733 3300061719 Bacteria 736
275 Ga0466962_0402397 3300061719 Unclassified 686
276 Ga0466962_0455270 3300061719 Bacteria 645
277 Ga0466962_0689248 3300061719 Unclassified 524
278 Ga0530510_1513307 3300061734 Bacteria 515
279 Ga0436364_0977188
280 Ga0070709_10165838
281 Ga0070709_10652415
282 Ga0070714_100019628
283 Ga0070714_100307123
284 Ga0070714_100373642
285 Ga0070714_100424175
286 Ga0070714_100577015
287 Ga0070714_100655465
288 Ga0070714_100706680
289 Ga0070714_100948604
290 Ga0070714_101562028
291 Ga0070713_100024191
292 Ga0070713_100036077
293 Ga0070713_100147394
294 Ga0070713_100646792
295 Ga0070713_101025627
296 Ga0070710_10118263
297 Ga0070710_10125748
298 Ga0070710_10132688
299 Ga0070711_100024715
300 Ga0070711_100067039
301 Ga0070711_100136990
302 Ga0070711_100251939
303 Ga0070711_100618139
304 Ga0070662_100682452
305 Ga0070697_101192420
306 Ga0068856_100014721
307 Ga0068856_100090255
308 Ga0068856_100527516
309 Ga0070717_10005220
310 Ga0070717_10027212
311 Ga0070717_10033158
312 Ga0070717_10070544
313 Ga0070717_10126603
314 Ga0070715_10145680
315 Ga0070715_10182135
316 Ga0070716_100161912
317 Ga0070716_100196239
318 Ga0070716_100716275
319 Ga0070716_101010732
320 Ga0070712_100046494
321 Ga0070712_100061477
322 Ga0070712_100129430
323 Ga0070712_100157879
324 Ga0070712_100445024
325 Ga0070712_100574306
326 Ga0070712_100663514
327 Ga0105245_10014257
328 Ga0213873_10041132
329 Ga0213874_10005504
330 Ga0213874_10061239
331 Ga0213874_10082183
332 Ga0213874_10084518
333 Ga0213876_10024636
334 Ga0213876_10041602
335 Ga0213876_10050501
336 Ga0213876_10054870
337 Ga0213876_10091502
338 Ga0213876_10125355
339 Ga0213876_10320828
340 Ga0213875_10005171
341 Ga0213875_10123526
342 Ga0213875_10288509
343 Ga0213875_10291050
344 Ga0207692_10041597
345 Ga0207692_10208580
346 Ga0207692_10347822
347 Ga0207685_10219626
348 Ga0207699_10046765
349 Ga0207693_10014421
350 Ga0207693_10020028
351 Ga0207693_10027645
352 Ga0207693_10328786
353 Ga0207693_10618685
354 Ga0207663_10021473
355 Ga0207663_10094107
356 Ga0207663_10594029
357 Ga0207663_10710485
358 Ga0207663_11434770
359 Ga0207700_10030443
360 Ga0207700_10197055
361 Ga0207664_10107530
362 Ga0207664_10115507
363 Ga0207664_10268942
364 Ga0207664_11118626
365 Ga0207665_10057554
366 Ga0207665_10065086
367 Ga0207665_10232294
368 Ga0207702_10006872
369 Ga0207702_10105375
370 Ga0307416_101887029
371 Ga0373945_0389995
372 Ga0373953_0020097
373 Ga0373943_0429706
374 Ga0373955_0132710
375 Ga0373924_0022926
376 Ga0373935_0744258
377 Ga0373927_0327789
378 Ga0373947_0082102
379 Ga0373937_0016888
380 Ga0373925_0189430
381 Ga0373925_1090753
382 Ga0395900_0005335
383 Ga0395898_0009272
384 Ga0436364_0268086
385 Ga0436364_0461116
386 Ga0436364_0496169
387 Ga0436364_0645960
388 Ga0436364_0776648
389 Ga0436364_0866147
390 Ga0436364_0874241
391 Ga0436364_0989026
392 Ga0436364_1093036
393 Ga0436364_1138291
394 Ga0436364_1164734
395 Ga0436364_1180097
396 Ga0436364_1273510
397 Ga0436364_1521721
398 Ga0436365_0129641
399 Ga0436365_0194794
400 Ga0436365_0267724
401 Ga0436365_0333123
402 Ga0436365_0337423
403 Ga0436365_0338733
404 Ga0436365_0438165
405 Ga0436365_0563704
406 Ga0436365_1222780
407 Ga0436365_1301997
408 Ga0436365_1320177
409 Ga0436365_1328469
410 Ga0436365_1669477
411 Ga0436365_1724099
412 Ga0436365_1868378
413 Ga0436360_0094674
414 Ga0436360_0907834
415 Ga0436361_0720905
416 Ga0436363_0040179
417 Ga0436363_0171709
418 Ga0436363_0510095
419 Ga0436363_0694719
420 Ga0436363_0847714
421 Ga0436363_1151541
422 Ga0436363_1200151
423 Ga0436363_1207990
424 Ga0436363_1356490
425 Ga0436363_1364053
426 Ga0436362_0702463
427 Ga0436362_0725898
428 Ga0436362_0893026
429 Ga0451853_2099196
430 Ga0451853_2703268
431 Ga0450907_041131
432 Ga0466969_0076240
433 Ga0466969_0168676
434 Ga0466965_0852875
435 Ga0466966_0162290
436 Ga0466966_0399286
437 Ga0466961_0016556
438 Ga0466961_0211163
439 Ga0466961_0358721
440 Ga0466963_0006891
441 Ga0466963_0032465
442 Ga0466963_0077898
443 Ga0466963_0151554
444 Ga0466963_0207189
445 Ga0466963_0746877
446 Ga0466963_0826238
447 Ga0466963_0973683
448 Ga0466971_0003528
449 Ga0466968_0029976
450 Ga0466968_0035974
451 Ga0466968_0362711
452 Ga0466968_0513638
453 Ga0466970_0059600
454 Ga0466970_0843188
455 Ga0466957_0116459
456 Ga0466957_0170614
457 Ga0466957_0342958
458 Ga0466959_0001970
459 Ga0466959_0047241
460 Ga0466959_0523013
461 Ga0466959_0837555
462 Ga0466959_1089401
463 Ga0466959_1119720
464 Ga0466958_0001424
465 Ga0466958_0006131
466 Ga0466958_0006834
467 Ga0466958_0017130
468 Ga0466958_0055239
469 Ga0466958_0070421
470 Ga0466958_0082102
471 Ga0466967_0222716
472 Ga0466967_0278355
473 Ga0466967_0372378
474 Ga0466967_0515082
475 Ga0466967_0630575
476 Ga0466967_0847322
477 Ga0466967_1053320
478 Ga0466967_1103839
479 Ga0466967_2327842
480 Ga0466967_2418280
481 Ga0466967_2582145
482 Ga0495629_0066658
483 Ga0495651_0006925
484 Ga0495653_0067108
485 Ga0495653_0721952
486 Ga0495582_0290344
487 Ga0495639_0646767
488 Ga0495664_0428226
489 Ga0495664_0636326
490 Ga0495608_0001585
491 Ga0495608_0117367
492 Ga0495608_0165050
493 Ga0495608_0493337
494 Ga0495618_0054272
495 Ga0495628_0030587
496 Ga0495630_0416878
497 Ga0495666_0404817
498 Ga0495652_0088865
499 Ga0495640_0029209
500 Ga0495587_0002732
501 Ga0495645_0318007
502 Ga0495667_0008563
503 Ga0495635_0055831
504 Ga0495657_0009000
505 Ga0495646_0139149
506 Ga0495647_0619933
507 Ga0495658_0644375
508 Ga0495613_0070780
509 Ga0495600_0070777
510 Ga0495581_0849091
511 Ga0495604_0001613
512 Ga0495604_0125865
513 Ga0495674_0027494
514 Ga0495674_0741632
515 Ga0495674_0827206
516 Ga0495680_0009131
517 Ga0495684_0018521
518 Ga0495602_0013734
519 Ga0495602_0241613
520 Ga0496100_0004567
521 Ga0496101_1095744
522 Ga0496104_0000037
523 Ga0496104_0033035
524 Ga0496104_0087619
525 Ga0496105_0472362
526 Ga0496106_0557904
527 Ga0496107_0528156
528 Ga0496110_0001061
529 Ga0496110_0169760
530 Ga0496111_0001257
531 Ga0496113_0239048
532 Ga0496114_1098397
533 Ga0496115_0487207
534 Ga0496115_0916792
535 Ga0501067_0148376
536 Ga0501067_0185075
537 Ga0501069_0106155
538 Ga0501072_0664459
539 Ga0501074_0459949
540 nmdc:mga08y16_97926_c1
541 nmdc:mga0rr50_1065149_c1
542 Ga0495601_0045631
543 Ga0495601_0641434
544 Ga0495612_0061746
545 Ga0495595_0030929
546 Ga0495595_0208140
547 Ga0495619_0033724
548 Ga0495619_1036233
549 Ga0466962_0007456
550 Ga0466962_0069727
551 Ga0466962_0237450
552 Ga0466962_0349733
553 Ga0466962_0402397
554 Ga0466962_0455270
555 Ga0466962_0689248
556 Ga0530510_1513307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

