F382478

General Info

Members Datasets Scaffolds Average Seq Length
278 181 277 312

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10005206|Ga0265314_100052064
Length 312
Sequence MSKQRVLVTGGAGYIGSVLVPELLARGFAVTAFDLFTRGDPGLASSCADANFTAVKGDVREESLIKPLMAKHDIIIPLAALVGAPLCKRDPLNAQTVNSDAVRMLVKLASKDQKILYPNTNSGYGIGEKTDFCTEESPLRPLSLYGTSKVEAESSVRAHGGVAFRLATVFGMAPRMRLDLLVNDITWRAVTDRTVVIFEGHFRRNYIHIRDVVKAFLHGIENYGSMGGEAYNLGLSSANLSKLQLCEVIKKHVPQFVYLEAPIGEDPDKRDYIVSNEKLEKAGWKPDWSLDDGIEELLKGYVMLRNSIYGNV

Samples

Sample ID Description Type Environment
1 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
147 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
150 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 2.16
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10013600 3300005290 Bacteria 2458
2 Ga0065715_10017859 3300005293 Bacteria 3223
3 Ga0065715_10122750 3300005293 Unclassified 2196
4 Ga0070658_10030671 3300005327 Bacteria 4319
5 Ga0070676_10097663 3300005328 Bacteria 1809
6 Ga0070690_100019178 3300005330 Unclassified 4146
7 Ga0070690_100067058 3300005330 Bacteria 2324
8 Ga0070670_100007277 3300005331 Bacteria 9387
9 Ga0070670_100013619 3300005331 Bacteria 6969
10 Ga0070666_10014590 3300005335 Bacteria 5002
11 Ga0070680_100018317 3300005336 Bacteria 5532
12 Ga0070680_100022208 3300005336 Bacteria 5049
13 Ga0068868_100197345 3300005338 Bacteria 1676
14 Ga0068868_100381216 3300005338 Unclassified 1213
15 Ga0070660_100048705 3300005339 Unclassified 3255
16 Ga0070689_100015513 3300005340 Bacteria 5558
17 Ga0070689_100167430 3300005340 Unclassified 1779
18 Ga0070689_100265634 3300005340 Bacteria 1419
19 Ga0070689_100273451 3300005340 Bacteria 1399
20 Ga0070691_10030089 3300005341 Bacteria 2543
21 Ga0070661_100000319 3300005344 Bacteria 38749
22 Ga0070668_100048049 3300005347 Bacteria 3282
23 Ga0070669_100018189 3300005353 Bacteria 5020
24 Ga0070669_100191552 3300005353 Unclassified 1604
25 Ga0070675_100001188 3300005354 Bacteria 18929
26 Ga0070675_100001560 3300005354 Bacteria 16931
27 Ga0070675_100086751 3300005354 Unclassified 2616
28 Ga0070671_100074087 3300005355 Unclassified 2844
29 Ga0070671_100219654 3300005355 Unclassified 1612
30 Ga0070673_100009627 3300005364 Bacteria 6497
31 Ga0070688_100147719 3300005365 Unclassified 1604
32 Ga0070667_100008745 3300005367 Bacteria 8391
33 Ga0070709_10000002 3300005434 Bacteria 322903
34 Ga0070709_10108879 3300005434 Bacteria 1859
35 Ga0070711_100000174 3300005439 Bacteria 34321
36 Ga0070705_100008664 3300005440 Bacteria 5038
37 Ga0070700_100160439 3300005441 Unclassified 1547
38 Ga0070708_100250243 3300005445 Bacteria 1665
39 Ga0070662_100120586 3300005457 Unclassified 2009
40 Ga0070662_100314843 3300005457 Unclassified 1275
41 Ga0070681_10002540 3300005458 Bacteria 16740
42 Ga0070681_10062869 3300005458 Unclassified 3685
43 Ga0070681_10250934 3300005458 Bacteria 1682
44 Ga0070681_10490597 3300005458 Unclassified 1141
45 Ga0070707_100000246 3300005468 Bacteria 54176
46 Ga0070707_100056672 3300005468 Bacteria 3759
47 Ga0070698_100207374 3300005471 Bacteria 1895
48 Ga0070698_100329389 3300005471 Unclassified 1458
49 Ga0070699_100017883 3300005518 Bacteria 6087
50 Ga0070699_100144864 3300005518 Bacteria 2099
51 Ga0070679_100282198 3300005530 Unclassified 1613
52 Ga0068853_100173185 3300005539 Unclassified 1953
53 Ga0070672_100003701 3300005543 Bacteria 9945
54 Ga0070686_100051289 3300005544 Bacteria 2626
55 Ga0070686_100084594 3300005544 Unclassified 2108
56 Ga0070686_100231007 3300005544 Unclassified 1342
57 Ga0070695_100119419 3300005545 Bacteria 1801
58 Ga0070696_100032592 3300005546 Bacteria 3575
59 Ga0070704_100065220 3300005549 Unclassified 2621
60 Ga0068855_100084307 3300005563 Bacteria 3680
61 Ga0068855_100106109 3300005563 Bacteria 3229
62 Ga0070664_100068895 3300005564 Unclassified 3025
63 Ga0070664_100090464 3300005564 Unclassified 2649
64 Ga0070664_100232601 3300005564 Unclassified 1652
65 Ga0068857_100160399 3300005577 Bacteria 2040
66 Ga0068859_100018999 3300005617 Bacteria 6902
67 Ga0068864_100051940 3300005618 Unclassified 3532
68 Ga0068866_10046285 3300005718 Unclassified 2187
69 Ga0068863_100004027 3300005841 Bacteria 14512
70 Ga0068863_100484224 3300005841 Unclassified 1217
71 Ga0068858_100197473 3300005842 Unclassified 1902
72 Ga0068860_100004987 3300005843 Bacteria 13525
73 Ga0081539_10000082 3300005985 Bacteria 219763
74 Ga0075364_10232776 3300006051 Bacteria 1251
75 Ga0075432_10033305 3300006058 Bacteria 1787
76 Ga0070715_10001782 3300006163 Bacteria 6411
77 Ga0070716_100005254 3300006173 Bacteria 6259
78 Ga0070712_100000320 3300006175 Bacteria 27117
79 Ga0075362_10000013 3300006177 Bacteria 99793
80 Ga0075367_10026507 3300006178 Bacteria 3288
81 Ga0075367_10056077 3300006178 Bacteria 2340
82 Ga0097621_100221634 3300006237 Bacteria 1648
