F382478
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 278 | 181 | 277 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10005206|Ga0265314_100052064 |
| Length | 312 |
| Sequence | MSKQRVLVTGGAGYIGSVLVPELLARGFAVTAFDLFTRGDPGLASSCADANFTAVKGDVREESLIKPLMAKHDIIIPLAALVGAPLCKRDPLNAQTVNSDAVRMLVKLASKDQKILYPNTNSGYGIGEKTDFCTEESPLRPLSLYGTSKVEAESSVRAHGGVAFRLATVFGMAPRMRLDLLVNDITWRAVTDRTVVIFEGHFRRNYIHIRDVVKAFLHGIENYGSMGGEAYNLGLSSANLSKLQLCEVIKKHVPQFVYLEAPIGEDPDKRDYIVSNEKLEKAGWKPDWSLDDGIEELLKGYVMLRNSIYGNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 145 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 146 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 147 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 148 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 149 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 150 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 151 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 171 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 172 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.24 |
| Nodule | 0 |
| Rhizoplane | 2.16 |
| Rhizosphere | 92.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10013600 | 3300005290 | Bacteria | 2458 |
| 2 | Ga0065715_10017859 | 3300005293 | Bacteria | 3223 |
| 3 | Ga0065715_10122750 | 3300005293 | Unclassified | 2196 |
| 4 | Ga0070658_10030671 | 3300005327 | Bacteria | 4319 |
| 5 | Ga0070676_10097663 | 3300005328 | Bacteria | 1809 |
| 6 | Ga0070690_100019178 | 3300005330 | Unclassified | 4146 |
| 7 | Ga0070690_100067058 | 3300005330 | Bacteria | 2324 |
| 8 | Ga0070670_100007277 | 3300005331 | Bacteria | 9387 |
| 9 | Ga0070670_100013619 | 3300005331 | Bacteria | 6969 |
| 10 | Ga0070666_10014590 | 3300005335 | Bacteria | 5002 |
| 11 | Ga0070680_100018317 | 3300005336 | Bacteria | 5532 |
| 12 | Ga0070680_100022208 | 3300005336 | Bacteria | 5049 |
| 13 | Ga0068868_100197345 | 3300005338 | Bacteria | 1676 |
| 14 | Ga0068868_100381216 | 3300005338 | Unclassified | 1213 |
| 15 | Ga0070660_100048705 | 3300005339 | Unclassified | 3255 |
| 16 | Ga0070689_100015513 | 3300005340 | Bacteria | 5558 |
| 17 | Ga0070689_100167430 | 3300005340 | Unclassified | 1779 |
| 18 | Ga0070689_100265634 | 3300005340 | Bacteria | 1419 |
| 19 | Ga0070689_100273451 | 3300005340 | Bacteria | 1399 |
| 20 | Ga0070691_10030089 | 3300005341 | Bacteria | 2543 |
| 21 | Ga0070661_100000319 | 3300005344 | Bacteria | 38749 |
| 22 | Ga0070668_100048049 | 3300005347 | Bacteria | 3282 |
| 23 | Ga0070669_100018189 | 3300005353 | Bacteria | 5020 |
| 24 | Ga0070669_100191552 | 3300005353 | Unclassified | 1604 |
| 25 | Ga0070675_100001188 | 3300005354 | Bacteria | 18929 |
| 26 | Ga0070675_100001560 | 3300005354 | Bacteria | 16931 |
| 27 | Ga0070675_100086751 | 3300005354 | Unclassified | 2616 |
| 28 | Ga0070671_100074087 | 3300005355 | Unclassified | 2844 |
| 29 | Ga0070671_100219654 | 3300005355 | Unclassified | 1612 |
| 30 | Ga0070673_100009627 | 3300005364 | Bacteria | 6497 |
| 31 | Ga0070688_100147719 | 3300005365 | Unclassified | 1604 |
| 32 | Ga0070667_100008745 | 3300005367 | Bacteria | 8391 |
| 33 | Ga0070709_10000002 | 3300005434 | Bacteria | 322903 |
| 34 | Ga0070709_10108879 | 3300005434 | Bacteria | 1859 |
| 35 | Ga0070711_100000174 | 3300005439 | Bacteria | 34321 |
| 36 | Ga0070705_100008664 | 3300005440 | Bacteria | 5038 |
| 37 | Ga0070700_100160439 | 3300005441 | Unclassified | 1547 |
| 38 | Ga0070708_100250243 | 3300005445 | Bacteria | 1665 |
| 39 | Ga0070662_100120586 | 3300005457 | Unclassified | 2009 |
| 40 | Ga0070662_100314843 | 3300005457 | Unclassified | 1275 |
| 41 | Ga0070681_10002540 | 3300005458 | Bacteria | 16740 |
| 42 | Ga0070681_10062869 | 3300005458 | Unclassified | 3685 |
| 43 | Ga0070681_10250934 | 3300005458 | Bacteria | 1682 |
| 44 | Ga0070681_10490597 | 3300005458 | Unclassified | 1141 |
| 45 | Ga0070707_100000246 | 3300005468 | Bacteria | 54176 |
| 46 | Ga0070707_100056672 | 3300005468 | Bacteria | 3759 |
| 47 | Ga0070698_100207374 | 3300005471 | Bacteria | 1895 |
| 48 | Ga0070698_100329389 | 3300005471 | Unclassified | 1458 |
| 49 | Ga0070699_100017883 | 3300005518 | Bacteria | 6087 |
| 50 | Ga0070699_100144864 | 3300005518 | Bacteria | 2099 |
| 51 | Ga0070679_100282198 | 3300005530 | Unclassified | 1613 |
| 52 | Ga0068853_100173185 | 3300005539 | Unclassified | 1953 |
| 53 | Ga0070672_100003701 | 3300005543 | Bacteria | 9945 |
| 54 | Ga0070686_100051289 | 3300005544 | Bacteria | 2626 |
| 55 | Ga0070686_100084594 | 3300005544 | Unclassified | 2108 |
| 56 | Ga0070686_100231007 | 3300005544 | Unclassified | 1342 |
| 57 | Ga0070695_100119419 | 3300005545 | Bacteria | 1801 |
| 58 | Ga0070696_100032592 | 3300005546 | Bacteria | 3575 |
| 59 | Ga0070704_100065220 | 3300005549 | Unclassified | 2621 |
| 60 | Ga0068855_100084307 | 3300005563 | Bacteria | 3680 |
| 61 | Ga0068855_100106109 | 3300005563 | Bacteria | 3229 |
| 62 | Ga0070664_100068895 | 3300005564 | Unclassified | 3025 |
| 63 | Ga0070664_100090464 | 3300005564 | Unclassified | 2649 |