1

125

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8749 2 123
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8527 2 122
7ess-assembly1.cif.gz_B structure-guided studies of the holliday junction resolvase ruvx provide novel insights into atp-stimulated cleavage of branched dna and rna substrates 0.8517 2 129
7ess-assembly1.cif.gz_A structure-guided studies of the holliday junction resolvase ruvx provide novel insights into atp-stimulated cleavage of branched dna and rna substrates 0.8501 2 129
1nu0-assembly2.cif.gz_B structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein 0.8387 2 123
ID Description Score Start End Superfamily
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8927 1 131 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8613 1 131 3.30.420.140
af_Q2FXW1_3_142_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8485 2 125 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8364 4 126 3.30.420.140
af_Q8GYR7_22_166_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.811 1 131 3.30.420.140
ID Description Score Start End GO Terms
AF-A0A538CFG6-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.99 1 126 GO:0000967
GO:0004518
GO:0005829
AF-A0A7V9WKT7-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.979 1 124 GO:0000967
GO:0004518
GO:0005829
AF-A0A538CFG6-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9671 1 126 GO:0000967
GO:0004518
GO:0005829
AF-A0A419GKK4-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9646 2 123 GO:0000967
GO:0004518
GO:0005829
AF-X1G2L9-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.9504 1 88 GO:0000967
GO:0004518
GO:0005829

Map