83 Ga0075370_10110830 3300006353 Unclassified 1594
84 Ga0068871_100019536 3300006358 Bacteria 5174
85 Ga0075428_100132798 3300006844 Unclassified 2707
86 Ga0075428_100264574 3300006844 Unclassified 1851
87 Ga0075428_100333156 3300006844 Bacteria 1630
88 Ga0075430_100097195 3300006846 Unclassified 2460
89 Ga0075430_100109392 3300006846 Unclassified 2305
90 Ga0075431_100093188 3300006847 Bacteria 3109
91 Ga0075431_100114550 3300006847 Bacteria 2783
92 Ga0075431_100139234 3300006847 Bacteria 2502
93 Ga0075431_100169630 3300006847 Bacteria 2243
94 Ga0075431_100260293 3300006847 Unclassified 1761
95 Ga0075433_10025006 3300006852 Bacteria 5046
96 Ga0075433_10034551 3300006852 Bacteria 4343
97 Ga0075433_10073390 3300006852 Unclassified 3009
98 Ga0075433_10091018 3300006852 Bacteria 2696
99 Ga0075433_10096620 3300006852 Bacteria 2615
100 Ga0075434_100011497 3300006871 Bacteria 8352
101 Ga0075434_100012881 3300006871 Bacteria 7943
102 Ga0075434_100026614 3300006871 Bacteria 5668
103 Ga0075429_100001635 3300006880 Bacteria 18519
104 Ga0075429_100052724 3300006880 Bacteria 3539
105 Ga0097620_100018999 3300006931 Bacteria 6902
106 Ga0075435_100028180 3300007076 Bacteria 4403
107 Ga0075435_100125752 3300007076 Bacteria 2143
108 Ga0075435_100157537 3300007076 Unclassified 1911
109 Ga0111539_10049478 3300009094 Bacteria 5011
110 Ga0111539_10090919 3300009094 Unclassified 3587
111 Ga0111539_10101634 3300009094 Bacteria 3375
112 Ga0111539_10185906 3300009094 Unclassified 2426
113 Ga0111539_10393726 3300009094 Unclassified 1614
114 Ga0105247_10028340 3300009101 Unclassified 3388
115 Ga0114129_10000678 3300009147 Bacteria 42896
116 Ga0114129_10001384 3300009147 Bacteria 32641
117 Ga0114129_10019981 3300009147 Bacteria 9534
118 Ga0114129_10051510 3300009147 Bacteria 5779
119 Ga0114129_10070342 3300009147 Bacteria 4879
120 Ga0114129_10105504 3300009147 Bacteria 3894
121 Ga0114129_10121804 3300009147 Bacteria 3589
122 Ga0114129_10464932 3300009147 Bacteria 1657
123 Ga0114129_10709400 3300009147 Unclassified 1292
124 Ga0105241_10034576 3300009174 Bacteria 3798
125 Ga0105242_10086239 3300009176 Unclassified 2634
126 Ga0105248_10000716 3300009177 Bacteria 37542
127 Ga0105239_10073872 3300010375 Unclassified 3749
128 Ga0157374_10032385 3300013296 Bacteria 4759
129 Ga0157374_10038100 3300013296 Unclassified 4418
130 Ga0163162_10001473 3300013306 Bacteria 21902
131 Ga0163162_10032693 3300013306 Bacteria 5167
132 Ga0163162_10042459 3300013306 Bacteria 4551
133 Ga0157372_10057102 3300013307 Bacteria 4363
134 Ga0157375_10032215 3300013308 Unclassified 4969
135 Ga0157375_10129754 3300013308 Unclassified 2639
136 Ga0163163_10010069 3300014325 Bacteria 8482
137 Ga0163163_10274066 3300014325 Bacteria 1738
138 Ga0157379_10002880 3300014968 Bacteria 14504
139 Ga0157379_10597641 3300014968 Bacteria 1030
140 Ga0163161_10007192 3300017792 Bacteria 7692
141 Ga0163161_10030077 3300017792 Unclassified 3863
142 Ga0207642_10050200 3300025899 Bacteria 1880
143 Ga0207710_10111185 3300025900 Unclassified 1301
144 Ga0207688_10081799 3300025901 Bacteria 1845
145 Ga0207685_10000927 3300025905 Bacteria 5601
146 Ga0207699_10000001 3300025906 Bacteria 695560
147 Ga0207645_10011210 3300025907 Bacteria 6131
148 Ga0207705_10088782 3300025909 Bacteria 2262
149 Ga0207684_10150838 3300025910 Bacteria 2000
150 Ga0207707_10001824 3300025912 Bacteria 19527
151 Ga0207695_10015235 3300025913 Bacteria 9064
152 Ga0207693_10004649 3300025915 Bacteria 11582
153 Ga0207663_10001140 3300025916 Bacteria 12243
154 Ga0207660_10059459 3300025917 Bacteria 2744
155 Ga0207657_10011878 3300025919 Bacteria 8620
156 Ga0207649_10000073 3300025920 Bacteria 86636
157 Ga0207646_10000638 3300025922 Bacteria 45629
158 Ga0207646_10058273 3300025922 Bacteria 3449
159 Ga0207681_10014620 3300025923 Unclassified 4884
160 Ga0207650_10047957 3300025925 Unclassified 3149
161 Ga0207659_10001424 3300025926 Bacteria 14248
162 Ga0207644_10016882 3300025931 Bacteria 4918
163 Ga0207644_10054382 3300025931 Unclassified 2883
164 Ga0207690_10061334 3300025932 Unclassified 2556
165 Ga0207706_10401576 3300025933 Unclassified 1188
166 Ga0207670_10005107 3300025936 Bacteria 7166
167 Ga0207670_10202781 3300025936 Bacteria 1508
168 Ga0207669_10316761 3300025937 Unclassified 1192
169 Ga0207665_10009909 3300025939 Bacteria 6253
170 Ga0207691_10030484 3300025940 Bacteria 5040
171 Ga0207691_10059775 3300025940 Unclassified 3464
172 Ga0207711_10003376 3300025941 Bacteria 13832
173 Ga0207689_10191213 3300025942 Bacteria 1689
174 Ga0207679_10084303 3300025945 Unclassified 2438
175 Ga0207651_10080701 3300025960 Unclassified 2342
176 Ga0207658_10017678 3300025986 Unclassified 4917
177 Ga0207677_10227405 3300026023 Bacteria 1500
178 Ga0207703_10328599 3300026035 Unclassified 1402
179 Ga0207639_10246647 3300026041 Unclassified 1556
180 Ga0207708_10204808 3300026075 Unclassified 1575