| 64 | Ga0070664_100232601 | 3300005564 | Unclassified | 1652 |
| 65 | Ga0068857_100160399 | 3300005577 | Bacteria | 2040 |
| 66 | Ga0068859_100018999 | 3300005617 | Bacteria | 6902 |
| 67 | Ga0068864_100051940 | 3300005618 | Unclassified | 3532 |
| 68 | Ga0068866_10046285 | 3300005718 | Unclassified | 2187 |
| 69 | Ga0068863_100004027 | 3300005841 | Bacteria | 14512 |
| 70 | Ga0068863_100484224 | 3300005841 | Unclassified | 1217 |
| 71 | Ga0068858_100197473 | 3300005842 | Unclassified | 1902 |
| 72 | Ga0068860_100004987 | 3300005843 | Bacteria | 13525 |
| 73 | Ga0081539_10000082 | 3300005985 | Bacteria | 219763 |
| 74 | Ga0075364_10232776 | 3300006051 | Bacteria | 1251 |
| 75 | Ga0075432_10033305 | 3300006058 | Bacteria | 1787 |
| 76 | Ga0070715_10001782 | 3300006163 | Bacteria | 6411 |
| 77 | Ga0070716_100005254 | 3300006173 | Bacteria | 6259 |
| 78 | Ga0070712_100000320 | 3300006175 | Bacteria | 27117 |
| 79 | Ga0075362_10000013 | 3300006177 | Bacteria | 99793 |
| 80 | Ga0075367_10026507 | 3300006178 | Bacteria | 3288 |
| 81 | Ga0075367_10056077 | 3300006178 | Bacteria | 2340 |
| 82 | Ga0097621_100221634 | 3300006237 | Bacteria | 1648 |
| 83 | Ga0075370_10110830 | 3300006353 | Unclassified | 1594 |
| 84 | Ga0068871_100019536 | 3300006358 | Bacteria | 5174 |
| 85 | Ga0075428_100132798 | 3300006844 | Unclassified | 2707 |
| 86 | Ga0075428_100264574 | 3300006844 | Unclassified | 1851 |
| 87 | Ga0075428_100333156 | 3300006844 | Bacteria | 1630 |
| 88 | Ga0075430_100097195 | 3300006846 | Unclassified | 2460 |
| 89 | Ga0075430_100109392 | 3300006846 | Unclassified | 2305 |
| 90 | Ga0075431_100093188 | 3300006847 | Bacteria | 3109 |
| 91 | Ga0075431_100114550 | 3300006847 | Bacteria | 2783 |
| 92 | Ga0075431_100139234 | 3300006847 | Bacteria | 2502 |
| 93 | Ga0075431_100169630 | 3300006847 | Bacteria | 2243 |
| 94 | Ga0075431_100260293 | 3300006847 | Unclassified | 1761 |
| 95 | Ga0075433_10025006 | 3300006852 | Bacteria | 5046 |
| 96 | Ga0075433_10034551 | 3300006852 | Bacteria | 4343 |
| 97 | Ga0075433_10073390 | 3300006852 | Unclassified | 3009 |
| 98 | Ga0075433_10091018 | 3300006852 | Bacteria | 2696 |
| 99 | Ga0075433_10096620 | 3300006852 | Bacteria | 2615 |
| 100 | Ga0075434_100011497 | 3300006871 | Bacteria | 8352 |
| 101 | Ga0075434_100012881 | 3300006871 | Bacteria | 7943 |
| 102 | Ga0075434_100026614 | 3300006871 | Bacteria | 5668 |
| 103 | Ga0075429_100001635 | 3300006880 | Bacteria | 18519 |
| 104 | Ga0075429_100052724 | 3300006880 | Bacteria | 3539 |
| 105 | Ga0097620_100018999 | 3300006931 | Bacteria | 6902 |
| 106 | Ga0075435_100028180 | 3300007076 | Bacteria | 4403 |
| 107 | Ga0075435_100125752 | 3300007076 | Bacteria | 2143 |
| 108 | Ga0075435_100157537 | 3300007076 | Unclassified | 1911 |
| 109 | Ga0111539_10049478 | 3300009094 | Bacteria | 5011 |
| 110 | Ga0111539_10090919 | 3300009094 | Unclassified | 3587 |
| 111 | Ga0111539_10101634 | 3300009094 | Bacteria | 3375 |
| 112 | Ga0111539_10185906 | 3300009094 | Unclassified | 2426 |
| 113 | Ga0111539_10393726 | 3300009094 | Unclassified | 1614 |
| 114 | Ga0105247_10028340 | 3300009101 | Unclassified | 3388 |
| 115 | Ga0114129_10000678 | 3300009147 | Bacteria | 42896 |
| 116 | Ga0114129_10001384 | 3300009147 | Bacteria | 32641 |
| 117 | Ga0114129_10019981 | 3300009147 | Bacteria | 9534 |
| 118 | Ga0114129_10051510 | 3300009147 | Bacteria | 5779 |
| 119 | Ga0114129_10070342 | 3300009147 | Bacteria | 4879 |
| 120 | Ga0114129_10105504 | 3300009147 | Bacteria | 3894 |
| 121 | Ga0114129_10121804 | 3300009147 | Bacteria | 3589 |
| 122 | Ga0114129_10464932 | 3300009147 | Bacteria | 1657 |
| 123 | Ga0114129_10709400 | 3300009147 | Unclassified | 1292 |
| 124 | Ga0105241_10034576 | 3300009174 | Bacteria | 3798 |
| 125 | Ga0105242_10086239 | 3300009176 | Unclassified | 2634 |
| 126 | Ga0105248_10000716 | 3300009177 | Bacteria | 37542 |
| 127 | Ga0105239_10073872 | 3300010375 | Unclassified | 3749 |
| 128 | Ga0157374_10032385 | 3300013296 | Bacteria | 4759 |
| 129 | Ga0157374_10038100 | 3300013296 | Unclassified | 4418 |
| 130 | Ga0163162_10001473 | 3300013306 | Bacteria | 21902 |
| 131 | Ga0163162_10032693 | 3300013306 | Bacteria | 5167 |
| 132 | Ga0163162_10042459 | 3300013306 | Bacteria | 4551 |
| 133 | Ga0157372_10057102 | 3300013307 | Bacteria | 4363 |
| 134 | Ga0157375_10032215 | 3300013308 | Unclassified | 4969 |
| 135 | Ga0157375_10129754 | 3300013308 | Unclassified | 2639 |
| 136 | Ga0163163_10010069 | 3300014325 | Bacteria | 8482 |
| 137 | Ga0163163_10274066 | 3300014325 | Bacteria | 1738 |
| 138 | Ga0157379_10002880 | 3300014968 | Bacteria | 14504 |
| 139 | Ga0157379_10597641 | 3300014968 | Bacteria | 1030 |
| 140 | Ga0163161_10007192 | 3300017792 | Bacteria | 7692 |
| 141 | Ga0163161_10030077 | 3300017792 | Unclassified | 3863 |
| 142 | Ga0207642_10050200 | 3300025899 | Bacteria | 1880 |
| 143 | Ga0207710_10111185 | 3300025900 | Unclassified | 1301 |
| 144 | Ga0207688_10081799 | 3300025901 | Bacteria | 1845 |
| 145 | Ga0207685_10000927 | 3300025905 | Bacteria | 5601 |