181 Ga0207641_10134789 3300026088 Unclassified 2221
182 Ga0207641_10441470 3300026088 Unclassified 1256
183 Ga0207676_10143042 3300026095 Bacteria 2050
184 Ga0207675_100232667 3300026118 Bacteria 1778
185 Ga0207683_10000701 3300026121 Bacteria 30621
186 Ga0209813_10035593 3300027866 Bacteria 1492
187 Ga0207428_10003817 3300027907 Bacteria 14447
188 Ga0207428_10193063 3300027907 Bacteria 1534
189 Ga0268264_10014021 3300028381 Bacteria 6590
190 Ga0265334_10000400 3300028573 Bacteria 22836
191 Ga0265318_10000006 3300028577 Bacteria 285591
192 Ga0265338_10095251 3300028800 Bacteria 2446
193 Ga0265332_10029372 3300031238 Bacteria 2404
194 Ga0265320_10004878 3300031240 Bacteria 8706
195 Ga0265331_10003322 3300031250 Bacteria 10449
196 Ga0265316_10024761 3300031344 Bacteria 5018
197 Ga0265313_10003448 3300031595 Bacteria 12794
198 Ga0265314_10000752 3300031711 Bacteria 38798
199 Ga0265314_10002363 3300031711 Bacteria 19458
200 Ga0265314_10005206 3300031711 Bacteria 11811
201 Ga0316576_10062984 3300031727 Bacteria 2721
202 Ga0307405_10052344 3300031731 Bacteria 2538
203 Ga0307410_10044698 3300031852 Bacteria 2944
204 Ga0307406_10134949 3300031901 Bacteria 1738
205 Ga0307416_100141082 3300032002 Bacteria 2190
206 Ga0307414_10197287 3300032004 Bacteria 1634
207 Ga0307414_10246928 3300032004 Unclassified 1481
208 Ga0307415_100104454 3300032126 Bacteria 2087
209 Ga0373940_0041197 3300035088 Bacteria 1270
210 Ga0373931_0018048 3300035691 Bacteria 3502
211 Ga0373935_0243933 3300035692 Bacteria 1255
212 Ga0373933_0166846 3300035724 Bacteria 1400
213 Ga0373937_0187160 3300036401 Bacteria 1945
214 Ga0316582_0027369 3300036647 Bacteria 3442
215 Ga0316584_0015700 3300036712 Bacteria 5420
216 Ga0400485_08379 3300038735 Bacteria 31740
217 Ga0400486_19814 3300038742 Bacteria 7556
218 Ga0400483_022312 3300039062 Bacteria 1817
219 Ga0400489_58816 3300039093 Bacteria 1219
220 Ga0400487_22986 3300039110 Unclassified 1408
221 Ga0436362_0246780 3300039453 Bacteria 1419
222 Ga0451577_0000397 3300042876 Bacteria 79933
223 Ga0451577_0001910 3300042876 Bacteria 26415
224 Ga0451577_0008011 3300042876 Bacteria 10314
225 Ga0453683_0037656 3300044673 Bacteria 3042
226 Ga0453684_0000229 3300044712 Bacteria 241494
227 Ga0453684_0000314 3300044712 Bacteria 205428
228 Ga0453684_0001252 3300044712 Bacteria 76808
229 Ga0453684_0005086 3300044712 Bacteria 26546
230 Ga0453684_0054516 3300044712 Bacteria 5207
231 Ga0451576_0000451 3300045051 Bacteria 93335
232 Ga0451576_0332722 3300045051 Unclassified 1589
233 Ga0495580_0220895 3300046472 Bacteria 1302
234 Ga0495643_0001847 3300046522 Bacteria 17988
235 Ga0495587_0224786 3300046536 Bacteria 1058
236 Ga0495658_0109250 3300046683 Bacteria 1661
237 Ga0495674_0056699 3300047319 Unclassified 3430
238 Ga0496102_0080216 3300048905 Unclassified 3006
239 Ga0496108_0471482 3300048911 Unclassified 1097
240 Ga0496110_0182641 3300048913 Unclassified 1905
241 Ga0496112_0019440 3300048915 Bacteria 6412
242 Ga0496112_0135063 3300048915 Unclassified 2437
243 Ga0496113_0393627 3300048916 Bacteria 1112
244 Ga0501073_0047531 3300049589 Bacteria 3016
245 Ga0501075_0195465 3300049591 Bacteria 1543
246 Ga0501077_0012938 3300049593 Bacteria 5228
247 Ga0501080_0332887 3300049742 Bacteria 1373
248 nmdc:mga03683_1_c2 3300050489 Bacteria 239664
249 nmdc:mga00v17_28_c1 3300050491 Bacteria 41836
250 nmdc:mga06z11_6471_c1 3300050494 Bacteria 2848
251 nmdc:mga05p37_107349_c1 3300050507 Bacteria 3435
252 nmdc:mga05p37_21058_c1 3300050507 Bacteria 7892
253 nmdc:mga05p37_231_c1 3300050507 Bacteria 56731
254 nmdc:mga05p37_3873_c1 3300050507 Bacteria 17503
255 nmdc:mga05p37_496461_c1 3300050507 Bacteria 1402
256 nmdc:mga05p37_67737_c1 3300050507 Bacteria 4392
257 nmdc:mga09592_1306_c1 3300050508 Bacteria 20044
258 nmdc:mga09592_93646_c1 3300050508 Bacteria 2569
259 nmdc:mga0qj67_217748_c1 3300050509 Unclassified 1550
260 nmdc:mga0qj67_88155_c1 3300050509 Bacteria 2491
261 nmdc:mga06r32_300411_c1 3300050510 Bacteria 1591
262 nmdc:mga06r32_40378_c1 3300050510 Bacteria 4429
263 nmdc:mga06r32_89847_c1 3300050510 Bacteria 3000
264 nmdc:mga08y16_136769_c1 3300050511 Bacteria 2547
265 nmdc:mga0n895_1088_c1 3300050512 Bacteria 19874
266 nmdc:mga0n895_601529_c1 3300050512 Bacteria 1102
267 nmdc:mga0n895_62110_c1 3300050512 Unclassified 3691
268 nmdc:mga0rr50_129838_c1 3300050513 Bacteria 2016
269 nmdc:mga0rr50_52637_c1 3300050513 Bacteria 3026
270 nmdc:mga0a205_11035_c1 3300050515 Bacteria 8315
271 nmdc:mga0a205_115166_c1 3300050515 Bacteria 2587
272 nmdc:mga0a205_117514_c1 3300050515 Archaea 2557
273 nmdc:mga0a205_1699_c1 3300050515 Bacteria 19005
274 nmdc:mga0a205_236149_c1 3300050515 Unclassified 1710
275 nmdc:mga0a205_42099_c1 3300050515 Bacteria 4400
276 nmdc:mga0a205_8329_c2 3300050515 Bacteria 2697
277 Ga0495601_0208520 3300053077 Bacteria 1277

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0224786 Ga0495587_0224786_106_960 284
2 3300047319 Ga0495674_0056699 Ga0495674_0056699_1839_2693 284
3 3300009147 Ga0114129_10105504 Ga0114129_101055043 288
4 3300035088 Ga0373940_0041197 Ga0373940_0041197_255_1178 307
5 3300050515 nmdc:mga0a205_115166_c1 nmdc:mga0a205_115166_c1_233_1156 307
6 3300009147 Ga0114129_10464932 Ga0114129_104649322 308
7 3300046522 Ga0495643_0001847 Ga0495643_0001847_11313_12239 308
8 3300050507 nmdc:mga05p37_496461_c1 nmdc:mga05p37_496461_c1_429_1355 308
9 3300050515 nmdc:mga0a205_42099_c1 nmdc:mga0a205_42099_c1_229_1155 308
10 iso_pu_bacteria 2671180531 2673164286 308
11 3300005434 Ga0070709_10108879 Ga0070709_101088792 310
12 3300005439 Ga0070711_100000174 Ga0070711_10000017421 310
13 3300005458 Ga0070681_10490597 Ga0070681_104905971 310
14 3300006051 Ga0075364_10232776 Ga0075364_102327761 310
15 3300006163 Ga0070715_10001782 Ga0070715_100017824 310
16 3300006173 Ga0070716_100005254 Ga0070716_1000052543 310
17 3300006175 Ga0070712_100000320 Ga0070712_10000032021 310
18 3300006178 Ga0075367_10026507 Ga0075367_100265073 310
19 3300006844 Ga0075428_100333156 Ga0075428_1003331561 310
20 3300006847 Ga0075431_100114550 Ga0075431_1001145502 310
21 3300006880 Ga0075429_100001635 Ga0075429_1000016352 310
22 3300009147 Ga0114129_10001384 Ga0114129_1000138415 310
23 3300025905 Ga0207685_10000927 Ga0207685_100009274 310
24 3300025913 Ga0207695_10015235 Ga0207695_1001523514 310
25 3300025915 Ga0207693_10004649 Ga0207693_100046496 310
26 3300025916 Ga0207663_10001140 Ga0207663_100011402 310
27 3300025939 Ga0207665_10009909 Ga0207665_100099095 310
28 3300027866 Ga0209813_10035593 Ga0209813_100355932 310
29 3300031711 Ga0265314_10002363 Ga0265314_1000236317 310
30 3300046683 Ga0495658_0109250 Ga0495658_0109250_35_967 310
31 3300050494 nmdc:mga06z11_6471_c1 nmdc:mga06z11_6471_c1_777_1709 310
32 3300050507 nmdc:mga05p37_231_c1 nmdc:mga05p37_231_c1_43925_44857 310
33 3300050508 nmdc:mga09592_1306_c1 nmdc:mga09592_1306_c1_1811_2743 310
34 3300050509 nmdc:mga0qj67_88155_c1 nmdc:mga0qj67_88155_c1_727_1659 310
35 3300050510 nmdc:mga06r32_89847_c1 nmdc:mga06r32_89847_c1_497_1429 310
36 3300053077 Ga0495601_0208520 Ga0495601_0208520_256_1188 310
37 3300005344 Ga0070661_100000319 Ga0070661_10000031912 311
38 3300005434 Ga0070709_10000002 Ga0070709_10000002124 311
39 3300005563 Ga0068855_100084307 Ga0068855_1000843073 311
40 3300025906 Ga0207699_10000001 Ga0207699_10000001135 311
41 3300025920 Ga0207649_10000073 Ga0207649_1000007329 311
42 3300031711 Ga0265314_10005206 Ga0265314_100052064 311
43 3300042876 Ga0451577_0001910 Ga0451577_0001910_16697_17632 311
44 3300044712 Ga0453684_0000229 Ga0453684_0000229_224358_225293 311
45 3300044712 Ga0453684_0054516 Ga0453684_0054516_520_1455 311
46 3300045051 Ga0451576_0000451 Ga0451576_0000451_18859_19794 311
47 3300005290 Ga0065712_10013600 Ga0065712_100136001 312
48 3300005293 Ga0065715_10017859 Ga0065715_100178593 312
49 3300005293 Ga0065715_10122750 Ga0065715_101227502 312
50 3300005327 Ga0070658_10030671 Ga0070658_100306713 312
51 3300005328 Ga0070676_10097663 Ga0070676_100976632 312
52 3300005330 Ga0070690_100019178 Ga0070690_1000191782 312
53 3300005330 Ga0070690_100067058 Ga0070690_1000670582 312
54 3300005331 Ga0070670_100007277 Ga0070670_1000072778 312
55 3300005331 Ga0070670_100013619 Ga0070670_1000136193 312
56 3300005335 Ga0070666_10014590 Ga0070666_100145902 312
57 3300005336 Ga0070680_100018317 Ga0070680_1000183173 312
58 3300005336 Ga0070680_100022208 Ga0070680_1000222082 312
59 3300005338 Ga0068868_100197345 Ga0068868_1001973452 312
60 3300005338 Ga0068868_100381216 Ga0068868_1003812161 312
61 3300005339 Ga0070660_100048705 Ga0070660_1000487052 312
62 3300005340 Ga0070689_100015513 Ga0070689_1000155135 312
63 3300005340 Ga0070689_100167430 Ga0070689_1001674302 312
64 3300005340 Ga0070689_100265634 Ga0070689_1002656342 312
65 3300005340 Ga0070689_100273451 Ga0070689_1002734511 312
66 3300005341 Ga0070691_10030089 Ga0070691_100300892 312
67 3300005347 Ga0070668_100048049 Ga0070668_1000480492 312
68 3300005353 Ga0070669_100018189 Ga0070669_1000181894 312
69 3300005353 Ga0070669_100191552 Ga0070669_1001915521 312
70 3300005354 Ga0070675_100001188 Ga0070675_10000118813 312