| 146 | Ga0207699_10000001 | 3300025906 | Bacteria | 695560 |
| 147 | Ga0207645_10011210 | 3300025907 | Bacteria | 6131 |
| 148 | Ga0207705_10088782 | 3300025909 | Bacteria | 2262 |
| 149 | Ga0207684_10150838 | 3300025910 | Bacteria | 2000 |
| 150 | Ga0207707_10001824 | 3300025912 | Bacteria | 19527 |
| 151 | Ga0207695_10015235 | 3300025913 | Bacteria | 9064 |
| 152 | Ga0207693_10004649 | 3300025915 | Bacteria | 11582 |
| 153 | Ga0207663_10001140 | 3300025916 | Bacteria | 12243 |
| 154 | Ga0207660_10059459 | 3300025917 | Bacteria | 2744 |
| 155 | Ga0207657_10011878 | 3300025919 | Bacteria | 8620 |
| 156 | Ga0207649_10000073 | 3300025920 | Bacteria | 86636 |
| 157 | Ga0207646_10000638 | 3300025922 | Bacteria | 45629 |
| 158 | Ga0207646_10058273 | 3300025922 | Bacteria | 3449 |
| 159 | Ga0207681_10014620 | 3300025923 | Unclassified | 4884 |
| 160 | Ga0207650_10047957 | 3300025925 | Unclassified | 3149 |
| 161 | Ga0207659_10001424 | 3300025926 | Bacteria | 14248 |
| 162 | Ga0207644_10016882 | 3300025931 | Bacteria | 4918 |
| 163 | Ga0207644_10054382 | 3300025931 | Unclassified | 2883 |
| 164 | Ga0207690_10061334 | 3300025932 | Unclassified | 2556 |
| 165 | Ga0207706_10401576 | 3300025933 | Unclassified | 1188 |
| 166 | Ga0207670_10005107 | 3300025936 | Bacteria | 7166 |
| 167 | Ga0207670_10202781 | 3300025936 | Bacteria | 1508 |
| 168 | Ga0207669_10316761 | 3300025937 | Unclassified | 1192 |
| 169 | Ga0207665_10009909 | 3300025939 | Bacteria | 6253 |
| 170 | Ga0207691_10030484 | 3300025940 | Bacteria | 5040 |
| 171 | Ga0207691_10059775 | 3300025940 | Unclassified | 3464 |
| 172 | Ga0207711_10003376 | 3300025941 | Bacteria | 13832 |
| 173 | Ga0207689_10191213 | 3300025942 | Bacteria | 1689 |
| 174 | Ga0207679_10084303 | 3300025945 | Unclassified | 2438 |
| 175 | Ga0207651_10080701 | 3300025960 | Unclassified | 2342 |
| 176 | Ga0207658_10017678 | 3300025986 | Unclassified | 4917 |
| 177 | Ga0207677_10227405 | 3300026023 | Bacteria | 1500 |
| 178 | Ga0207703_10328599 | 3300026035 | Unclassified | 1402 |
| 179 | Ga0207639_10246647 | 3300026041 | Unclassified | 1556 |
| 180 | Ga0207708_10204808 | 3300026075 | Unclassified | 1575 |
| 181 | Ga0207641_10134789 | 3300026088 | Unclassified | 2221 |
| 182 | Ga0207641_10441470 | 3300026088 | Unclassified | 1256 |
| 183 | Ga0207676_10143042 | 3300026095 | Bacteria | 2050 |
| 184 | Ga0207675_100232667 | 3300026118 | Bacteria | 1778 |
| 185 | Ga0207683_10000701 | 3300026121 | Bacteria | 30621 |
| 186 | Ga0209813_10035593 | 3300027866 | Bacteria | 1492 |
| 187 | Ga0207428_10003817 | 3300027907 | Bacteria | 14447 |
| 188 | Ga0207428_10193063 | 3300027907 | Bacteria | 1534 |
| 189 | Ga0268264_10014021 | 3300028381 | Bacteria | 6590 |
| 190 | Ga0265334_10000400 | 3300028573 | Bacteria | 22836 |
| 191 | Ga0265318_10000006 | 3300028577 | Bacteria | 285591 |
| 192 | Ga0265338_10095251 | 3300028800 | Bacteria | 2446 |
| 193 | Ga0265332_10029372 | 3300031238 | Bacteria | 2404 |
| 194 | Ga0265320_10004878 | 3300031240 | Bacteria | 8706 |
| 195 | Ga0265331_10003322 | 3300031250 | Bacteria | 10449 |
| 196 | Ga0265316_10024761 | 3300031344 | Bacteria | 5018 |
| 197 | Ga0265313_10003448 | 3300031595 | Bacteria | 12794 |
| 198 | Ga0265314_10000752 | 3300031711 | Bacteria | 38798 |
| 199 | Ga0265314_10002363 | 3300031711 | Bacteria | 19458 |
| 200 | Ga0265314_10005206 | 3300031711 | Bacteria | 11811 |
| 201 | Ga0316576_10062984 | 3300031727 | Bacteria | 2721 |
| 202 | Ga0307405_10052344 | 3300031731 | Bacteria | 2538 |
| 203 | Ga0307410_10044698 | 3300031852 | Bacteria | 2944 |
| 204 | Ga0307406_10134949 | 3300031901 | Bacteria | 1738 |
| 205 | Ga0307416_100141082 | 3300032002 | Bacteria | 2190 |
| 206 | Ga0307414_10197287 | 3300032004 | Bacteria | 1634 |
| 207 | Ga0307414_10246928 | 3300032004 | Unclassified | 1481 |
| 208 | Ga0307415_100104454 | 3300032126 | Bacteria | 2087 |
| 209 | Ga0373940_0041197 | 3300035088 | Bacteria | 1270 |
| 210 | Ga0373931_0018048 | 3300035691 | Bacteria | 3502 |
| 211 | Ga0373935_0243933 | 3300035692 | Bacteria | 1255 |
| 212 | Ga0373933_0166846 | 3300035724 | Bacteria | 1400 |
| 213 | Ga0373937_0187160 | 3300036401 | Bacteria | 1945 |
| 214 | Ga0316582_0027369 | 3300036647 | Bacteria | 3442 |
| 215 | Ga0316584_0015700 | 3300036712 | Bacteria | 5420 |
| 216 | Ga0400485_08379 | 3300038735 | Bacteria | 31740 |
| 217 | Ga0400486_19814 | 3300038742 | Bacteria | 7556 |
| 218 | Ga0400483_022312 | 3300039062 | Bacteria | 1817 |
| 219 | Ga0400489_58816 | 3300039093 | Bacteria | 1219 |
| 220 | Ga0400487_22986 | 3300039110 | Unclassified | 1408 |
| 221 | Ga0436362_0246780 | 3300039453 | Bacteria | 1419 |
| 222 | Ga0451577_0000397 | 3300042876 | Bacteria | 79933 |
| 223 | Ga0451577_0001910 | 3300042876 | Bacteria | 26415 |
| 224 | Ga0451577_0008011 | 3300042876 | Bacteria | 10314 |
| 225 | Ga0453683_0037656 | 3300044673 | Bacteria | 3042 |
| 226 | Ga0453684_0000229 | 3300044712 | Bacteria | 241494 |
| 227 | Ga0453684_0000314 | 3300044712 | Bacteria | 205428 |
| 228 | Ga0453684_0001252 | 3300044712 | Bacteria | 76808 |