71 3300005354 Ga0070675_100001560 Ga0070675_1000015604 312
72 3300005354 Ga0070675_100086751 Ga0070675_1000867512 312
73 3300005355 Ga0070671_100074087 Ga0070671_1000740873 312
74 3300005355 Ga0070671_100219654 Ga0070671_1002196542 312
75 3300005364 Ga0070673_100009627 Ga0070673_1000096275 312
76 3300005365 Ga0070688_100147719 Ga0070688_1001477192 312
77 3300005367 Ga0070667_100008745 Ga0070667_1000087456 312
78 3300005440 Ga0070705_100008664 Ga0070705_1000086643 312
79 3300005441 Ga0070700_100160439 Ga0070700_1001604392 312
80 3300005445 Ga0070708_100250243 Ga0070708_1002502432 312
81 3300005457 Ga0070662_100120586 Ga0070662_1001205862 312
82 3300005457 Ga0070662_100314843 Ga0070662_1003148431 312
83 3300005458 Ga0070681_10002540 Ga0070681_1000254013 312
84 3300005458 Ga0070681_10062869 Ga0070681_100628693 312
85 3300005458 Ga0070681_10250934 Ga0070681_102509341 312
86 3300005468 Ga0070707_100000246 Ga0070707_10000024657 312
87 3300005468 Ga0070707_100056672 Ga0070707_1000566724 312
88 3300005471 Ga0070698_100207374 Ga0070698_1002073742 312
89 3300005471 Ga0070698_100329389 Ga0070698_1003293892 312
90 3300005518 Ga0070699_100017883 Ga0070699_1000178835 312
91 3300005518 Ga0070699_100144864 Ga0070699_1001448641 312
92 3300005530 Ga0070679_100282198 Ga0070679_1002821982 312
93 3300005539 Ga0068853_100173185 Ga0068853_1001731852 312
94 3300005543 Ga0070672_100003701 Ga0070672_1000037018 312
95 3300005544 Ga0070686_100051289 Ga0070686_1000512892 312
96 3300005544 Ga0070686_100084594 Ga0070686_1000845942 312
97 3300005544 Ga0070686_100231007 Ga0070686_1002310071 312
98 3300005545 Ga0070695_100119419 Ga0070695_1001194192 312
99 3300005546 Ga0070696_100032592 Ga0070696_1000325924 312
100 3300005549 Ga0070704_100065220 Ga0070704_1000652202 312
101 3300005563 Ga0068855_100106109 Ga0068855_1001061092 312
102 3300005564 Ga0070664_100068895 Ga0070664_1000688953 312
103 3300005564 Ga0070664_100090464 Ga0070664_1000904642 312
104 3300005564 Ga0070664_100232601 Ga0070664_1002326012 312
105 3300005577 Ga0068857_100160399 Ga0068857_1001603992 312
106 3300005617 Ga0068859_100018999 Ga0068859_1000189993 312
107 3300005618 Ga0068864_100051940 Ga0068864_1000519402 312
108 3300005718 Ga0068866_10046285 Ga0068866_100462852 312
109 3300005841 Ga0068863_100004027 Ga0068863_1000040272 312
110 3300005841 Ga0068863_100484224 Ga0068863_1004842242 312
111 3300005842 Ga0068858_100197473 Ga0068858_1001974732 312
112 3300005843 Ga0068860_100004987 Ga0068860_1000049875 312
113 3300005985 Ga0081539_10000082 Ga0081539_10000082118 312
114 3300006058 Ga0075432_10033305 Ga0075432_100333052 312
115 3300006177 Ga0075362_10000013 Ga0075362_1000001333 312
116 3300006178 Ga0075367_10056077 Ga0075367_100560771 312
117 3300006237 Ga0097621_100221634 Ga0097621_1002216342 312
118 3300006353 Ga0075370_10110830 Ga0075370_101108302 312
119 3300006358 Ga0068871_100019536 Ga0068871_1000195363 312
120 3300006844 Ga0075428_100132798 Ga0075428_1001327983 312
121 3300006844 Ga0075428_100264574 Ga0075428_1002645742 312
122 3300006846 Ga0075430_100097195 Ga0075430_1000971952 312
123 3300006846 Ga0075430_100109392 Ga0075430_1001093922 312
124 3300006847 Ga0075431_100093188 Ga0075431_1000931884 312
125 3300006847 Ga0075431_100139234 Ga0075431_1001392342 312
126 3300006847 Ga0075431_100169630 Ga0075431_1001696302 312
127 3300006847 Ga0075431_100260293 Ga0075431_1002602932 312
128 3300006852 Ga0075433_10025006 Ga0075433_100250065 312
129 3300006852 Ga0075433_10034551 Ga0075433_100345512 312
130 3300006852 Ga0075433_10073390 Ga0075433_100733903 312
131 3300006852 Ga0075433_10091018 Ga0075433_100910183 312
132 3300006852 Ga0075433_10096620 Ga0075433_100966202 312
133 3300006871 Ga0075434_100011497 Ga0075434_1000114972 312
134 3300006871 Ga0075434_100012881 Ga0075434_1000128815 312
135 3300006871 Ga0075434_100026614 Ga0075434_1000266142 312
136 3300006880 Ga0075429_100052724 Ga0075429_1000527242 312
137 3300006931 Ga0097620_100018999 Ga0097620_1000189995 312
138 3300007076 Ga0075435_100028180 Ga0075435_1000281803 312
139 3300007076 Ga0075435_100125752 Ga0075435_1001257522 312
140 3300007076 Ga0075435_100157537 Ga0075435_1001575372 312
141 3300009094 Ga0111539_10049478 Ga0111539_100494783 312
142 3300009094 Ga0111539_10090919 Ga0111539_100909193 312
143 3300009094 Ga0111539_10101634 Ga0111539_101016343 312
144 3300009094 Ga0111539_10185906 Ga0111539_101859062 312
145 3300009094 Ga0111539_10393726 Ga0111539_103937262 312
146 3300009101 Ga0105247_10028340 Ga0105247_100283402 312
147 3300009147 Ga0114129_10000678 Ga0114129_1000067815 312
148 3300009147 Ga0114129_10019981 Ga0114129_100199818 312
149 3300009147 Ga0114129_10051510 Ga0114129_100515104 312
150 3300009147 Ga0114129_10070342 Ga0114129_100703422 312
151 3300009147 Ga0114129_10121804 Ga0114129_101218041 312
152 3300009147 Ga0114129_10709400 Ga0114129_107094001 312
153 3300009174 Ga0105241_10034576 Ga0105241_100345763 312
154 3300009176 Ga0105242_10086239 Ga0105242_100862393 312
155 3300009177 Ga0105248_10000716 Ga0105248_100007163 312
156 3300010375 Ga0105239_10073872 Ga0105239_100738722 312
157 3300013296 Ga0157374_10032385 Ga0157374_100323852 312
158 3300013296 Ga0157374_10038100 Ga0157374_100381002 312
159 3300013306 Ga0163162_10001473 Ga0163162_1000147319 312
160 3300013306 Ga0163162_10032693 Ga0163162_100326933 312
161 3300013306 Ga0163162_10042459 Ga0163162_100424592 312
162 3300013307 Ga0157372_10057102 Ga0157372_100571024 312
163 3300013308 Ga0157375_10032215 Ga0157375_100322154 312
164 3300013308 Ga0157375_10129754 Ga0157375_101297542 312
165 3300014325 Ga0163163_10010069 Ga0163163_100100697 312
166 3300014325 Ga0163163_10274066 Ga0163163_102740662 312
167 3300014968 Ga0157379_10002880 Ga0157379_100028806 312
168 3300014968 Ga0157379_10597641 Ga0157379_105976411 312
169 3300017792 Ga0163161_10007192 Ga0163161_100071924 312
170 3300017792 Ga0163161_10030077 Ga0163161_100300772 312
171 3300025899 Ga0207642_10050200 Ga0207642_100502002 312
172 3300025900 Ga0207710_10111185 Ga0207710_101111851 312
173 3300025901 Ga0207688_10081799 Ga0207688_100817992 312
174 3300025907 Ga0207645_10011210 Ga0207645_100112103 312
175 3300025909 Ga0207705_10088782 Ga0207705_100887822 312
176 3300025910 Ga0207684_10150838 Ga0207684_101508382 312
177 3300025912 Ga0207707_10001824 Ga0207707_100018243 312
178 3300025917 Ga0207660_10059459 Ga0207660_100594592 312
179 3300025919 Ga0207657_10011878 Ga0207657_100118787 312
180 3300025922 Ga0207646_10000638 Ga0207646_100006382 312
181 3300025922 Ga0207646_10058273 Ga0207646_100582732 312
182 3300025923 Ga0207681_10014620 Ga0207681_100146203 312
183 3300025925 Ga0207650_10047957 Ga0207650_100479572 312
184 3300025926 Ga0207659_10001424 Ga0207659_100014241 312
185 3300025931 Ga0207644_10016882 Ga0207644_100168821 312
186 3300025931 Ga0207644_10054382 Ga0207644_100543821 312
187 3300025932 Ga0207690_10061334 Ga0207690_100613342 312
188 3300025933 Ga0207706_10401576 Ga0207706_104015762 312
189 3300025936 Ga0207670_10005107 Ga0207670_100051077 312
190 3300025936 Ga0207670_10202781 Ga0207670_102027811 312
191 3300025937 Ga0207669_10316761 Ga0207669_103167612 312
192 3300025940 Ga0207691_10030484 Ga0207691_100304843 312
193 3300025940 Ga0207691_10059775 Ga0207691_100597753 312
194 3300025941 Ga0207711_10003376 Ga0207711_100033763 312
195 3300025942 Ga0207689_10191213 Ga0207689_101912132 312
196 3300025945 Ga0207679_10084303 Ga0207679_100843031 312
197 3300025960 Ga0207651_10080701 Ga0207651_100807012 312
198 3300025986 Ga0207658_10017678 Ga0207658_100176782 312
199 3300026023 Ga0207677_10227405 Ga0207677_102274052 312
200 3300026035 Ga0207703_10328599 Ga0207703_103285992 312
201 3300026041 Ga0207639_10246647 Ga0207639_102466472 312
202 3300026075 Ga0207708_10204808 Ga0207708_102048082 312
203 3300026088 Ga0207641_10134789 Ga0207641_101347892 312
204 3300026088 Ga0207641_10441470 Ga0207641_104414701 312
205 3300026095 Ga0207676_10143042 Ga0207676_101430422 312
206 3300026118 Ga0207675_100232667 Ga0207675_1002326672 312
207 3300026121 Ga0207683_10000701 Ga0207683_1000070125 312
208 3300027907 Ga0207428_10003817 Ga0207428_100038174 312
209 3300027907 Ga0207428_10193063 Ga0207428_101930632 312
210 3300028381 Ga0268264_10014021 Ga0268264_100140214 312
211 3300028573 Ga0265334_10000400 Ga0265334_1000040019 312
212 3300028577 Ga0265318_10000006 Ga0265318_10000006127 312
213 3300028800 Ga0265338_10095251 Ga0265338_100952512 312
214 3300031238 Ga0265332_10029372 Ga0265332_100293722 312
215 3300031240 Ga0265320_10004878 Ga0265320_100048789 312