| 229 | Ga0453684_0005086 | 3300044712 | Bacteria | 26546 |
| 230 | Ga0453684_0054516 | 3300044712 | Bacteria | 5207 |
| 231 | Ga0451576_0000451 | 3300045051 | Bacteria | 93335 |
| 232 | Ga0451576_0332722 | 3300045051 | Unclassified | 1589 |
| 233 | Ga0495580_0220895 | 3300046472 | Bacteria | 1302 |
| 234 | Ga0495643_0001847 | 3300046522 | Bacteria | 17988 |
| 235 | Ga0495587_0224786 | 3300046536 | Bacteria | 1058 |
| 236 | Ga0495658_0109250 | 3300046683 | Bacteria | 1661 |
| 237 | Ga0495674_0056699 | 3300047319 | Unclassified | 3430 |
| 238 | Ga0496102_0080216 | 3300048905 | Unclassified | 3006 |
| 239 | Ga0496108_0471482 | 3300048911 | Unclassified | 1097 |
| 240 | Ga0496110_0182641 | 3300048913 | Unclassified | 1905 |
| 241 | Ga0496112_0019440 | 3300048915 | Bacteria | 6412 |
| 242 | Ga0496112_0135063 | 3300048915 | Unclassified | 2437 |
| 243 | Ga0496113_0393627 | 3300048916 | Bacteria | 1112 |
| 244 | Ga0501073_0047531 | 3300049589 | Bacteria | 3016 |
| 245 | Ga0501075_0195465 | 3300049591 | Bacteria | 1543 |
| 246 | Ga0501077_0012938 | 3300049593 | Bacteria | 5228 |
| 247 | Ga0501080_0332887 | 3300049742 | Bacteria | 1373 |
| 248 | nmdc:mga03683_1_c2 | 3300050489 | Bacteria | 239664 |
| 249 | nmdc:mga00v17_28_c1 | 3300050491 | Bacteria | 41836 |
| 250 | nmdc:mga06z11_6471_c1 | 3300050494 | Bacteria | 2848 |
| 251 | nmdc:mga05p37_107349_c1 | 3300050507 | Bacteria | 3435 |
| 252 | nmdc:mga05p37_21058_c1 | 3300050507 | Bacteria | 7892 |
| 253 | nmdc:mga05p37_231_c1 | 3300050507 | Bacteria | 56731 |
| 254 | nmdc:mga05p37_3873_c1 | 3300050507 | Bacteria | 17503 |
| 255 | nmdc:mga05p37_496461_c1 | 3300050507 | Bacteria | 1402 |
| 256 | nmdc:mga05p37_67737_c1 | 3300050507 | Bacteria | 4392 |
| 257 | nmdc:mga09592_1306_c1 | 3300050508 | Bacteria | 20044 |
| 258 | nmdc:mga09592_93646_c1 | 3300050508 | Bacteria | 2569 |
| 259 | nmdc:mga0qj67_217748_c1 | 3300050509 | Unclassified | 1550 |
| 260 | nmdc:mga0qj67_88155_c1 | 3300050509 | Bacteria | 2491 |
| 261 | nmdc:mga06r32_300411_c1 | 3300050510 | Bacteria | 1591 |
| 262 | nmdc:mga06r32_40378_c1 | 3300050510 | Bacteria | 4429 |
| 263 | nmdc:mga06r32_89847_c1 | 3300050510 | Bacteria | 3000 |
| 264 | nmdc:mga08y16_136769_c1 | 3300050511 | Bacteria | 2547 |
| 265 | nmdc:mga0n895_1088_c1 | 3300050512 | Bacteria | 19874 |
| 266 | nmdc:mga0n895_601529_c1 | 3300050512 | Bacteria | 1102 |
| 267 | nmdc:mga0n895_62110_c1 | 3300050512 | Unclassified | 3691 |
| 268 | nmdc:mga0rr50_129838_c1 | 3300050513 | Bacteria | 2016 |
| 269 | nmdc:mga0rr50_52637_c1 | 3300050513 | Bacteria | 3026 |
| 270 | nmdc:mga0a205_11035_c1 | 3300050515 | Bacteria | 8315 |
| 271 | nmdc:mga0a205_115166_c1 | 3300050515 | Bacteria | 2587 |
| 272 | nmdc:mga0a205_117514_c1 | 3300050515 | Archaea | 2557 |
| 273 | nmdc:mga0a205_1699_c1 | 3300050515 | Bacteria | 19005 |
| 274 | nmdc:mga0a205_236149_c1 | 3300050515 | Unclassified | 1710 |
| 275 | nmdc:mga0a205_42099_c1 | 3300050515 | Bacteria | 4400 |
| 276 | nmdc:mga0a205_8329_c2 | 3300050515 | Bacteria | 2697 |
| 277 | Ga0495601_0208520 | 3300053077 | Bacteria | 1277 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046536 | Ga0495587_0224786 | Ga0495587_0224786_106_960 | 284 |
| 2 | 3300047319 | Ga0495674_0056699 | Ga0495674_0056699_1839_2693 | 284 |
| 3 | 3300009147 | Ga0114129_10105504 | Ga0114129_101055043 | 288 |
| 4 | 3300035088 | Ga0373940_0041197 | Ga0373940_0041197_255_1178 | 307 |
| 5 | 3300050515 | nmdc:mga0a205_115166_c1 | nmdc:mga0a205_115166_c1_233_1156 | 307 |
| 6 | 3300009147 | Ga0114129_10464932 | Ga0114129_104649322 | 308 |
| 7 | 3300046522 | Ga0495643_0001847 | Ga0495643_0001847_11313_12239 | 308 |
| 8 | 3300050507 | nmdc:mga05p37_496461_c1 | nmdc:mga05p37_496461_c1_429_1355 | 308 |
| 9 | 3300050515 | nmdc:mga0a205_42099_c1 | nmdc:mga0a205_42099_c1_229_1155 | 308 |
| 10 | iso_pu_bacteria | 2671180531 | 2673164286 | 308 |
| 11 | 3300005434 | Ga0070709_10108879 | Ga0070709_101088792 | 310 |
| 12 | 3300005439 | Ga0070711_100000174 | Ga0070711_10000017421 | 310 |
| 13 | 3300005458 | Ga0070681_10490597 | Ga0070681_104905971 | 310 |
| 14 | 3300006051 | Ga0075364_10232776 | Ga0075364_102327761 | 310 |
| 15 | 3300006163 | Ga0070715_10001782 | Ga0070715_100017824 | 310 |
| 16 | 3300006173 | Ga0070716_100005254 | Ga0070716_1000052543 | 310 |
| 17 | 3300006175 | Ga0070712_100000320 | Ga0070712_10000032021 | 310 |
| 18 | 3300006178 | Ga0075367_10026507 | Ga0075367_100265073 | 310 |
| 19 | 3300006844 | Ga0075428_100333156 | Ga0075428_1003331561 | 310 |
| 20 | 3300006847 | Ga0075431_100114550 | Ga0075431_1001145502 | 310 |
| 21 | 3300006880 | Ga0075429_100001635 | Ga0075429_1000016352 | 310 |
| 22 | 3300009147 | Ga0114129_10001384 | Ga0114129_1000138415 | 310 |
| 23 | 3300025905 | Ga0207685_10000927 | Ga0207685_100009274 | 310 |
| 24 | 3300025913 | Ga0207695_10015235 | Ga0207695_1001523514 | 310 |
| 25 | 3300025915 | Ga0207693_10004649 | Ga0207693_100046496 | 310 |
| 26 | 3300025916 | Ga0207663_10001140 | Ga0207663_100011402 | 310 |
| 27 | 3300025939 | Ga0207665_10009909 | Ga0207665_100099095 | 310 |
| 28 | 3300027866 | Ga0209813_10035593 | Ga0209813_100355932 | 310 |
| 29 | 3300031711 | Ga0265314_10002363 | Ga0265314_1000236317 | 310 |
| 30 | 3300046683 | Ga0495658_0109250 | Ga0495658_0109250_35_967 | 310 |
| 31 | 3300050494 | nmdc:mga06z11_6471_c1 | nmdc:mga06z11_6471_c1_777_1709 | 310 |
| 32 | 3300050507 | nmdc:mga05p37_231_c1 | nmdc:mga05p37_231_c1_43925_44857 | 310 |
| 33 | 3300050508 | nmdc:mga09592_1306_c1 | nmdc:mga09592_1306_c1_1811_2743 | 310 |
| 34 | 3300050509 | nmdc:mga0qj67_88155_c1 | nmdc:mga0qj67_88155_c1_727_1659 | 310 |
| 35 | 3300050510 | nmdc:mga06r32_89847_c1 | nmdc:mga06r32_89847_c1_497_1429 | 310 |
| 36 | 3300053077 | Ga0495601_0208520 | Ga0495601_0208520_256_1188 | 310 |
| 37 | 3300005344 | Ga0070661_100000319 | Ga0070661_10000031912 | 311 |
| 38 | 3300005434 | Ga0070709_10000002 | Ga0070709_10000002124 | 311 |
| 39 | 3300005563 | Ga0068855_100084307 | Ga0068855_1000843073 | 311 |
| 40 | 3300025906 | Ga0207699_10000001 | Ga0207699_10000001135 | 311 |
| 41 | 3300025920 | Ga0207649_10000073 | Ga0207649_1000007329 | 311 |
| 42 | 3300031711 | Ga0265314_10005206 | Ga0265314_100052064 | 311 |
| 43 | 3300042876 | Ga0451577_0001910 | Ga0451577_0001910_16697_17632 | 311 |
| 44 | 3300044712 | Ga0453684_0000229 | Ga0453684_0000229_224358_225293 | 311 |
| 45 | 3300044712 | Ga0453684_0054516 | Ga0453684_0054516_520_1455 | 311 |
| 46 | 3300045051 | Ga0451576_0000451 | Ga0451576_0000451_18859_19794 | 311 |
| 47 | 3300005290 | Ga0065712_10013600 | Ga0065712_100136001 | 312 |
| 48 | 3300005293 | Ga0065715_10017859 | Ga0065715_100178593 | 312 |
| 49 | 3300005293 | Ga0065715_10122750 | Ga0065715_101227502 | 312 |
| 50 | 3300005327 | Ga0070658_10030671 | Ga0070658_100306713 | 312 |
| 51 | 3300005328 | Ga0070676_10097663 | Ga0070676_100976632 | 312 |
| 52 | 3300005330 | Ga0070690_100019178 | Ga0070690_1000191782 | 312 |
| 53 | 3300005330 | Ga0070690_100067058 | Ga0070690_1000670582 | 312 |
| 54 | 3300005331 | Ga0070670_100007277 | Ga0070670_1000072778 | 312 |
| 55 | 3300005331 | Ga0070670_100013619 | Ga0070670_1000136193 | 312 |
| 56 | 3300005335 | Ga0070666_10014590 | Ga0070666_100145902 | 312 |
| 57 | 3300005336 | Ga0070680_100018317 | Ga0070680_1000183173 | 312 |
| 58 | 3300005336 | Ga0070680_100022208 | Ga0070680_1000222082 | 312 |
| 59 | 3300005338 | Ga0068868_100197345 | Ga0068868_1001973452 | 312 |
| 60 | 3300005338 | Ga0068868_100381216 | Ga0068868_1003812161 | 312 |
| 61 | 3300005339 | Ga0070660_100048705 | Ga0070660_1000487052 | 312 |
| 62 | 3300005340 | Ga0070689_100015513 | Ga0070689_1000155135 | 312 |
| 63 | 3300005340 | Ga0070689_100167430 | Ga0070689_1001674302 | 312 |
| 64 | 3300005340 | Ga0070689_100265634 | Ga0070689_1002656342 | 312 |
| 65 | 3300005340 | Ga0070689_100273451 | Ga0070689_1002734511 | 312 |
| 66 | 3300005341 | Ga0070691_10030089 | Ga0070691_100300892 | 312 |
| 67 | 3300005347 | Ga0070668_100048049 | Ga0070668_1000480492 | 312 |
| 68 | 3300005353 | Ga0070669_100018189 | Ga0070669_1000181894 | 312 |
| 69 | 3300005353 | Ga0070669_100191552 | Ga0070669_1001915521 | 312 |
| 70 | 3300005354 | Ga0070675_100001188 | Ga0070675_10000118813 | 312 |
| 71 | 3300005354 | Ga0070675_100001560 | Ga0070675_1000015604 | 312 |
| 72 | 3300005354 | Ga0070675_100086751 | Ga0070675_1000867512 | 312 |
| 73 | 3300005355 | Ga0070671_100074087 | Ga0070671_1000740873 | 312 |
| 74 | 3300005355 | Ga0070671_100219654 | Ga0070671_1002196542 | 312 |
| 75 | 3300005364 | Ga0070673_100009627 | Ga0070673_1000096275 | 312 |
| 76 | 3300005365 | Ga0070688_100147719 | Ga0070688_1001477192 | 312 |
| 77 | 3300005367 | Ga0070667_100008745 | Ga0070667_1000087456 | 312 |
| 78 | 3300005440 | Ga0070705_100008664 | Ga0070705_1000086643 | 312 |
| 79 | 3300005441 | Ga0070700_100160439 | Ga0070700_1001604392 | 312 |
| 80 | 3300005445 | Ga0070708_100250243 | Ga0070708_1002502432 | 312 |
| 81 | 3300005457 | Ga0070662_100120586 | Ga0070662_1001205862 | 312 |
| 82 | 3300005457 | Ga0070662_100314843 | Ga0070662_1003148431 | 312 |
| 83 | 3300005458 | Ga0070681_10002540 | Ga0070681_1000254013 | 312 |
| 84 | 3300005458 | Ga0070681_10062869 | Ga0070681_100628693 | 312 |
| 85 | 3300005458 | Ga0070681_10250934 | Ga0070681_102509341 | 312 |
| 86 | 3300005468 | Ga0070707_100000246 | Ga0070707_10000024657 | 312 |
| 87 | 3300005468 | Ga0070707_100056672 | Ga0070707_1000566724 | 312 |
| 88 | 3300005471 | Ga0070698_100207374 | Ga0070698_1002073742 | 312 |
| 89 | 3300005471 | Ga0070698_100329389 | Ga0070698_1003293892 | 312 |
| 90 | 3300005518 | Ga0070699_100017883 | Ga0070699_1000178835 | 312 |
| 91 | 3300005518 | Ga0070699_100144864 | Ga0070699_1001448641 | 312 |
| 92 | 3300005530 | Ga0070679_100282198 | Ga0070679_1002821982 | 312 |
| 93 | 3300005539 | Ga0068853_100173185 | Ga0068853_1001731852 | 312 |
| 94 | 3300005543 | Ga0070672_100003701 | Ga0070672_1000037018 | 312 |
| 95 | 3300005544 | Ga0070686_100051289 | Ga0070686_1000512892 | 312 |
| 96 | 3300005544 | Ga0070686_100084594 | Ga0070686_1000845942 | 312 |
| 97 | 3300005544 | Ga0070686_100231007 | Ga0070686_1002310071 | 312 |