216 3300031250 Ga0265331_10003322 Ga0265331_100033227 312
217 3300031344 Ga0265316_10024761 Ga0265316_100247613 312
218 3300031595 Ga0265313_10003448 Ga0265313_100034487 312
219 3300031711 Ga0265314_10000752 Ga0265314_1000075221 312
220 3300031727 Ga0316576_10062984 Ga0316576_100629843 312
221 3300031731 Ga0307405_10052344 Ga0307405_100523441 312
222 3300031852 Ga0307410_10044698 Ga0307410_100446984 312
223 3300031901 Ga0307406_10134949 Ga0307406_101349492 312
224 3300032002 Ga0307416_100141082 Ga0307416_1001410822 312
225 3300032004 Ga0307414_10197287 Ga0307414_101972872 312
226 3300032004 Ga0307414_10246928 Ga0307414_102469282 312
227 3300032126 Ga0307415_100104454 Ga0307415_1001044543 312
228 3300035691 Ga0373931_0018048 Ga0373931_0018048_2103_3041 312
229 3300035692 Ga0373935_0243933 Ga0373935_0243933_155_1093 312
230 3300035724 Ga0373933_0166846 Ga0373933_0166846_167_1105 312
231 3300036401 Ga0373937_0187160 Ga0373937_0187160_23_961 312
232 3300036647 Ga0316582_0027369 Ga0316582_0027369_1778_2719 312
233 3300036712 Ga0316584_0015700 Ga0316584_0015700_1177_2118 312
234 3300038735 Ga0400485_08379 Ga0400485_08379_3522_4460 312
235 3300038742 Ga0400486_19814 Ga0400486_19814_6151_7089 312
236 3300039062 Ga0400483_022312 Ga0400483_022312_699_1637 312
237 3300039093 Ga0400489_58816 Ga0400489_58816_140_1078 312
238 3300039110 Ga0400487_22986 Ga0400487_22986_358_1296 312
239 3300039453 Ga0436362_0246780 Ga0436362_0246780_271_1209 312
240 3300042876 Ga0451577_0000397 Ga0451577_0000397_37450_38388 312
241 3300042876 Ga0451577_0008011 Ga0451577_0008011_3722_4660 312
242 3300044673 Ga0453683_0037656 Ga0453683_0037656_1257_2195 312
243 3300044712 Ga0453684_0000314 Ga0453684_0000314_19483_20421 312
244 3300044712 Ga0453684_0001252 Ga0453684_0001252_41546_42484 312
245 3300044712 Ga0453684_0005086 Ga0453684_0005086_24410_25348 312
246 3300045051 Ga0451576_0332722 Ga0451576_0332722_60_998 312
247 3300046472 Ga0495580_0220895 Ga0495580_0220895_61_999 312
248 3300048905 Ga0496102_0080216 Ga0496102_0080216_1609_2547 312
249 3300048911 Ga0496108_0471482 Ga0496108_0471482_22_960 312
250 3300048913 Ga0496110_0182641 Ga0496110_0182641_750_1688 312
251 3300048915 Ga0496112_0019440 Ga0496112_0019440_3555_4493 312
252 3300048915 Ga0496112_0135063 Ga0496112_0135063_785_1723 312
253 3300048916 Ga0496113_0393627 Ga0496113_0393627_17_955 312
254 3300049589 Ga0501073_0047531 Ga0501073_0047531_1644_2582 312
255 3300049591 Ga0501075_0195465 Ga0501075_0195465_542_1483 312
256 3300049593 Ga0501077_0012938 Ga0501077_0012938_87_1025 312
257 3300049742 Ga0501080_0332887 Ga0501080_0332887_80_1030 312
258 3300050489 nmdc:mga03683_1_c2 nmdc:mga03683_1_c2_73053_73991 312
259 3300050491 nmdc:mga00v17_28_c1 nmdc:mga00v17_28_c1_31618_32556 312
260 3300050507 nmdc:mga05p37_107349_c1 nmdc:mga05p37_107349_c1_810_1748 312
261 3300050507 nmdc:mga05p37_21058_c1 nmdc:mga05p37_21058_c1_4478_5416 312
262 3300050507 nmdc:mga05p37_3873_c1 nmdc:mga05p37_3873_c1_713_1672 312
263 3300050507 nmdc:mga05p37_67737_c1 nmdc:mga05p37_67737_c1_354_1292 312
264 3300050508 nmdc:mga09592_93646_c1 nmdc:mga09592_93646_c1_1039_1977 312
265 3300050509 nmdc:mga0qj67_217748_c1 nmdc:mga0qj67_217748_c1_258_1196 312
266 3300050510 nmdc:mga06r32_300411_c1 nmdc:mga06r32_300411_c1_74_1018 312
267 3300050510 nmdc:mga06r32_40378_c1 nmdc:mga06r32_40378_c1_439_1377 312
268 3300050511 nmdc:mga08y16_136769_c1 nmdc:mga08y16_136769_c1_547_1485 312
269 3300050512 nmdc:mga0n895_1088_c1 nmdc:mga0n895_1088_c1_10641_11579 312
270 3300050512 nmdc:mga0n895_601529_c1 nmdc:mga0n895_601529_c1_108_1046 312
271 3300050512 nmdc:mga0n895_62110_c1 nmdc:mga0n895_62110_c1_1462_2400 312
272 3300050513 nmdc:mga0rr50_129838_c1 nmdc:mga0rr50_129838_c1_695_1633 312
273 3300050513 nmdc:mga0rr50_52637_c1 nmdc:mga0rr50_52637_c1_739_1677 312
274 3300050515 nmdc:mga0a205_11035_c1 nmdc:mga0a205_11035_c1_1771_2730 312
275 3300050515 nmdc:mga0a205_117514_c1 nmdc:mga0a205_117514_c1_1581_2519 312
276 3300050515 nmdc:mga0a205_1699_c1 nmdc:mga0a205_1699_c1_2860_3798 312
277 3300050515 nmdc:mga0a205_236149_c1 nmdc:mga0a205_236149_c1_259_1197 312
278 3300050515 nmdc:mga0a205_8329_c2 nmdc:mga0a205_8329_c2_874_1812 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