| 98 | 3300005545 | Ga0070695_100119419 | Ga0070695_1001194192 | 312 |
| 99 | 3300005546 | Ga0070696_100032592 | Ga0070696_1000325924 | 312 |
| 100 | 3300005549 | Ga0070704_100065220 | Ga0070704_1000652202 | 312 |
| 101 | 3300005563 | Ga0068855_100106109 | Ga0068855_1001061092 | 312 |
| 102 | 3300005564 | Ga0070664_100068895 | Ga0070664_1000688953 | 312 |
| 103 | 3300005564 | Ga0070664_100090464 | Ga0070664_1000904642 | 312 |
| 104 | 3300005564 | Ga0070664_100232601 | Ga0070664_1002326012 | 312 |
| 105 | 3300005577 | Ga0068857_100160399 | Ga0068857_1001603992 | 312 |
| 106 | 3300005617 | Ga0068859_100018999 | Ga0068859_1000189993 | 312 |
| 107 | 3300005618 | Ga0068864_100051940 | Ga0068864_1000519402 | 312 |
| 108 | 3300005718 | Ga0068866_10046285 | Ga0068866_100462852 | 312 |
| 109 | 3300005841 | Ga0068863_100004027 | Ga0068863_1000040272 | 312 |
| 110 | 3300005841 | Ga0068863_100484224 | Ga0068863_1004842242 | 312 |
| 111 | 3300005842 | Ga0068858_100197473 | Ga0068858_1001974732 | 312 |
| 112 | 3300005843 | Ga0068860_100004987 | Ga0068860_1000049875 | 312 |
| 113 | 3300005985 | Ga0081539_10000082 | Ga0081539_10000082118 | 312 |
| 114 | 3300006058 | Ga0075432_10033305 | Ga0075432_100333052 | 312 |
| 115 | 3300006177 | Ga0075362_10000013 | Ga0075362_1000001333 | 312 |
| 116 | 3300006178 | Ga0075367_10056077 | Ga0075367_100560771 | 312 |
| 117 | 3300006237 | Ga0097621_100221634 | Ga0097621_1002216342 | 312 |
| 118 | 3300006353 | Ga0075370_10110830 | Ga0075370_101108302 | 312 |
| 119 | 3300006358 | Ga0068871_100019536 | Ga0068871_1000195363 | 312 |
| 120 | 3300006844 | Ga0075428_100132798 | Ga0075428_1001327983 | 312 |
| 121 | 3300006844 | Ga0075428_100264574 | Ga0075428_1002645742 | 312 |
| 122 | 3300006846 | Ga0075430_100097195 | Ga0075430_1000971952 | 312 |
| 123 | 3300006846 | Ga0075430_100109392 | Ga0075430_1001093922 | 312 |
| 124 | 3300006847 | Ga0075431_100093188 | Ga0075431_1000931884 | 312 |
| 125 | 3300006847 | Ga0075431_100139234 | Ga0075431_1001392342 | 312 |
| 126 | 3300006847 | Ga0075431_100169630 | Ga0075431_1001696302 | 312 |
| 127 | 3300006847 | Ga0075431_100260293 | Ga0075431_1002602932 | 312 |
| 128 | 3300006852 | Ga0075433_10025006 | Ga0075433_100250065 | 312 |
| 129 | 3300006852 | Ga0075433_10034551 | Ga0075433_100345512 | 312 |
| 130 | 3300006852 | Ga0075433_10073390 | Ga0075433_100733903 | 312 |
| 131 | 3300006852 | Ga0075433_10091018 | Ga0075433_100910183 | 312 |
| 132 | 3300006852 | Ga0075433_10096620 | Ga0075433_100966202 | 312 |
| 133 | 3300006871 | Ga0075434_100011497 | Ga0075434_1000114972 | 312 |
| 134 | 3300006871 | Ga0075434_100012881 | Ga0075434_1000128815 | 312 |
| 135 | 3300006871 | Ga0075434_100026614 | Ga0075434_1000266142 | 312 |
| 136 | 3300006880 | Ga0075429_100052724 | Ga0075429_1000527242 | 312 |
| 137 | 3300006931 | Ga0097620_100018999 | Ga0097620_1000189995 | 312 |
| 138 | 3300007076 | Ga0075435_100028180 | Ga0075435_1000281803 | 312 |
| 139 | 3300007076 | Ga0075435_100125752 | Ga0075435_1001257522 | 312 |
| 140 | 3300007076 | Ga0075435_100157537 | Ga0075435_1001575372 | 312 |
| 141 | 3300009094 | Ga0111539_10049478 | Ga0111539_100494783 | 312 |
| 142 | 3300009094 | Ga0111539_10090919 | Ga0111539_100909193 | 312 |
| 143 | 3300009094 | Ga0111539_10101634 | Ga0111539_101016343 | 312 |
| 144 | 3300009094 | Ga0111539_10185906 | Ga0111539_101859062 | 312 |
| 145 | 3300009094 | Ga0111539_10393726 | Ga0111539_103937262 | 312 |
| 146 | 3300009101 | Ga0105247_10028340 | Ga0105247_100283402 | 312 |
| 147 | 3300009147 | Ga0114129_10000678 | Ga0114129_1000067815 | 312 |
| 148 | 3300009147 | Ga0114129_10019981 | Ga0114129_100199818 | 312 |
| 149 | 3300009147 | Ga0114129_10051510 | Ga0114129_100515104 | 312 |
| 150 | 3300009147 | Ga0114129_10070342 | Ga0114129_100703422 | 312 |
| 151 | 3300009147 | Ga0114129_10121804 | Ga0114129_101218041 | 312 |
| 152 | 3300009147 | Ga0114129_10709400 | Ga0114129_107094001 | 312 |
| 153 | 3300009174 | Ga0105241_10034576 | Ga0105241_100345763 | 312 |
| 154 | 3300009176 | Ga0105242_10086239 | Ga0105242_100862393 | 312 |
| 155 | 3300009177 | Ga0105248_10000716 | Ga0105248_100007163 | 312 |
| 156 | 3300010375 | Ga0105239_10073872 | Ga0105239_100738722 | 312 |
| 157 | 3300013296 | Ga0157374_10032385 | Ga0157374_100323852 | 312 |
| 158 | 3300013296 | Ga0157374_10038100 | Ga0157374_100381002 | 312 |
| 159 | 3300013306 | Ga0163162_10001473 | Ga0163162_1000147319 | 312 |
| 160 | 3300013306 | Ga0163162_10032693 | Ga0163162_100326933 | 312 |
| 161 | 3300013306 | Ga0163162_10042459 | Ga0163162_100424592 | 312 |
| 162 | 3300013307 | Ga0157372_10057102 | Ga0157372_100571024 | 312 |
| 163 | 3300013308 | Ga0157375_10032215 | Ga0157375_100322154 | 312 |
| 164 | 3300013308 | Ga0157375_10129754 | Ga0157375_101297542 | 312 |
| 165 | 3300014325 | Ga0163163_10010069 | Ga0163163_100100697 | 312 |
| 166 | 3300014325 | Ga0163163_10274066 | Ga0163163_102740662 | 312 |
| 167 | 3300014968 | Ga0157379_10002880 | Ga0157379_100028806 | 312 |
| 168 | 3300014968 | Ga0157379_10597641 | Ga0157379_105976411 | 312 |
| 169 | 3300017792 | Ga0163161_10007192 | Ga0163161_100071924 | 312 |
| 170 | 3300017792 | Ga0163161_10030077 | Ga0163161_100300772 | 312 |
| 171 | 3300025899 | Ga0207642_10050200 | Ga0207642_100502002 | 312 |
| 172 | 3300025900 | Ga0207710_10111185 | Ga0207710_101111851 | 312 |
| 173 | 3300025901 | Ga0207688_10081799 | Ga0207688_100817992 | 312 |
| 174 | 3300025907 | Ga0207645_10011210 | Ga0207645_100112103 | 312 |
| 175 | 3300025909 | Ga0207705_10088782 | Ga0207705_100887822 | 312 |
| 176 | 3300025910 | Ga0207684_10150838 | Ga0207684_101508382 | 312 |
| 177 | 3300025912 | Ga0207707_10001824 | Ga0207707_100018243 | 312 |
| 178 | 3300025917 | Ga0207660_10059459 | Ga0207660_100594592 | 312 |
| 179 | 3300025919 | Ga0207657_10011878 | Ga0207657_100118787 | 312 |
| 180 | 3300025922 | Ga0207646_10000638 | Ga0207646_100006382 | 312 |
| 181 | 3300025922 | Ga0207646_10058273 | Ga0207646_100582732 | 312 |
| 182 | 3300025923 | Ga0207681_10014620 | Ga0207681_100146203 | 312 |
| 183 | 3300025925 | Ga0207650_10047957 | Ga0207650_100479572 | 312 |
| 184 | 3300025926 | Ga0207659_10001424 | Ga0207659_100014241 | 312 |
| 185 | 3300025931 | Ga0207644_10016882 | Ga0207644_100168821 | 312 |
| 186 | 3300025931 | Ga0207644_10054382 | Ga0207644_100543821 | 312 |
| 187 | 3300025932 | Ga0207690_10061334 | Ga0207690_100613342 | 312 |
| 188 | 3300025933 | Ga0207706_10401576 | Ga0207706_104015762 | 312 |
| 189 | 3300025936 | Ga0207670_10005107 | Ga0207670_100051077 | 312 |
| 190 | 3300025936 | Ga0207670_10202781 | Ga0207670_102027811 | 312 |
| 191 | 3300025937 | Ga0207669_10316761 | Ga0207669_103167612 | 312 |
| 192 | 3300025940 | Ga0207691_10030484 | Ga0207691_100304843 | 312 |
| 193 | 3300025940 | Ga0207691_10059775 | Ga0207691_100597753 | 312 |
| 194 | 3300025941 | Ga0207711_10003376 | Ga0207711_100033763 | 312 |
| 195 | 3300025942 | Ga0207689_10191213 | Ga0207689_101912132 | 312 |
| 196 | 3300025945 | Ga0207679_10084303 | Ga0207679_100843031 | 312 |
| 197 | 3300025960 | Ga0207651_10080701 | Ga0207651_100807012 | 312 |
| 198 | 3300025986 | Ga0207658_10017678 | Ga0207658_100176782 | 312 |
| 199 | 3300026023 | Ga0207677_10227405 | Ga0207677_102274052 | 312 |
| 200 | 3300026035 | Ga0207703_10328599 | Ga0207703_103285992 | 312 |
| 201 | 3300026041 | Ga0207639_10246647 | Ga0207639_102466472 | 312 |
| 202 | 3300026075 | Ga0207708_10204808 | Ga0207708_102048082 | 312 |
| 203 | 3300026088 | Ga0207641_10134789 | Ga0207641_101347892 | 312 |
| 204 | 3300026088 | Ga0207641_10441470 | Ga0207641_104414701 | 312 |
| 205 | 3300026095 | Ga0207676_10143042 | Ga0207676_101430422 | 312 |
| 206 | 3300026118 | Ga0207675_100232667 | Ga0207675_1002326672 | 312 |
| 207 | 3300026121 | Ga0207683_10000701 | Ga0207683_1000070125 | 312 |
| 208 | 3300027907 | Ga0207428_10003817 | Ga0207428_100038174 | 312 |
| 209 | 3300027907 | Ga0207428_10193063 | Ga0207428_101930632 | 312 |
| 210 | 3300028381 | Ga0268264_10014021 | Ga0268264_100140214 | 312 |
| 211 | 3300028573 | Ga0265334_10000400 | Ga0265334_1000040019 | 312 |
| 212 | 3300028577 | Ga0265318_10000006 | Ga0265318_10000006127 | 312 |
| 213 | 3300028800 | Ga0265338_10095251 | Ga0265338_100952512 | 312 |
| 214 | 3300031238 | Ga0265332_10029372 | Ga0265332_100293722 | 312 |
| 215 | 3300031240 | Ga0265320_10004878 | Ga0265320_100048789 | 312 |
| 216 | 3300031250 | Ga0265331_10003322 | Ga0265331_100033227 | 312 |
| 217 | 3300031344 | Ga0265316_10024761 | Ga0265316_100247613 | 312 |
| 218 | 3300031595 | Ga0265313_10003448 | Ga0265313_100034487 | 312 |
| 219 | 3300031711 | Ga0265314_10000752 | Ga0265314_1000075221 | 312 |
| 220 | 3300031727 | Ga0316576_10062984 | Ga0316576_100629843 | 312 |
| 221 | 3300031731 | Ga0307405_10052344 | Ga0307405_100523441 | 312 |
| 222 | 3300031852 | Ga0307410_10044698 | Ga0307410_100446984 | 312 |
| 223 | 3300031901 | Ga0307406_10134949 | Ga0307406_101349492 | 312 |
| 224 | 3300032002 | Ga0307416_100141082 | Ga0307416_1001410822 | 312 |
| 225 | 3300032004 | Ga0307414_10197287 | Ga0307414_101972872 | 312 |
| 226 | 3300032004 | Ga0307414_10246928 | Ga0307414_102469282 | 312 |
| 227 | 3300032126 | Ga0307415_100104454 | Ga0307415_1001044543 | 312 |
| 228 | 3300035691 | Ga0373931_0018048 | Ga0373931_0018048_2103_3041 | 312 |
| 229 | 3300035692 | Ga0373935_0243933 | Ga0373935_0243933_155_1093 | 312 |
| 230 | 3300035724 | Ga0373933_0166846 | Ga0373933_0166846_167_1105 | 312 |
| 231 | 3300036401 | Ga0373937_0187160 | Ga0373937_0187160_23_961 | 312 |
| 232 | 3300036647 | Ga0316582_0027369 | Ga0316582_0027369_1778_2719 | 312 |
| 233 | 3300036712 | Ga0316584_0015700 | Ga0316584_0015700_1177_2118 | 312 |
| 234 | 3300038735 | Ga0400485_08379 | Ga0400485_08379_3522_4460 | 312 |
| 235 | 3300038742 | Ga0400486_19814 | Ga0400486_19814_6151_7089 | 312 |
| 236 | 3300039062 | Ga0400483_022312 | Ga0400483_022312_699_1637 | 312 |
| 237 | 3300039093 | Ga0400489_58816 | Ga0400489_58816_140_1078 | 312 |
| 238 | 3300039110 | Ga0400487_22986 | Ga0400487_22986_358_1296 | 312 |
| 239 | 3300039453 | Ga0436362_0246780 | Ga0436362_0246780_271_1209 | 312 |