4

201

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

6

234

0.88

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

6

117

0.86

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

7

297

0.79

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

7

185

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vo6-assembly1.cif.gz_C crystal structure of cj1427, an essential nad-dependent dehydrogenase from campylobacter jejuni, in the presence of nadh and gdp 0.9814 4 311
6vo8-assembly1.cif.gz_B-2 x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni 0.9806 4 304
6vo8-assembly1.cif.gz_A-2 x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni 0.9766 4 304
6vo6-assembly1.cif.gz_C crystal structure of cj1427, an essential nad-dependent dehydrogenase from campylobacter jejuni, in the presence of nadh and gdp 0.9716 4 311
6vo8-assembly1.cif.gz_B-2 x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni 0.9709 4 304
ID Description Score Start End Superfamily
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9127 4 107 3.40.50.720
af_Q4CM81_8_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9127 4 107 3.40.50.720
af_Q5QMG5_99_194_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9094 1 96 3.40.50.720
3ru7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8921 2 166 3.40.50.720
af_P72050_1_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8893 4 306 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A554J9M4-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.995 2 117
AF-A0A1F7LPB4-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9906 4 236
AF-Q29VV8-F1-model_v4 Putative nucleotidyl sugar epimerase 0.9869 1 253
AF-A0A554J9M4-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9865 2 117
AF-S0EZ33-F1-model_v4 Nucleoside-diphosphate-sugar epimerases 0.984 1 312

Feature Viewer

pLDDT pTM Quality
92.44 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map