| 240 | 3300042876 | Ga0451577_0000397 | Ga0451577_0000397_37450_38388 | 312 |
| 241 | 3300042876 | Ga0451577_0008011 | Ga0451577_0008011_3722_4660 | 312 |
| 242 | 3300044673 | Ga0453683_0037656 | Ga0453683_0037656_1257_2195 | 312 |
| 243 | 3300044712 | Ga0453684_0000314 | Ga0453684_0000314_19483_20421 | 312 |
| 244 | 3300044712 | Ga0453684_0001252 | Ga0453684_0001252_41546_42484 | 312 |
| 245 | 3300044712 | Ga0453684_0005086 | Ga0453684_0005086_24410_25348 | 312 |
| 246 | 3300045051 | Ga0451576_0332722 | Ga0451576_0332722_60_998 | 312 |
| 247 | 3300046472 | Ga0495580_0220895 | Ga0495580_0220895_61_999 | 312 |
| 248 | 3300048905 | Ga0496102_0080216 | Ga0496102_0080216_1609_2547 | 312 |
| 249 | 3300048911 | Ga0496108_0471482 | Ga0496108_0471482_22_960 | 312 |
| 250 | 3300048913 | Ga0496110_0182641 | Ga0496110_0182641_750_1688 | 312 |
| 251 | 3300048915 | Ga0496112_0019440 | Ga0496112_0019440_3555_4493 | 312 |
| 252 | 3300048915 | Ga0496112_0135063 | Ga0496112_0135063_785_1723 | 312 |
| 253 | 3300048916 | Ga0496113_0393627 | Ga0496113_0393627_17_955 | 312 |
| 254 | 3300049589 | Ga0501073_0047531 | Ga0501073_0047531_1644_2582 | 312 |
| 255 | 3300049591 | Ga0501075_0195465 | Ga0501075_0195465_542_1483 | 312 |
| 256 | 3300049593 | Ga0501077_0012938 | Ga0501077_0012938_87_1025 | 312 |
| 257 | 3300049742 | Ga0501080_0332887 | Ga0501080_0332887_80_1030 | 312 |
| 258 | 3300050489 | nmdc:mga03683_1_c2 | nmdc:mga03683_1_c2_73053_73991 | 312 |
| 259 | 3300050491 | nmdc:mga00v17_28_c1 | nmdc:mga00v17_28_c1_31618_32556 | 312 |
| 260 | 3300050507 | nmdc:mga05p37_107349_c1 | nmdc:mga05p37_107349_c1_810_1748 | 312 |
| 261 | 3300050507 | nmdc:mga05p37_21058_c1 | nmdc:mga05p37_21058_c1_4478_5416 | 312 |
| 262 | 3300050507 | nmdc:mga05p37_3873_c1 | nmdc:mga05p37_3873_c1_713_1672 | 312 |
| 263 | 3300050507 | nmdc:mga05p37_67737_c1 | nmdc:mga05p37_67737_c1_354_1292 | 312 |
| 264 | 3300050508 | nmdc:mga09592_93646_c1 | nmdc:mga09592_93646_c1_1039_1977 | 312 |
| 265 | 3300050509 | nmdc:mga0qj67_217748_c1 | nmdc:mga0qj67_217748_c1_258_1196 | 312 |
| 266 | 3300050510 | nmdc:mga06r32_300411_c1 | nmdc:mga06r32_300411_c1_74_1018 | 312 |
| 267 | 3300050510 | nmdc:mga06r32_40378_c1 | nmdc:mga06r32_40378_c1_439_1377 | 312 |
| 268 | 3300050511 | nmdc:mga08y16_136769_c1 | nmdc:mga08y16_136769_c1_547_1485 | 312 |
| 269 | 3300050512 | nmdc:mga0n895_1088_c1 | nmdc:mga0n895_1088_c1_10641_11579 | 312 |
| 270 | 3300050512 | nmdc:mga0n895_601529_c1 | nmdc:mga0n895_601529_c1_108_1046 | 312 |
| 271 | 3300050512 | nmdc:mga0n895_62110_c1 | nmdc:mga0n895_62110_c1_1462_2400 | 312 |
| 272 | 3300050513 | nmdc:mga0rr50_129838_c1 | nmdc:mga0rr50_129838_c1_695_1633 | 312 |
| 273 | 3300050513 | nmdc:mga0rr50_52637_c1 | nmdc:mga0rr50_52637_c1_739_1677 | 312 |
| 274 | 3300050515 | nmdc:mga0a205_11035_c1 | nmdc:mga0a205_11035_c1_1771_2730 | 312 |
| 275 | 3300050515 | nmdc:mga0a205_117514_c1 | nmdc:mga0a205_117514_c1_1581_2519 | 312 |
| 276 | 3300050515 | nmdc:mga0a205_1699_c1 | nmdc:mga0a205_1699_c1_2860_3798 | 312 |
| 277 | 3300050515 | nmdc:mga0a205_236149_c1 | nmdc:mga0a205_236149_c1_259_1197 | 312 |
| 278 | 3300050515 | nmdc:mga0a205_8329_c2 | nmdc:mga0a205_8329_c2_874_1812 | 312 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vo6-assembly1.cif.gz_C | crystal structure of cj1427, an essential nad-dependent dehydrogenase from campylobacter jejuni, in the presence of nadh and gdp | 0.9814 | 4 | 311 |
| 6vo8-assembly1.cif.gz_B-2 | x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni | 0.9806 | 4 | 304 |
| 6vo8-assembly1.cif.gz_A-2 | x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni | 0.9766 | 4 | 304 |
| 6vo6-assembly1.cif.gz_C | crystal structure of cj1427, an essential nad-dependent dehydrogenase from campylobacter jejuni, in the presence of nadh and gdp | 0.9716 | 4 | 311 |
| 6vo8-assembly1.cif.gz_B-2 | x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni | 0.9709 | 4 | 304 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4CM81_7_150_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9127 | 4 | 107 | 3.40.50.720 |
| af_Q4CM81_8_135_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9127 | 4 | 107 | 3.40.50.720 |
| af_Q5QMG5_99_194_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9094 | 1 | 96 | 3.40.50.720 |
| 3ru7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8921 | 2 | 166 | 3.40.50.720 |
| af_P72050_1_314_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8893 | 4 | 306 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A554J9M4-F1-model_v4 | UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) | 0.995 | 2 | 117 |
|
| AF-A0A1F7LPB4-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9906 | 4 | 236 |
|
| AF-Q29VV8-F1-model_v4 | Putative nucleotidyl sugar epimerase | 0.9869 | 1 | 253 |
|
| AF-A0A554J9M4-F1-model_v4 | UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) | 0.9865 | 2 | 117 |
|
| AF-S0EZ33-F1-model_v4 | Nucleoside-diphosphate-sugar epimerases | 0.984 | 1 | 312 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar